Go to:
Gentoo Home
Documentation
Forums
Lists
Bugs
Planet
Store
Wiki
Get Gentoo!
Gentoo's Bugzilla – Attachment 42651 Details for
Bug 69067
gentoo-dev-sources-2.6.9-r1 breaks xorg-x11 6.8 compile
Home
|
New
–
[Ex]
|
Browse
|
Search
|
Privacy Policy
|
[?]
|
Reports
|
Requests
|
Help
|
New Account
|
Log In
[x]
|
Forgot Password
Login:
[x]
Outfile from X11.org compile crash
cclQ9PTz.out (text/plain), 721.80 KB, created by
Gordon Bergström
on 2004-10-26 13:58:54 UTC
(
hide
)
Description:
Outfile from X11.org compile crash
Filename:
MIME Type:
Creator:
Gordon Bergström
Created:
2004-10-26 13:58:54 UTC
Size:
721.80 KB
patch
obsolete
>// /usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/cc1 -quiet -I../../../../../../exports/include/X11 -I../../../../../../include/extensions -I../../../../../../extras/Mesa/src/mesa -I../../../../../../extras/Mesa/src/mesa/main -I../../../../../../extras/Mesa/src/mesa/glapi -I../../../../../../extras/Mesa/src/mesa/shader -I../../../../../../extras/Mesa/include -I../../../../../../extras/Mesa/src/mesa/drivers/dri/common -I../../../../../../extras/Mesa/src/mesa/drivers/dri/gamma -I../../../../../../lib/GL/dri -I../../../../../../exports/include/X11 -I../../../../../../lib/GL/glx -I../../../../../../lib/GL/include -I../../../../../../programs/Xserver/GL/dri -I../../../../../../programs/Xserver/hw/xfree86/os-support -I../../../../../../extras/drm/shared -I../../../../../../programs/Xserver/hw/xfree86/drivers/glint -I../../../../../../lib/GL/dri/drm -I../../../../../.. -I../../../../../../exports/include -D__GNUC__=3 -D__GNUC_MINOR__=3 -D__GNUC_PATCHLEVEL__=4 -Dlinux -D__i386__ -D_POSIX_C_SOURCE=199309L -D_POSIX_SOURCE -D_XOPEN_SOURCE -D_BSD_SOURCE -D_SVID_SOURCE -D_GNU_SOURCE -DFUNCPROTO=15 -DNARROWPROTO -DXTHREADS -D_REENTRANT -DXUSE_MTSAFE_API -DMALLOC_0_RETURNS_NULL -DGLXEXT -DXF86DRI -DGLX_DIRECT_RENDERING -DGLX_USE_DLOPEN -DGLX_USE_MESA -DX_BYTE_ORDER=X_LITTLE_ENDIAN -DUSE_X86_ASM gamma_texmem.c -quiet -dumpbase gamma_texmem.c -march=pentium4 -ansi -auxbase gamma_texmem -O3 -pedantic -Wno-return-type -w -ansi -fomit-frame-pointer -fno-strict-aliasing -fPIC -o - -frandom-seed=0 ># 1 "gamma_texmem.c" ># 1 "<built-in>" ># 1 "<command line>" ># 1 "gamma_texmem.c" > > ># 1 "/usr/include/stdlib.h" 1 3 4 ># 25 "/usr/include/stdlib.h" 3 4 ># 1 "/usr/include/features.h" 1 3 4 ># 296 "/usr/include/features.h" 3 4 ># 1 "/usr/include/sys/cdefs.h" 1 3 4 ># 297 "/usr/include/features.h" 2 3 4 ># 319 "/usr/include/features.h" 3 4 ># 1 "/usr/include/gnu/stubs.h" 1 3 4 ># 320 "/usr/include/features.h" 2 3 4 ># 26 "/usr/include/stdlib.h" 2 3 4 > > > > > > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 213 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 3 4 >typedef unsigned int size_t; ># 325 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 3 4 >typedef long int wchar_t; ># 34 "/usr/include/stdlib.h" 2 3 4 > > > > > > > > ># 1 "/usr/include/bits/waitflags.h" 1 3 4 ># 43 "/usr/include/stdlib.h" 2 3 4 ># 1 "/usr/include/bits/waitstatus.h" 1 3 4 ># 63 "/usr/include/bits/waitstatus.h" 3 4 ># 1 "/usr/include/endian.h" 1 3 4 ># 37 "/usr/include/endian.h" 3 4 ># 1 "/usr/include/bits/endian.h" 1 3 4 ># 38 "/usr/include/endian.h" 2 3 4 ># 64 "/usr/include/bits/waitstatus.h" 2 3 4 > >union wait > { > int w_status; > struct > { > > unsigned int __w_termsig:7; > unsigned int __w_coredump:1; > unsigned int __w_retcode:8; > unsigned int:16; > > > > > > > > } __wait_terminated; > struct > { > > unsigned int __w_stopval:8; > unsigned int __w_stopsig:8; > unsigned int:16; > > > > > > > } __wait_stopped; > }; ># 44 "/usr/include/stdlib.h" 2 3 4 ># 68 "/usr/include/stdlib.h" 3 4 >typedef union > { > union wait *__uptr; > int *__iptr; > } __WAIT_STATUS __attribute__ ((__transparent_union__)); ># 93 "/usr/include/stdlib.h" 3 4 > > >typedef struct > { > int quot; > int rem; > } div_t; > > > >typedef struct > { > long int quot; > long int rem; > } ldiv_t; > > > > > > > >__extension__ typedef struct > { > long long int quot; > long long int rem; > } lldiv_t; > > ># 137 "/usr/include/stdlib.h" 3 4 >extern size_t __ctype_get_mb_cur_max (void) ; > > > > >extern double atof (__const char *__nptr) __attribute__ ((__pure__)); > >extern int atoi (__const char *__nptr) __attribute__ ((__pure__)); > >extern long int atol (__const char *__nptr) __attribute__ ((__pure__)); > > > > > >__extension__ extern long long int atoll (__const char *__nptr) > __attribute__ ((__pure__)); > > > > > >extern double strtod (__const char *__restrict __nptr, > char **__restrict __endptr) ; > > > > > >extern float strtof (__const char *__restrict __nptr, > char **__restrict __endptr) ; > >extern long double strtold (__const char *__restrict __nptr, > char **__restrict __endptr) ; > > > > > >extern long int strtol (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) ; > >extern unsigned long int strtoul (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) > ; > > > > >__extension__ >extern long long int strtoq (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) ; > >__extension__ >extern unsigned long long int strtouq (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) > ; > > > > > >__extension__ >extern long long int strtoll (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) ; > >__extension__ >extern unsigned long long int strtoull (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) > ; > ># 225 "/usr/include/stdlib.h" 3 4 ># 1 "/usr/include/xlocale.h" 1 3 4 ># 28 "/usr/include/xlocale.h" 3 4 >typedef struct __locale_struct >{ > > struct locale_data *__locales[13]; > > > const unsigned short int *__ctype_b; > const int *__ctype_tolower; > const int *__ctype_toupper; > > > const char *__names[13]; >} *__locale_t; ># 226 "/usr/include/stdlib.h" 2 3 4 > > > >extern long int strtol_l (__const char *__restrict __nptr, > char **__restrict __endptr, int __base, > __locale_t __loc) ; > >extern unsigned long int strtoul_l (__const char *__restrict __nptr, > char **__restrict __endptr, > int __base, __locale_t __loc) ; > >__extension__ >extern long long int strtoll_l (__const char *__restrict __nptr, > char **__restrict __endptr, int __base, > __locale_t __loc) ; > >__extension__ >extern unsigned long long int strtoull_l (__const char *__restrict __nptr, > char **__restrict __endptr, > int __base, __locale_t __loc) > ; > >extern double strtod_l (__const char *__restrict __nptr, > char **__restrict __endptr, __locale_t __loc) > ; > >extern float strtof_l (__const char *__restrict __nptr, > char **__restrict __endptr, __locale_t __loc) ; > >extern long double strtold_l (__const char *__restrict __nptr, > char **__restrict __endptr, > __locale_t __loc) ; > > > > > > >extern double __strtod_internal (__const char *__restrict __nptr, > char **__restrict __endptr, int __group) > ; >extern float __strtof_internal (__const char *__restrict __nptr, > char **__restrict __endptr, int __group) > ; >extern long double __strtold_internal (__const char *__restrict __nptr, > char **__restrict __endptr, > int __group) ; > >extern long int __strtol_internal (__const char *__restrict __nptr, > char **__restrict __endptr, > int __base, int __group) ; > > > >extern unsigned long int __strtoul_internal (__const char *__restrict __nptr, > char **__restrict __endptr, > int __base, int __group) ; > > > > >__extension__ >extern long long int __strtoll_internal (__const char *__restrict __nptr, > char **__restrict __endptr, > int __base, int __group) ; > > > >__extension__ >extern unsigned long long int __strtoull_internal (__const char * > __restrict __nptr, > char **__restrict __endptr, > int __base, int __group) > ; > > > > > > > > >extern __inline double >strtod (__const char *__restrict __nptr, char **__restrict __endptr) >{ > return __strtod_internal (__nptr, __endptr, 0); >} >extern __inline long int >strtol (__const char *__restrict __nptr, char **__restrict __endptr, > int __base) >{ > return __strtol_internal (__nptr, __endptr, __base, 0); >} >extern __inline unsigned long int >strtoul (__const char *__restrict __nptr, char **__restrict __endptr, > int __base) >{ > return __strtoul_internal (__nptr, __endptr, __base, 0); >} > > > > >extern __inline float >strtof (__const char *__restrict __nptr, char **__restrict __endptr) >{ > return __strtof_internal (__nptr, __endptr, 0); >} >extern __inline long double >strtold (__const char *__restrict __nptr, char **__restrict __endptr) >{ > return __strtold_internal (__nptr, __endptr, 0); >} > > > > >__extension__ extern __inline long long int >strtoq (__const char *__restrict __nptr, char **__restrict __endptr, > int __base) >{ > return __strtoll_internal (__nptr, __endptr, __base, 0); >} >__extension__ extern __inline unsigned long long int >strtouq (__const char *__restrict __nptr, char **__restrict __endptr, > int __base) >{ > return __strtoull_internal (__nptr, __endptr, __base, 0); >} > > > > >__extension__ extern __inline long long int >strtoll (__const char *__restrict __nptr, char **__restrict __endptr, > int __base) >{ > return __strtoll_internal (__nptr, __endptr, __base, 0); >} >__extension__ extern __inline unsigned long long int >strtoull (__const char * __restrict __nptr, char **__restrict __endptr, > int __base) >{ > return __strtoull_internal (__nptr, __endptr, __base, 0); >} > > > > >extern __inline double >atof (__const char *__nptr) >{ > return strtod (__nptr, (char **) ((void *)0)); >} >extern __inline int >atoi (__const char *__nptr) >{ > return (int) strtol (__nptr, (char **) ((void *)0), 10); >} >extern __inline long int >atol (__const char *__nptr) >{ > return strtol (__nptr, (char **) ((void *)0), 10); >} > > > > >__extension__ extern __inline long long int >atoll (__const char *__nptr) >{ > return strtoll (__nptr, (char **) ((void *)0), 10); >} > ># 408 "/usr/include/stdlib.h" 3 4 >extern char *l64a (long int __n) ; > > >extern long int a64l (__const char *__s) __attribute__ ((__pure__)); > > > > ># 1 "/usr/include/sys/types.h" 1 3 4 ># 29 "/usr/include/sys/types.h" 3 4 > > ># 1 "/usr/include/bits/types.h" 1 3 4 ># 28 "/usr/include/bits/types.h" 3 4 ># 1 "/usr/include/bits/wordsize.h" 1 3 4 ># 29 "/usr/include/bits/types.h" 2 3 4 > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 32 "/usr/include/bits/types.h" 2 3 4 > > >typedef unsigned char __u_char; >typedef unsigned short int __u_short; >typedef unsigned int __u_int; >typedef unsigned long int __u_long; > > >typedef signed char __int8_t; >typedef unsigned char __uint8_t; >typedef signed short int __int16_t; >typedef unsigned short int __uint16_t; >typedef signed int __int32_t; >typedef unsigned int __uint32_t; > > > > >__extension__ typedef signed long long int __int64_t; >__extension__ typedef unsigned long long int __uint64_t; > > > > > > > >__extension__ typedef long long int __quad_t; >__extension__ typedef unsigned long long int __u_quad_t; ># 129 "/usr/include/bits/types.h" 3 4 ># 1 "/usr/include/bits/typesizes.h" 1 3 4 ># 130 "/usr/include/bits/types.h" 2 3 4 > > > > > > >__extension__ typedef unsigned long long int __dev_t; >__extension__ typedef unsigned int __uid_t; >__extension__ typedef unsigned int __gid_t; >__extension__ typedef unsigned long int __ino_t; >__extension__ typedef unsigned long long int __ino64_t; >__extension__ typedef unsigned int __mode_t; >__extension__ typedef unsigned int __nlink_t; >__extension__ typedef long int __off_t; >__extension__ typedef long long int __off64_t; >__extension__ typedef int __pid_t; >__extension__ typedef struct { int __val[2]; } __fsid_t; >__extension__ typedef long int __clock_t; >__extension__ typedef unsigned long int __rlim_t; >__extension__ typedef unsigned long long int __rlim64_t; >__extension__ typedef unsigned int __id_t; >__extension__ typedef long int __time_t; >__extension__ typedef unsigned int __useconds_t; >__extension__ typedef long int __suseconds_t; > >__extension__ typedef int __daddr_t; >__extension__ typedef long int __swblk_t; >__extension__ typedef int __key_t; > > >__extension__ typedef int __clockid_t; > > >__extension__ typedef int __timer_t; > > >__extension__ typedef long int __blksize_t; > > > > >__extension__ typedef long int __blkcnt_t; >__extension__ typedef long long int __blkcnt64_t; > > >__extension__ typedef unsigned long int __fsblkcnt_t; >__extension__ typedef unsigned long long int __fsblkcnt64_t; > > >__extension__ typedef unsigned long int __fsfilcnt_t; >__extension__ typedef unsigned long long int __fsfilcnt64_t; > >__extension__ typedef int __ssize_t; > > > >typedef __off64_t __loff_t; >typedef __quad_t *__qaddr_t; >typedef char *__caddr_t; > > >__extension__ typedef int __intptr_t; > > >__extension__ typedef unsigned int __socklen_t; ># 32 "/usr/include/sys/types.h" 2 3 4 > > > >typedef __u_char u_char; >typedef __u_short u_short; >typedef __u_int u_int; >typedef __u_long u_long; >typedef __quad_t quad_t; >typedef __u_quad_t u_quad_t; >typedef __fsid_t fsid_t; > > > > >typedef __loff_t loff_t; > > > >typedef __ino_t ino_t; > > > > > > >typedef __ino64_t ino64_t; > > > > >typedef __dev_t dev_t; > > > > >typedef __gid_t gid_t; > > > > >typedef __mode_t mode_t; > > > > >typedef __nlink_t nlink_t; > > > > >typedef __uid_t uid_t; > > > > > >typedef __off_t off_t; > > > > > > >typedef __off64_t off64_t; > > > > >typedef __pid_t pid_t; > > > > >typedef __id_t id_t; > > > > >typedef __ssize_t ssize_t; > > > > > >typedef __daddr_t daddr_t; >typedef __caddr_t caddr_t; > > > > > >typedef __key_t key_t; ># 133 "/usr/include/sys/types.h" 3 4 ># 1 "/usr/include/time.h" 1 3 4 ># 58 "/usr/include/time.h" 3 4 > > >typedef __clock_t clock_t; > > > ># 74 "/usr/include/time.h" 3 4 > > >typedef __time_t time_t; > > > ># 92 "/usr/include/time.h" 3 4 >typedef __clockid_t clockid_t; ># 104 "/usr/include/time.h" 3 4 >typedef __timer_t timer_t; ># 134 "/usr/include/sys/types.h" 2 3 4 > > > >typedef __useconds_t useconds_t; > > > >typedef __suseconds_t suseconds_t; > > > > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 148 "/usr/include/sys/types.h" 2 3 4 > > > >typedef unsigned long int ulong; >typedef unsigned short int ushort; >typedef unsigned int uint; ># 191 "/usr/include/sys/types.h" 3 4 >typedef int int8_t __attribute__ ((__mode__ (__QI__))); >typedef int int16_t __attribute__ ((__mode__ (__HI__))); >typedef int int32_t __attribute__ ((__mode__ (__SI__))); >typedef int int64_t __attribute__ ((__mode__ (__DI__))); > > >typedef unsigned int u_int8_t __attribute__ ((__mode__ (__QI__))); >typedef unsigned int u_int16_t __attribute__ ((__mode__ (__HI__))); >typedef unsigned int u_int32_t __attribute__ ((__mode__ (__SI__))); >typedef unsigned int u_int64_t __attribute__ ((__mode__ (__DI__))); > >typedef int register_t __attribute__ ((__mode__ (__word__))); ># 216 "/usr/include/sys/types.h" 3 4 ># 1 "/usr/include/sys/select.h" 1 3 4 ># 31 "/usr/include/sys/select.h" 3 4 ># 1 "/usr/include/bits/select.h" 1 3 4 ># 32 "/usr/include/sys/select.h" 2 3 4 > > ># 1 "/usr/include/bits/sigset.h" 1 3 4 ># 23 "/usr/include/bits/sigset.h" 3 4 >typedef int __sig_atomic_t; > > > > >typedef struct > { > unsigned long int __val[(1024 / (8 * sizeof (unsigned long int)))]; > } __sigset_t; ># 35 "/usr/include/sys/select.h" 2 3 4 > > > >typedef __sigset_t sigset_t; > > > > > ># 1 "/usr/include/time.h" 1 3 4 ># 118 "/usr/include/time.h" 3 4 >struct timespec > { > __time_t tv_sec; > long int tv_nsec; > }; ># 45 "/usr/include/sys/select.h" 2 3 4 > ># 1 "/usr/include/bits/time.h" 1 3 4 ># 69 "/usr/include/bits/time.h" 3 4 >struct timeval > { > __time_t tv_sec; > __suseconds_t tv_usec; > }; ># 47 "/usr/include/sys/select.h" 2 3 4 ># 55 "/usr/include/sys/select.h" 3 4 >typedef long int __fd_mask; ># 67 "/usr/include/sys/select.h" 3 4 >typedef struct > { > > > > __fd_mask fds_bits[1024 / (8 * sizeof (__fd_mask))]; > > > > > > } fd_set; > > > > > > >typedef __fd_mask fd_mask; ># 99 "/usr/include/sys/select.h" 3 4 > ># 109 "/usr/include/sys/select.h" 3 4 >extern int select (int __nfds, fd_set *__restrict __readfds, > fd_set *__restrict __writefds, > fd_set *__restrict __exceptfds, > struct timeval *__restrict __timeout); ># 121 "/usr/include/sys/select.h" 3 4 >extern int pselect (int __nfds, fd_set *__restrict __readfds, > fd_set *__restrict __writefds, > fd_set *__restrict __exceptfds, > const struct timespec *__restrict __timeout, > const __sigset_t *__restrict __sigmask); > > > ># 217 "/usr/include/sys/types.h" 2 3 4 > > ># 1 "/usr/include/sys/sysmacros.h" 1 3 4 ># 29 "/usr/include/sys/sysmacros.h" 3 4 >__extension__ >extern __inline unsigned int gnu_dev_major (unsigned long long int __dev) > ; >__extension__ >extern __inline unsigned int gnu_dev_minor (unsigned long long int __dev) > ; >__extension__ >extern __inline unsigned long long int gnu_dev_makedev (unsigned int __major, > unsigned int __minor) > ; > > >__extension__ extern __inline unsigned int >gnu_dev_major (unsigned long long int __dev) >{ > return ((__dev >> 8) & 0xfff) | ((unsigned int) (__dev >> 32) & ~0xfff); >} > >__extension__ extern __inline unsigned int >gnu_dev_minor (unsigned long long int __dev) >{ > return (__dev & 0xff) | ((unsigned int) (__dev >> 12) & ~0xff); >} > >__extension__ extern __inline unsigned long long int >gnu_dev_makedev (unsigned int __major, unsigned int __minor) >{ > return ((__minor & 0xff) | ((__major & 0xfff) << 8) > | (((unsigned long long int) (__minor & ~0xff)) << 12) > | (((unsigned long long int) (__major & ~0xfff)) << 32)); >} ># 220 "/usr/include/sys/types.h" 2 3 4 > > > > >typedef __blksize_t blksize_t; > > > > > > >typedef __blkcnt_t blkcnt_t; > > > >typedef __fsblkcnt_t fsblkcnt_t; > > > >typedef __fsfilcnt_t fsfilcnt_t; ># 258 "/usr/include/sys/types.h" 3 4 >typedef __blkcnt64_t blkcnt64_t; >typedef __fsblkcnt64_t fsblkcnt64_t; >typedef __fsfilcnt64_t fsfilcnt64_t; > > > > > ># 1 "/usr/include/bits/pthreadtypes.h" 1 3 4 ># 23 "/usr/include/bits/pthreadtypes.h" 3 4 ># 1 "/usr/include/bits/sched.h" 1 3 4 ># 83 "/usr/include/bits/sched.h" 3 4 >struct __sched_param > { > int __sched_priority; > }; ># 24 "/usr/include/bits/pthreadtypes.h" 2 3 4 > > >struct _pthread_fastlock >{ > long int __status; > int __spinlock; > >}; > > > >typedef struct _pthread_descr_struct *_pthread_descr; > > > > > >typedef struct __pthread_attr_s >{ > int __detachstate; > int __schedpolicy; > struct __sched_param __schedparam; > int __inheritsched; > int __scope; > size_t __guardsize; > int __stackaddr_set; > void *__stackaddr; > size_t __stacksize; >} pthread_attr_t; > > > > > >__extension__ typedef long long __pthread_cond_align_t; > > > > >typedef struct >{ > struct _pthread_fastlock __c_lock; > _pthread_descr __c_waiting; > char __padding[48 - sizeof (struct _pthread_fastlock) > - sizeof (_pthread_descr) - sizeof (__pthread_cond_align_t)]; > __pthread_cond_align_t __align; >} pthread_cond_t; > > > >typedef struct >{ > int __dummy; >} pthread_condattr_t; > > >typedef unsigned int pthread_key_t; > > > > > >typedef struct >{ > int __m_reserved; > int __m_count; > _pthread_descr __m_owner; > int __m_kind; > struct _pthread_fastlock __m_lock; >} pthread_mutex_t; > > > >typedef struct >{ > int __mutexkind; >} pthread_mutexattr_t; > > > >typedef int pthread_once_t; > > > > >typedef struct _pthread_rwlock_t >{ > struct _pthread_fastlock __rw_lock; > int __rw_readers; > _pthread_descr __rw_writer; > _pthread_descr __rw_read_waiting; > _pthread_descr __rw_write_waiting; > int __rw_kind; > int __rw_pshared; >} pthread_rwlock_t; > > > >typedef struct >{ > int __lockkind; > int __pshared; >} pthread_rwlockattr_t; > > > > >typedef volatile int pthread_spinlock_t; > > >typedef struct { > struct _pthread_fastlock __ba_lock; > int __ba_required; > int __ba_present; > _pthread_descr __ba_waiting; >} pthread_barrier_t; > > >typedef struct { > int __pshared; >} pthread_barrierattr_t; > > > > > >typedef unsigned long int pthread_t; ># 267 "/usr/include/sys/types.h" 2 3 4 > > > ># 417 "/usr/include/stdlib.h" 2 3 4 > > > > > > >extern long int random (void) ; > > >extern void srandom (unsigned int __seed) ; > > > > > >extern char *initstate (unsigned int __seed, char *__statebuf, > size_t __statelen) ; > > > >extern char *setstate (char *__statebuf) ; > > > > > > > >struct random_data > { > int32_t *fptr; > int32_t *rptr; > int32_t *state; > int rand_type; > int rand_deg; > int rand_sep; > int32_t *end_ptr; > }; > >extern int random_r (struct random_data *__restrict __buf, > int32_t *__restrict __result) ; > >extern int srandom_r (unsigned int __seed, struct random_data *__buf) ; > >extern int initstate_r (unsigned int __seed, char *__restrict __statebuf, > size_t __statelen, > struct random_data *__restrict __buf) ; > >extern int setstate_r (char *__restrict __statebuf, > struct random_data *__restrict __buf) ; > > > > > > >extern int rand (void) ; > >extern void srand (unsigned int __seed) ; > > > > >extern int rand_r (unsigned int *__seed) ; > > > > > > > >extern double drand48 (void) ; >extern double erand48 (unsigned short int __xsubi[3]) ; > > >extern long int lrand48 (void) ; >extern long int nrand48 (unsigned short int __xsubi[3]) ; > > >extern long int mrand48 (void) ; >extern long int jrand48 (unsigned short int __xsubi[3]) ; > > >extern void srand48 (long int __seedval) ; >extern unsigned short int *seed48 (unsigned short int __seed16v[3]) ; >extern void lcong48 (unsigned short int __param[7]) ; > > > > > >struct drand48_data > { > unsigned short int __x[3]; > unsigned short int __old_x[3]; > unsigned short int __c; > unsigned short int __init; > unsigned long long int __a; > }; > > >extern int drand48_r (struct drand48_data *__restrict __buffer, > double *__restrict __result) ; >extern int erand48_r (unsigned short int __xsubi[3], > struct drand48_data *__restrict __buffer, > double *__restrict __result) ; > > >extern int lrand48_r (struct drand48_data *__restrict __buffer, > long int *__restrict __result) ; >extern int nrand48_r (unsigned short int __xsubi[3], > struct drand48_data *__restrict __buffer, > long int *__restrict __result) ; > > >extern int mrand48_r (struct drand48_data *__restrict __buffer, > long int *__restrict __result) ; >extern int jrand48_r (unsigned short int __xsubi[3], > struct drand48_data *__restrict __buffer, > long int *__restrict __result) ; > > >extern int srand48_r (long int __seedval, struct drand48_data *__buffer) > ; > >extern int seed48_r (unsigned short int __seed16v[3], > struct drand48_data *__buffer) ; > >extern int lcong48_r (unsigned short int __param[7], > struct drand48_data *__buffer) ; > > > > > > > > > >extern void *malloc (size_t __size) __attribute__ ((__malloc__)); > >extern void *calloc (size_t __nmemb, size_t __size) > __attribute__ ((__malloc__)); > > > > > > > >extern void *realloc (void *__ptr, size_t __size) __attribute__ ((__malloc__)); > >extern void free (void *__ptr) ; > > > > >extern void cfree (void *__ptr) ; > > > ># 1 "/usr/include/alloca.h" 1 3 4 ># 25 "/usr/include/alloca.h" 3 4 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 26 "/usr/include/alloca.h" 2 3 4 > > > > > > > >extern void *alloca (size_t __size) ; > > > > > > ># 579 "/usr/include/stdlib.h" 2 3 4 > > > > >extern void *valloc (size_t __size) __attribute__ ((__malloc__)); > > > > >extern int posix_memalign (void **__memptr, size_t __alignment, size_t __size) > __attribute__ ((__malloc__)); > > > > >extern void abort (void) __attribute__ ((__noreturn__)); > > > >extern int atexit (void (*__func) (void)) ; > > > > > >extern int on_exit (void (*__func) (int __status, void *__arg), void *__arg) > ; > > > > > > >extern void exit (int __status) __attribute__ ((__noreturn__)); > > > > > > >extern void _Exit (int __status) __attribute__ ((__noreturn__)); > > > > > > >extern char *getenv (__const char *__name) ; > > > > >extern char *__secure_getenv (__const char *__name) ; > > > > > >extern int putenv (char *__string) ; > > > > > >extern int setenv (__const char *__name, __const char *__value, int __replace) > ; > > >extern int unsetenv (__const char *__name) ; > > > > > > >extern int clearenv (void) ; ># 663 "/usr/include/stdlib.h" 3 4 >extern char *mktemp (char *__template) ; ># 674 "/usr/include/stdlib.h" 3 4 >extern int mkstemp (char *__template); ># 683 "/usr/include/stdlib.h" 3 4 >extern int mkstemp64 (char *__template); ># 693 "/usr/include/stdlib.h" 3 4 >extern char *mkdtemp (char *__template) ; > > > > > > > > >extern int system (__const char *__command); > > > > > > > >extern char *canonicalize_file_name (__const char *__name) ; ># 720 "/usr/include/stdlib.h" 3 4 >extern char *realpath (__const char *__restrict __name, > char *__restrict __resolved) ; > > > > > > >typedef int (*__compar_fn_t) (__const void *, __const void *); > > >typedef __compar_fn_t comparison_fn_t; > > > > > > >extern void *bsearch (__const void *__key, __const void *__base, > size_t __nmemb, size_t __size, __compar_fn_t __compar); > > > >extern void qsort (void *__base, size_t __nmemb, size_t __size, > __compar_fn_t __compar); > > > >extern int abs (int __x) __attribute__ ((__const__)); >extern long int labs (long int __x) __attribute__ ((__const__)); > > > >__extension__ extern long long int llabs (long long int __x) > __attribute__ ((__const__)); > > > > > > > >extern div_t div (int __numer, int __denom) > __attribute__ ((__const__)); >extern ldiv_t ldiv (long int __numer, long int __denom) > __attribute__ ((__const__)); > > > > >__extension__ extern lldiv_t lldiv (long long int __numer, > long long int __denom) > __attribute__ ((__const__)); > ># 784 "/usr/include/stdlib.h" 3 4 >extern char *ecvt (double __value, int __ndigit, int *__restrict __decpt, > int *__restrict __sign) ; > > > > >extern char *fcvt (double __value, int __ndigit, int *__restrict __decpt, > int *__restrict __sign) ; > > > > >extern char *gcvt (double __value, int __ndigit, char *__buf) ; > > > > >extern char *qecvt (long double __value, int __ndigit, > int *__restrict __decpt, int *__restrict __sign) ; >extern char *qfcvt (long double __value, int __ndigit, > int *__restrict __decpt, int *__restrict __sign) ; >extern char *qgcvt (long double __value, int __ndigit, char *__buf) ; > > > > >extern int ecvt_r (double __value, int __ndigit, int *__restrict __decpt, > int *__restrict __sign, char *__restrict __buf, > size_t __len) ; >extern int fcvt_r (double __value, int __ndigit, int *__restrict __decpt, > int *__restrict __sign, char *__restrict __buf, > size_t __len) ; > >extern int qecvt_r (long double __value, int __ndigit, > int *__restrict __decpt, int *__restrict __sign, > char *__restrict __buf, size_t __len) ; >extern int qfcvt_r (long double __value, int __ndigit, > int *__restrict __decpt, int *__restrict __sign, > char *__restrict __buf, size_t __len) ; > > > > > > > >extern int mblen (__const char *__s, size_t __n) ; > > >extern int mbtowc (wchar_t *__restrict __pwc, > __const char *__restrict __s, size_t __n) ; > > >extern int wctomb (char *__s, wchar_t __wchar) ; > > > >extern size_t mbstowcs (wchar_t *__restrict __pwcs, > __const char *__restrict __s, size_t __n) ; > >extern size_t wcstombs (char *__restrict __s, > __const wchar_t *__restrict __pwcs, size_t __n) > ; > > > > > > > > >extern int rpmatch (__const char *__response) ; ># 866 "/usr/include/stdlib.h" 3 4 >extern int getsubopt (char **__restrict __optionp, > char *__const *__restrict __tokens, > char **__restrict __valuep) ; > > > > > >extern void setkey (__const char *__key) ; > > > > > > > >extern int posix_openpt (int __oflag); > > > > > > > >extern int grantpt (int __fd) ; > > > >extern int unlockpt (int __fd) ; > > > > >extern char *ptsname (int __fd) ; > > > > > > >extern int ptsname_r (int __fd, char *__buf, size_t __buflen) ; > > >extern int getpt (void); > > > > > > >extern int getloadavg (double __loadavg[], int __nelem) ; > > > > > > ># 4 "gamma_texmem.c" 2 ># 1 "/usr/include/stdio.h" 1 3 4 ># 30 "/usr/include/stdio.h" 3 4 > > > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 35 "/usr/include/stdio.h" 2 3 4 ># 44 "/usr/include/stdio.h" 3 4 > > >typedef struct _IO_FILE FILE; > > > > > ># 62 "/usr/include/stdio.h" 3 4 >typedef struct _IO_FILE __FILE; ># 72 "/usr/include/stdio.h" 3 4 ># 1 "/usr/include/libio.h" 1 3 4 ># 32 "/usr/include/libio.h" 3 4 ># 1 "/usr/include/_G_config.h" 1 3 4 ># 14 "/usr/include/_G_config.h" 3 4 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 354 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 3 4 >typedef unsigned int wint_t; ># 15 "/usr/include/_G_config.h" 2 3 4 ># 24 "/usr/include/_G_config.h" 3 4 ># 1 "/usr/include/wchar.h" 1 3 4 ># 48 "/usr/include/wchar.h" 3 4 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 49 "/usr/include/wchar.h" 2 3 4 > ># 1 "/usr/include/bits/wchar.h" 1 3 4 ># 51 "/usr/include/wchar.h" 2 3 4 ># 76 "/usr/include/wchar.h" 3 4 >typedef struct >{ > int __count; > union > { > wint_t __wch; > char __wchb[4]; > } __value; >} __mbstate_t; ># 25 "/usr/include/_G_config.h" 2 3 4 > >typedef struct >{ > __off_t __pos; > __mbstate_t __state; >} _G_fpos_t; >typedef struct >{ > __off64_t __pos; > __mbstate_t __state; >} _G_fpos64_t; ># 44 "/usr/include/_G_config.h" 3 4 ># 1 "/usr/include/gconv.h" 1 3 4 ># 28 "/usr/include/gconv.h" 3 4 ># 1 "/usr/include/wchar.h" 1 3 4 ># 48 "/usr/include/wchar.h" 3 4 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 49 "/usr/include/wchar.h" 2 3 4 ># 29 "/usr/include/gconv.h" 2 3 4 > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 32 "/usr/include/gconv.h" 2 3 4 > > > > > >enum >{ > __GCONV_OK = 0, > __GCONV_NOCONV, > __GCONV_NODB, > __GCONV_NOMEM, > > __GCONV_EMPTY_INPUT, > __GCONV_FULL_OUTPUT, > __GCONV_ILLEGAL_INPUT, > __GCONV_INCOMPLETE_INPUT, > > __GCONV_ILLEGAL_DESCRIPTOR, > __GCONV_INTERNAL_ERROR >}; > > > >enum >{ > __GCONV_IS_LAST = 0x0001, > __GCONV_IGNORE_ERRORS = 0x0002 >}; > > > >struct __gconv_step; >struct __gconv_step_data; >struct __gconv_loaded_object; >struct __gconv_trans_data; > > > >typedef int (*__gconv_fct) (struct __gconv_step *, struct __gconv_step_data *, > __const unsigned char **, __const unsigned char *, > unsigned char **, size_t *, int, int); > > >typedef wint_t (*__gconv_btowc_fct) (struct __gconv_step *, unsigned char); > > >typedef int (*__gconv_init_fct) (struct __gconv_step *); >typedef void (*__gconv_end_fct) (struct __gconv_step *); > > > >typedef int (*__gconv_trans_fct) (struct __gconv_step *, > struct __gconv_step_data *, void *, > __const unsigned char *, > __const unsigned char **, > __const unsigned char *, unsigned char **, > size_t *); > > >typedef int (*__gconv_trans_context_fct) (void *, __const unsigned char *, > __const unsigned char *, > unsigned char *, unsigned char *); > > >typedef int (*__gconv_trans_query_fct) (__const char *, __const char ***, > size_t *); > > >typedef int (*__gconv_trans_init_fct) (void **, const char *); >typedef void (*__gconv_trans_end_fct) (void *); > >struct __gconv_trans_data >{ > > __gconv_trans_fct __trans_fct; > __gconv_trans_context_fct __trans_context_fct; > __gconv_trans_end_fct __trans_end_fct; > void *__data; > struct __gconv_trans_data *__next; >}; > > > >struct __gconv_step >{ > struct __gconv_loaded_object *__shlib_handle; > __const char *__modname; > > int __counter; > > char *__from_name; > char *__to_name; > > __gconv_fct __fct; > __gconv_btowc_fct __btowc_fct; > __gconv_init_fct __init_fct; > __gconv_end_fct __end_fct; > > > > int __min_needed_from; > int __max_needed_from; > int __min_needed_to; > int __max_needed_to; > > > int __stateful; > > void *__data; >}; > > > >struct __gconv_step_data >{ > unsigned char *__outbuf; > unsigned char *__outbufend; > > > > int __flags; > > > > int __invocation_counter; > > > > int __internal_use; > > __mbstate_t *__statep; > __mbstate_t __state; > > > > struct __gconv_trans_data *__trans; >}; > > > >typedef struct __gconv_info >{ > size_t __nsteps; > struct __gconv_step *__steps; > __extension__ struct __gconv_step_data __data []; >} *__gconv_t; ># 45 "/usr/include/_G_config.h" 2 3 4 >typedef union >{ > struct __gconv_info __cd; > struct > { > struct __gconv_info __cd; > struct __gconv_step_data __data; > } __combined; >} _G_iconv_t; > >typedef int _G_int16_t __attribute__ ((__mode__ (__HI__))); >typedef int _G_int32_t __attribute__ ((__mode__ (__SI__))); >typedef unsigned int _G_uint16_t __attribute__ ((__mode__ (__HI__))); >typedef unsigned int _G_uint32_t __attribute__ ((__mode__ (__SI__))); ># 33 "/usr/include/libio.h" 2 3 4 ># 53 "/usr/include/libio.h" 3 4 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stdarg.h" 1 3 4 ># 43 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stdarg.h" 3 4 >typedef __builtin_va_list __gnuc_va_list; ># 54 "/usr/include/libio.h" 2 3 4 ># 163 "/usr/include/libio.h" 3 4 >struct _IO_jump_t; struct _IO_FILE; ># 173 "/usr/include/libio.h" 3 4 >typedef void _IO_lock_t; > > > > > >struct _IO_marker { > struct _IO_marker *_next; > struct _IO_FILE *_sbuf; > > > > int _pos; ># 196 "/usr/include/libio.h" 3 4 >}; > > >enum __codecvt_result >{ > __codecvt_ok, > __codecvt_partial, > __codecvt_error, > __codecvt_noconv >}; ># 264 "/usr/include/libio.h" 3 4 >struct _IO_FILE { > int _flags; > > > > > char* _IO_read_ptr; > char* _IO_read_end; > char* _IO_read_base; > char* _IO_write_base; > char* _IO_write_ptr; > char* _IO_write_end; > char* _IO_buf_base; > char* _IO_buf_end; > > char *_IO_save_base; > char *_IO_backup_base; > char *_IO_save_end; > > struct _IO_marker *_markers; > > struct _IO_FILE *_chain; > > int _fileno; > > > > int _flags2; > > __off_t _old_offset; > > > > unsigned short _cur_column; > signed char _vtable_offset; > char _shortbuf[1]; > > > > _IO_lock_t *_lock; ># 312 "/usr/include/libio.h" 3 4 > __off64_t _offset; > > > > > > void *__pad1; > void *__pad2; > > int _mode; > > char _unused2[15 * sizeof (int) - 2 * sizeof (void *)]; > >}; > > >typedef struct _IO_FILE _IO_FILE; > > >struct _IO_FILE_plus; > >extern struct _IO_FILE_plus _IO_2_1_stdin_; >extern struct _IO_FILE_plus _IO_2_1_stdout_; >extern struct _IO_FILE_plus _IO_2_1_stderr_; ># 351 "/usr/include/libio.h" 3 4 >typedef __ssize_t __io_read_fn (void *__cookie, char *__buf, size_t __nbytes); > > > > > > > >typedef __ssize_t __io_write_fn (void *__cookie, __const char *__buf, > size_t __n); > > > > > > > >typedef int __io_seek_fn (void *__cookie, __off64_t *__pos, int __w); > > >typedef int __io_close_fn (void *__cookie); > > > > >typedef __io_read_fn cookie_read_function_t; >typedef __io_write_fn cookie_write_function_t; >typedef __io_seek_fn cookie_seek_function_t; >typedef __io_close_fn cookie_close_function_t; > > >typedef struct >{ > __io_read_fn *read; > __io_write_fn *write; > __io_seek_fn *seek; > __io_close_fn *close; >} _IO_cookie_io_functions_t; >typedef _IO_cookie_io_functions_t cookie_io_functions_t; > >struct _IO_cookie_file; > > >extern void _IO_cookie_init (struct _IO_cookie_file *__cfile, int __read_write, > void *__cookie, _IO_cookie_io_functions_t __fns); > > > > > > > >extern int __underflow (_IO_FILE *) ; >extern int __uflow (_IO_FILE *) ; >extern int __overflow (_IO_FILE *, int) ; >extern wint_t __wunderflow (_IO_FILE *) ; >extern wint_t __wuflow (_IO_FILE *) ; >extern wint_t __woverflow (_IO_FILE *, wint_t) ; ># 441 "/usr/include/libio.h" 3 4 >extern int _IO_getc (_IO_FILE *__fp) ; >extern int _IO_putc (int __c, _IO_FILE *__fp) ; >extern int _IO_feof (_IO_FILE *__fp) ; >extern int _IO_ferror (_IO_FILE *__fp) ; > >extern int _IO_peekc_locked (_IO_FILE *__fp) ; > > > > > >extern void _IO_flockfile (_IO_FILE *) ; >extern void _IO_funlockfile (_IO_FILE *) ; >extern int _IO_ftrylockfile (_IO_FILE *) ; ># 471 "/usr/include/libio.h" 3 4 >extern int _IO_vfscanf (_IO_FILE * __restrict, const char * __restrict, > __gnuc_va_list, int *__restrict) ; >extern int _IO_vfprintf (_IO_FILE *__restrict, const char *__restrict, > __gnuc_va_list) ; >extern __ssize_t _IO_padn (_IO_FILE *, int, __ssize_t) ; >extern size_t _IO_sgetn (_IO_FILE *, void *, size_t) ; > >extern __off64_t _IO_seekoff (_IO_FILE *, __off64_t, int, int) ; >extern __off64_t _IO_seekpos (_IO_FILE *, __off64_t, int) ; > >extern void _IO_free_backup_area (_IO_FILE *) ; ># 73 "/usr/include/stdio.h" 2 3 4 > > > > >typedef __gnuc_va_list va_list; ># 86 "/usr/include/stdio.h" 3 4 > > >typedef _G_fpos_t fpos_t; > > > > > >typedef _G_fpos64_t fpos64_t; ># 138 "/usr/include/stdio.h" 3 4 ># 1 "/usr/include/bits/stdio_lim.h" 1 3 4 ># 139 "/usr/include/stdio.h" 2 3 4 > > > >extern struct _IO_FILE *stdin; >extern struct _IO_FILE *stdout; >extern struct _IO_FILE *stderr; > > > > > > > >extern int remove (__const char *__filename) ; > >extern int rename (__const char *__old, __const char *__new) ; > > > > > > > > > >extern FILE *tmpfile (void); ># 174 "/usr/include/stdio.h" 3 4 >extern FILE *tmpfile64 (void); > > > >extern char *tmpnam (char *__s) ; > > > > > >extern char *tmpnam_r (char *__s) ; ># 196 "/usr/include/stdio.h" 3 4 >extern char *tempnam (__const char *__dir, __const char *__pfx) > __attribute__ ((__malloc__)); > > > > > > > > >extern int fclose (FILE *__stream); > > > > >extern int fflush (FILE *__stream); > ># 221 "/usr/include/stdio.h" 3 4 >extern int fflush_unlocked (FILE *__stream); ># 231 "/usr/include/stdio.h" 3 4 >extern int fcloseall (void); > > > > > > > > > >extern FILE *fopen (__const char *__restrict __filename, > __const char *__restrict __modes); > > > > >extern FILE *freopen (__const char *__restrict __filename, > __const char *__restrict __modes, > FILE *__restrict __stream); ># 262 "/usr/include/stdio.h" 3 4 > > >extern FILE *fopen64 (__const char *__restrict __filename, > __const char *__restrict __modes); >extern FILE *freopen64 (__const char *__restrict __filename, > __const char *__restrict __modes, > FILE *__restrict __stream); > > > > >extern FILE *fdopen (int __fd, __const char *__modes) ; > > > > > >extern FILE *fopencookie (void *__restrict __magic_cookie, > __const char *__restrict __modes, > _IO_cookie_io_functions_t __io_funcs) ; > > >extern FILE *fmemopen (void *__s, size_t __len, __const char *__modes) ; > > > > >extern FILE *open_memstream (char **__restrict __bufloc, > size_t *__restrict __sizeloc) ; > > > > > > >extern void setbuf (FILE *__restrict __stream, char *__restrict __buf) ; > > > >extern int setvbuf (FILE *__restrict __stream, char *__restrict __buf, > int __modes, size_t __n) ; > > > > > >extern void setbuffer (FILE *__restrict __stream, char *__restrict __buf, > size_t __size) ; > > >extern void setlinebuf (FILE *__stream) ; > > > > > > > > >extern int fprintf (FILE *__restrict __stream, > __const char *__restrict __format, ...); > > > > >extern int printf (__const char *__restrict __format, ...); > >extern int sprintf (char *__restrict __s, > __const char *__restrict __format, ...) ; > > > > > >extern int vfprintf (FILE *__restrict __s, __const char *__restrict __format, > __gnuc_va_list __arg); > > > > >extern int vprintf (__const char *__restrict __format, __gnuc_va_list __arg); > >extern int vsprintf (char *__restrict __s, __const char *__restrict __format, > __gnuc_va_list __arg) ; > > > > > >extern int snprintf (char *__restrict __s, size_t __maxlen, > __const char *__restrict __format, ...) > __attribute__ ((__format__ (__printf__, 3, 4))); > >extern int vsnprintf (char *__restrict __s, size_t __maxlen, > __const char *__restrict __format, __gnuc_va_list __arg) > __attribute__ ((__format__ (__printf__, 3, 0))); > > > > > > >extern int vasprintf (char **__restrict __ptr, __const char *__restrict __f, > __gnuc_va_list __arg) > __attribute__ ((__format__ (__printf__, 2, 0))); >extern int __asprintf (char **__restrict __ptr, > __const char *__restrict __fmt, ...) > __attribute__ ((__format__ (__printf__, 2, 3))); >extern int asprintf (char **__restrict __ptr, > __const char *__restrict __fmt, ...) > __attribute__ ((__format__ (__printf__, 2, 3))); > > > > > > > >extern int vdprintf (int __fd, __const char *__restrict __fmt, > __gnuc_va_list __arg) > __attribute__ ((__format__ (__printf__, 2, 0))); >extern int dprintf (int __fd, __const char *__restrict __fmt, ...) > __attribute__ ((__format__ (__printf__, 2, 3))); > > > > > > > > >extern int fscanf (FILE *__restrict __stream, > __const char *__restrict __format, ...); > > > > >extern int scanf (__const char *__restrict __format, ...); > >extern int sscanf (__const char *__restrict __s, > __const char *__restrict __format, ...) ; > > > > > > > > >extern int vfscanf (FILE *__restrict __s, __const char *__restrict __format, > __gnuc_va_list __arg) > __attribute__ ((__format__ (__scanf__, 2, 0))); > > > > > >extern int vscanf (__const char *__restrict __format, __gnuc_va_list __arg) > __attribute__ ((__format__ (__scanf__, 1, 0))); > > >extern int vsscanf (__const char *__restrict __s, > __const char *__restrict __format, __gnuc_va_list __arg) > __attribute__ ((__format__ (__scanf__, 2, 0))); > > > > > > > > > >extern int fgetc (FILE *__stream); >extern int getc (FILE *__stream); > > > > > >extern int getchar (void); > ># 454 "/usr/include/stdio.h" 3 4 >extern int getc_unlocked (FILE *__stream); >extern int getchar_unlocked (void); ># 465 "/usr/include/stdio.h" 3 4 >extern int fgetc_unlocked (FILE *__stream); > > > > > > > > > > > >extern int fputc (int __c, FILE *__stream); >extern int putc (int __c, FILE *__stream); > > > > > >extern int putchar (int __c); > ># 498 "/usr/include/stdio.h" 3 4 >extern int fputc_unlocked (int __c, FILE *__stream); > > > > > > > >extern int putc_unlocked (int __c, FILE *__stream); >extern int putchar_unlocked (int __c); > > > > > > >extern int getw (FILE *__stream); > > >extern int putw (int __w, FILE *__stream); > > > > > > > > >extern char *fgets (char *__restrict __s, int __n, FILE *__restrict __stream); > > > > > > >extern char *gets (char *__s); > ># 543 "/usr/include/stdio.h" 3 4 >extern char *fgets_unlocked (char *__restrict __s, int __n, > FILE *__restrict __stream); ># 559 "/usr/include/stdio.h" 3 4 >extern __ssize_t __getdelim (char **__restrict __lineptr, > size_t *__restrict __n, int __delimiter, > FILE *__restrict __stream); >extern __ssize_t getdelim (char **__restrict __lineptr, > size_t *__restrict __n, int __delimiter, > FILE *__restrict __stream); > > > > > > > >extern __ssize_t getline (char **__restrict __lineptr, > size_t *__restrict __n, > FILE *__restrict __stream); > > > > > > > > >extern int fputs (__const char *__restrict __s, FILE *__restrict __stream); > > > > > >extern int puts (__const char *__s); > > > > > > >extern int ungetc (int __c, FILE *__stream); > > > > > > >extern size_t fread (void *__restrict __ptr, size_t __size, > size_t __n, FILE *__restrict __stream); > > > > >extern size_t fwrite (__const void *__restrict __ptr, size_t __size, > size_t __n, FILE *__restrict __s); > ># 620 "/usr/include/stdio.h" 3 4 >extern int fputs_unlocked (__const char *__restrict __s, > FILE *__restrict __stream); ># 631 "/usr/include/stdio.h" 3 4 >extern size_t fread_unlocked (void *__restrict __ptr, size_t __size, > size_t __n, FILE *__restrict __stream); >extern size_t fwrite_unlocked (__const void *__restrict __ptr, size_t __size, > size_t __n, FILE *__restrict __stream); > > > > > > > > >extern int fseek (FILE *__stream, long int __off, int __whence); > > > > >extern long int ftell (FILE *__stream); > > > > >extern void rewind (FILE *__stream); > ># 667 "/usr/include/stdio.h" 3 4 >extern int fseeko (FILE *__stream, __off_t __off, int __whence); > > > > >extern __off_t ftello (FILE *__stream); ># 686 "/usr/include/stdio.h" 3 4 > > > > > > >extern int fgetpos (FILE *__restrict __stream, fpos_t *__restrict __pos); > > > > >extern int fsetpos (FILE *__stream, __const fpos_t *__pos); ># 709 "/usr/include/stdio.h" 3 4 > > > >extern int fseeko64 (FILE *__stream, __off64_t __off, int __whence); >extern __off64_t ftello64 (FILE *__stream); >extern int fgetpos64 (FILE *__restrict __stream, fpos64_t *__restrict __pos); >extern int fsetpos64 (FILE *__stream, __const fpos64_t *__pos); > > > > >extern void clearerr (FILE *__stream) ; > >extern int feof (FILE *__stream) ; > >extern int ferror (FILE *__stream) ; > > > > >extern void clearerr_unlocked (FILE *__stream) ; >extern int feof_unlocked (FILE *__stream) ; >extern int ferror_unlocked (FILE *__stream) ; > > > > > > > > >extern void perror (__const char *__s); > > > > > > ># 1 "/usr/include/bits/sys_errlist.h" 1 3 4 ># 27 "/usr/include/bits/sys_errlist.h" 3 4 >extern int sys_nerr; >extern __const char *__const sys_errlist[]; > > >extern int _sys_nerr; >extern __const char *__const _sys_errlist[]; ># 748 "/usr/include/stdio.h" 2 3 4 > > > > >extern int fileno (FILE *__stream) ; > > > > >extern int fileno_unlocked (FILE *__stream) ; ># 767 "/usr/include/stdio.h" 3 4 >extern FILE *popen (__const char *__command, __const char *__modes); > > > > > >extern int pclose (FILE *__stream); > > > > > >extern char *ctermid (char *__s) ; > > > > > >extern char *cuserid (char *__s); > > > > >struct obstack; > > >extern int obstack_printf (struct obstack *__restrict __obstack, > __const char *__restrict __format, ...) > __attribute__ ((__format__ (__printf__, 2, 3))); >extern int obstack_vprintf (struct obstack *__restrict __obstack, > __const char *__restrict __format, > __gnuc_va_list __args) > __attribute__ ((__format__ (__printf__, 2, 0))); > > > > > > > >extern void flockfile (FILE *__stream) ; > > > >extern int ftrylockfile (FILE *__stream) ; > > >extern void funlockfile (FILE *__stream) ; ># 828 "/usr/include/stdio.h" 3 4 ># 1 "/usr/include/bits/stdio.h" 1 3 4 ># 33 "/usr/include/bits/stdio.h" 3 4 >extern __inline int >vprintf (__const char *__restrict __fmt, __gnuc_va_list __arg) >{ > return vfprintf (stdout, __fmt, __arg); >} > > >extern __inline int >getchar (void) >{ > return _IO_getc (stdin); >} > > > > >extern __inline int >getc_unlocked (FILE *__fp) >{ > return (__builtin_expect ((__fp)->_IO_read_ptr >= (__fp)->_IO_read_end, 0) ? __uflow (__fp) : *(unsigned char *) (__fp)->_IO_read_ptr++); >} > > >extern __inline int >getchar_unlocked (void) >{ > return (__builtin_expect ((stdin)->_IO_read_ptr >= (stdin)->_IO_read_end, 0) ? __uflow (stdin) : *(unsigned char *) (stdin)->_IO_read_ptr++); >} > > > > >extern __inline int >putchar (int __c) >{ > return _IO_putc (__c, stdout); >} > > > > >extern __inline int >fputc_unlocked (int __c, FILE *__stream) >{ > return (__builtin_expect ((__stream)->_IO_write_ptr >= (__stream)->_IO_write_end, 0) ? __overflow (__stream, (unsigned char) (__c)) : (unsigned char) (*(__stream)->_IO_write_ptr++ = (__c))); >} > > > > > >extern __inline int >putc_unlocked (int __c, FILE *__stream) >{ > return (__builtin_expect ((__stream)->_IO_write_ptr >= (__stream)->_IO_write_end, 0) ? __overflow (__stream, (unsigned char) (__c)) : (unsigned char) (*(__stream)->_IO_write_ptr++ = (__c))); >} > > >extern __inline int >putchar_unlocked (int __c) >{ > return (__builtin_expect ((stdout)->_IO_write_ptr >= (stdout)->_IO_write_end, 0) ? __overflow (stdout, (unsigned char) (__c)) : (unsigned char) (*(stdout)->_IO_write_ptr++ = (__c))); >} > > > > > >extern __inline __ssize_t >getline (char **__lineptr, size_t *__n, FILE *__stream) >{ > return __getdelim (__lineptr, __n, '\n', __stream); >} > > > > > >extern __inline int >feof_unlocked (FILE *__stream) >{ > return (((__stream)->_flags & 0x10) != 0); >} > > >extern __inline int >ferror_unlocked (FILE *__stream) >{ > return (((__stream)->_flags & 0x20) != 0); >} ># 829 "/usr/include/stdio.h" 2 3 4 > > > ># 5 "gamma_texmem.c" 2 > ># 1 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 1 ># 53 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" ># 1 "/usr/include/assert.h" 1 3 4 ># 65 "/usr/include/assert.h" 3 4 > > > >extern void __assert_fail (__const char *__assertion, __const char *__file, > unsigned int __line, __const char *__function) > __attribute__ ((__noreturn__)); > > >extern void __assert_perror_fail (int __errnum, __const char *__file, > unsigned int __line, > __const char *__function) > __attribute__ ((__noreturn__)); > > > > >extern void __assert (const char *__assertion, const char *__file, int __line) > __attribute__ ((__noreturn__)); > > > ># 54 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 ># 1 "/usr/include/ctype.h" 1 3 4 ># 30 "/usr/include/ctype.h" 3 4 > ># 48 "/usr/include/ctype.h" 3 4 >enum >{ > _ISupper = ((0) < 8 ? ((1 << (0)) << 8) : ((1 << (0)) >> 8)), > _ISlower = ((1) < 8 ? ((1 << (1)) << 8) : ((1 << (1)) >> 8)), > _ISalpha = ((2) < 8 ? ((1 << (2)) << 8) : ((1 << (2)) >> 8)), > _ISdigit = ((3) < 8 ? ((1 << (3)) << 8) : ((1 << (3)) >> 8)), > _ISxdigit = ((4) < 8 ? ((1 << (4)) << 8) : ((1 << (4)) >> 8)), > _ISspace = ((5) < 8 ? ((1 << (5)) << 8) : ((1 << (5)) >> 8)), > _ISprint = ((6) < 8 ? ((1 << (6)) << 8) : ((1 << (6)) >> 8)), > _ISgraph = ((7) < 8 ? ((1 << (7)) << 8) : ((1 << (7)) >> 8)), > _ISblank = ((8) < 8 ? ((1 << (8)) << 8) : ((1 << (8)) >> 8)), > _IScntrl = ((9) < 8 ? ((1 << (9)) << 8) : ((1 << (9)) >> 8)), > _ISpunct = ((10) < 8 ? ((1 << (10)) << 8) : ((1 << (10)) >> 8)), > _ISalnum = ((11) < 8 ? ((1 << (11)) << 8) : ((1 << (11)) >> 8)) >}; ># 81 "/usr/include/ctype.h" 3 4 >extern __const unsigned short int **__ctype_b_loc (void) > __attribute__ ((__const)); >extern __const __int32_t **__ctype_tolower_loc (void) > __attribute__ ((__const)); >extern __const __int32_t **__ctype_toupper_loc (void) > __attribute__ ((__const)); ># 96 "/usr/include/ctype.h" 3 4 > > > > > > >extern int isalnum (int) ; >extern int isalpha (int) ; >extern int iscntrl (int) ; >extern int isdigit (int) ; >extern int islower (int) ; >extern int isgraph (int) ; >extern int isprint (int) ; >extern int ispunct (int) ; >extern int isspace (int) ; >extern int isupper (int) ; >extern int isxdigit (int) ; > > > >extern int tolower (int __c) ; > > >extern int toupper (int __c) ; > > > > > > > > >extern int isblank (int) ; > > > > > > >extern int isctype (int __c, int __mask) ; > > > > > > >extern int isascii (int __c) ; > > > >extern int toascii (int __c) ; > > > >extern int _toupper (int) ; >extern int _tolower (int) ; ># 190 "/usr/include/ctype.h" 3 4 >extern __inline int >tolower (int __c) >{ > return __c >= -128 && __c < 256 ? (*__ctype_tolower_loc ())[__c] : __c; >} > >extern __inline int >toupper (int __c) >{ > return __c >= -128 && __c < 256 ? (*__ctype_toupper_loc ())[__c] : __c; >} ># 247 "/usr/include/ctype.h" 3 4 >extern int isalnum_l (int, __locale_t) ; >extern int isalpha_l (int, __locale_t) ; >extern int iscntrl_l (int, __locale_t) ; >extern int isdigit_l (int, __locale_t) ; >extern int islower_l (int, __locale_t) ; >extern int isgraph_l (int, __locale_t) ; >extern int isprint_l (int, __locale_t) ; >extern int ispunct_l (int, __locale_t) ; >extern int isspace_l (int, __locale_t) ; >extern int isupper_l (int, __locale_t) ; >extern int isxdigit_l (int, __locale_t) ; > >extern int isblank_l (int, __locale_t) ; > > > >extern int __tolower_l (int __c, __locale_t __l) ; >extern int tolower_l (int __c, __locale_t __l) ; > > >extern int __toupper_l (int __c, __locale_t __l) ; >extern int toupper_l (int __c, __locale_t __l) ; ># 323 "/usr/include/ctype.h" 3 4 > ># 55 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 > > > > ># 1 "/usr/include/math.h" 1 3 4 ># 29 "/usr/include/math.h" 3 4 > > > > ># 1 "/usr/include/bits/huge_val.h" 1 3 4 ># 34 "/usr/include/math.h" 2 3 4 > ># 1 "/usr/include/bits/huge_valf.h" 1 3 4 ># 36 "/usr/include/math.h" 2 3 4 ># 1 "/usr/include/bits/huge_vall.h" 1 3 4 ># 37 "/usr/include/math.h" 2 3 4 > > ># 1 "/usr/include/bits/inf.h" 1 3 4 ># 40 "/usr/include/math.h" 2 3 4 > > ># 1 "/usr/include/bits/nan.h" 1 3 4 ># 43 "/usr/include/math.h" 2 3 4 > > > ># 1 "/usr/include/bits/mathdef.h" 1 3 4 ># 29 "/usr/include/bits/mathdef.h" 3 4 >typedef long double float_t; > >typedef long double double_t; ># 47 "/usr/include/math.h" 2 3 4 ># 70 "/usr/include/math.h" 3 4 ># 1 "/usr/include/bits/mathcalls.h" 1 3 4 ># 53 "/usr/include/bits/mathcalls.h" 3 4 > > >extern double acos (double __x) ; extern double __acos (double __x) ; > >extern double asin (double __x) ; extern double __asin (double __x) ; > >extern double atan (double __x) ; extern double __atan (double __x) ; > >extern double atan2 (double __y, double __x) ; extern double __atan2 (double __y, double __x) ; > > >extern double cos (double __x) ; extern double __cos (double __x) ; > >extern double sin (double __x) ; extern double __sin (double __x) ; > >extern double tan (double __x) ; extern double __tan (double __x) ; > > > > >extern double cosh (double __x) ; extern double __cosh (double __x) ; > >extern double sinh (double __x) ; extern double __sinh (double __x) ; > >extern double tanh (double __x) ; extern double __tanh (double __x) ; > > > > >extern void sincos (double __x, double *__sinx, double *__cosx) ; extern void __sincos (double __x, double *__sinx, double *__cosx) ; > > > > > > >extern double acosh (double __x) ; extern double __acosh (double __x) ; > >extern double asinh (double __x) ; extern double __asinh (double __x) ; > >extern double atanh (double __x) ; extern double __atanh (double __x) ; > > > > > > > >extern double exp (double __x) ; extern double __exp (double __x) ; > > >extern double frexp (double __x, int *__exponent) ; extern double __frexp (double __x, int *__exponent) ; > > >extern double ldexp (double __x, int __exponent) ; extern double __ldexp (double __x, int __exponent) ; > > >extern double log (double __x) ; extern double __log (double __x) ; > > >extern double log10 (double __x) ; extern double __log10 (double __x) ; > > >extern double modf (double __x, double *__iptr) ; extern double __modf (double __x, double *__iptr) ; > > > > >extern double exp10 (double __x) ; extern double __exp10 (double __x) ; > >extern double pow10 (double __x) ; extern double __pow10 (double __x) ; > > > > > >extern double expm1 (double __x) ; extern double __expm1 (double __x) ; > > >extern double log1p (double __x) ; extern double __log1p (double __x) ; > > >extern double logb (double __x) ; extern double __logb (double __x) ; > > > > > > >extern double exp2 (double __x) ; extern double __exp2 (double __x) ; > > >extern double log2 (double __x) ; extern double __log2 (double __x) ; > > > > > > > > >extern double pow (double __x, double __y) ; extern double __pow (double __x, double __y) ; > > >extern double sqrt (double __x) ; extern double __sqrt (double __x) ; > > > > > >extern double hypot (double __x, double __y) ; extern double __hypot (double __x, double __y) ; > > > > > > >extern double cbrt (double __x) ; extern double __cbrt (double __x) ; > > > > > > > > >extern double ceil (double __x) __attribute__ ((__const__)); extern double __ceil (double __x) __attribute__ ((__const__)); > > >extern double fabs (double __x) __attribute__ ((__const__)); extern double __fabs (double __x) __attribute__ ((__const__)); > > >extern double floor (double __x) __attribute__ ((__const__)); extern double __floor (double __x) __attribute__ ((__const__)); > > >extern double fmod (double __x, double __y) ; extern double __fmod (double __x, double __y) ; > > > > >extern int __isinf (double __value) __attribute__ ((__const__)); > > >extern int __finite (double __value) __attribute__ ((__const__)); > > > > > >extern int isinf (double __value) __attribute__ ((__const__)); > > >extern int finite (double __value) __attribute__ ((__const__)); > > >extern double drem (double __x, double __y) ; extern double __drem (double __x, double __y) ; > > > >extern double significand (double __x) ; extern double __significand (double __x) ; > > > > > >extern double copysign (double __x, double __y) __attribute__ ((__const__)); extern double __copysign (double __x, double __y) __attribute__ ((__const__)); > > > > > > >extern double nan (__const char *__tagb) __attribute__ ((__const__)); extern double __nan (__const char *__tagb) __attribute__ ((__const__)); > > > > > >extern int __isnan (double __value) __attribute__ ((__const__)); > > > >extern int isnan (double __value) __attribute__ ((__const__)); > > >extern double j0 (double) ; extern double __j0 (double) ; >extern double j1 (double) ; extern double __j1 (double) ; >extern double jn (int, double) ; extern double __jn (int, double) ; >extern double y0 (double) ; extern double __y0 (double) ; >extern double y1 (double) ; extern double __y1 (double) ; >extern double yn (int, double) ; extern double __yn (int, double) ; > > > > > > >extern double erf (double) ; extern double __erf (double) ; >extern double erfc (double) ; extern double __erfc (double) ; >extern double lgamma (double) ; extern double __lgamma (double) ; > > > > > > >extern double tgamma (double) ; extern double __tgamma (double) ; > > > > > >extern double gamma (double) ; extern double __gamma (double) ; > > > > > > >extern double lgamma_r (double, int *__signgamp) ; extern double __lgamma_r (double, int *__signgamp) ; > > > > > > > >extern double rint (double __x) ; extern double __rint (double __x) ; > > >extern double nextafter (double __x, double __y) __attribute__ ((__const__)); extern double __nextafter (double __x, double __y) __attribute__ ((__const__)); > >extern double nexttoward (double __x, long double __y) __attribute__ ((__const__)); extern double __nexttoward (double __x, long double __y) __attribute__ ((__const__)); > > > >extern double remainder (double __x, double __y) ; extern double __remainder (double __x, double __y) ; > > > >extern double scalbn (double __x, int __n) ; extern double __scalbn (double __x, int __n) ; > > > >extern int ilogb (double __x) ; extern int __ilogb (double __x) ; > > > > >extern double scalbln (double __x, long int __n) ; extern double __scalbln (double __x, long int __n) ; > > > >extern double nearbyint (double __x) ; extern double __nearbyint (double __x) ; > > > >extern double round (double __x) __attribute__ ((__const__)); extern double __round (double __x) __attribute__ ((__const__)); > > > >extern double trunc (double __x) __attribute__ ((__const__)); extern double __trunc (double __x) __attribute__ ((__const__)); > > > > >extern double remquo (double __x, double __y, int *__quo) ; extern double __remquo (double __x, double __y, int *__quo) ; > > > > > > >extern long int lrint (double __x) ; extern long int __lrint (double __x) ; >extern long long int llrint (double __x) ; extern long long int __llrint (double __x) ; > > > >extern long int lround (double __x) ; extern long int __lround (double __x) ; >extern long long int llround (double __x) ; extern long long int __llround (double __x) ; > > > >extern double fdim (double __x, double __y) ; extern double __fdim (double __x, double __y) ; > > >extern double fmax (double __x, double __y) ; extern double __fmax (double __x, double __y) ; > > >extern double fmin (double __x, double __y) ; extern double __fmin (double __x, double __y) ; > > > >extern int __fpclassify (double __value) > __attribute__ ((__const__)); > > >extern int __signbit (double __value) > __attribute__ ((__const__)); > > > >extern double fma (double __x, double __y, double __z) ; extern double __fma (double __x, double __y, double __z) ; > > > > >extern double scalb (double __x, double __n) ; extern double __scalb (double __x, double __n) ; ># 71 "/usr/include/math.h" 2 3 4 ># 93 "/usr/include/math.h" 3 4 ># 1 "/usr/include/bits/mathcalls.h" 1 3 4 ># 53 "/usr/include/bits/mathcalls.h" 3 4 > > >extern float acosf (float __x) ; extern float __acosf (float __x) ; > >extern float asinf (float __x) ; extern float __asinf (float __x) ; > >extern float atanf (float __x) ; extern float __atanf (float __x) ; > >extern float atan2f (float __y, float __x) ; extern float __atan2f (float __y, float __x) ; > > >extern float cosf (float __x) ; extern float __cosf (float __x) ; > >extern float sinf (float __x) ; extern float __sinf (float __x) ; > >extern float tanf (float __x) ; extern float __tanf (float __x) ; > > > > >extern float coshf (float __x) ; extern float __coshf (float __x) ; > >extern float sinhf (float __x) ; extern float __sinhf (float __x) ; > >extern float tanhf (float __x) ; extern float __tanhf (float __x) ; > > > > >extern void sincosf (float __x, float *__sinx, float *__cosx) ; extern void __sincosf (float __x, float *__sinx, float *__cosx) ; > > > > > > >extern float acoshf (float __x) ; extern float __acoshf (float __x) ; > >extern float asinhf (float __x) ; extern float __asinhf (float __x) ; > >extern float atanhf (float __x) ; extern float __atanhf (float __x) ; > > > > > > > >extern float expf (float __x) ; extern float __expf (float __x) ; > > >extern float frexpf (float __x, int *__exponent) ; extern float __frexpf (float __x, int *__exponent) ; > > >extern float ldexpf (float __x, int __exponent) ; extern float __ldexpf (float __x, int __exponent) ; > > >extern float logf (float __x) ; extern float __logf (float __x) ; > > >extern float log10f (float __x) ; extern float __log10f (float __x) ; > > >extern float modff (float __x, float *__iptr) ; extern float __modff (float __x, float *__iptr) ; > > > > >extern float exp10f (float __x) ; extern float __exp10f (float __x) ; > >extern float pow10f (float __x) ; extern float __pow10f (float __x) ; > > > > > >extern float expm1f (float __x) ; extern float __expm1f (float __x) ; > > >extern float log1pf (float __x) ; extern float __log1pf (float __x) ; > > >extern float logbf (float __x) ; extern float __logbf (float __x) ; > > > > > > >extern float exp2f (float __x) ; extern float __exp2f (float __x) ; > > >extern float log2f (float __x) ; extern float __log2f (float __x) ; > > > > > > > > >extern float powf (float __x, float __y) ; extern float __powf (float __x, float __y) ; > > >extern float sqrtf (float __x) ; extern float __sqrtf (float __x) ; > > > > > >extern float hypotf (float __x, float __y) ; extern float __hypotf (float __x, float __y) ; > > > > > > >extern float cbrtf (float __x) ; extern float __cbrtf (float __x) ; > > > > > > > > >extern float ceilf (float __x) __attribute__ ((__const__)); extern float __ceilf (float __x) __attribute__ ((__const__)); > > >extern float fabsf (float __x) __attribute__ ((__const__)); extern float __fabsf (float __x) __attribute__ ((__const__)); > > >extern float floorf (float __x) __attribute__ ((__const__)); extern float __floorf (float __x) __attribute__ ((__const__)); > > >extern float fmodf (float __x, float __y) ; extern float __fmodf (float __x, float __y) ; > > > > >extern int __isinff (float __value) __attribute__ ((__const__)); > > >extern int __finitef (float __value) __attribute__ ((__const__)); > > > > > >extern int isinff (float __value) __attribute__ ((__const__)); > > >extern int finitef (float __value) __attribute__ ((__const__)); > > >extern float dremf (float __x, float __y) ; extern float __dremf (float __x, float __y) ; > > > >extern float significandf (float __x) ; extern float __significandf (float __x) ; > > > > > >extern float copysignf (float __x, float __y) __attribute__ ((__const__)); extern float __copysignf (float __x, float __y) __attribute__ ((__const__)); > > > > > > >extern float nanf (__const char *__tagb) __attribute__ ((__const__)); extern float __nanf (__const char *__tagb) __attribute__ ((__const__)); > > > > > >extern int __isnanf (float __value) __attribute__ ((__const__)); > > > >extern int isnanf (float __value) __attribute__ ((__const__)); > > >extern float j0f (float) ; extern float __j0f (float) ; >extern float j1f (float) ; extern float __j1f (float) ; >extern float jnf (int, float) ; extern float __jnf (int, float) ; >extern float y0f (float) ; extern float __y0f (float) ; >extern float y1f (float) ; extern float __y1f (float) ; >extern float ynf (int, float) ; extern float __ynf (int, float) ; > > > > > > >extern float erff (float) ; extern float __erff (float) ; >extern float erfcf (float) ; extern float __erfcf (float) ; >extern float lgammaf (float) ; extern float __lgammaf (float) ; > > > > > > >extern float tgammaf (float) ; extern float __tgammaf (float) ; > > > > > >extern float gammaf (float) ; extern float __gammaf (float) ; > > > > > > >extern float lgammaf_r (float, int *__signgamp) ; extern float __lgammaf_r (float, int *__signgamp) ; > > > > > > > >extern float rintf (float __x) ; extern float __rintf (float __x) ; > > >extern float nextafterf (float __x, float __y) __attribute__ ((__const__)); extern float __nextafterf (float __x, float __y) __attribute__ ((__const__)); > >extern float nexttowardf (float __x, long double __y) __attribute__ ((__const__)); extern float __nexttowardf (float __x, long double __y) __attribute__ ((__const__)); > > > >extern float remainderf (float __x, float __y) ; extern float __remainderf (float __x, float __y) ; > > > >extern float scalbnf (float __x, int __n) ; extern float __scalbnf (float __x, int __n) ; > > > >extern int ilogbf (float __x) ; extern int __ilogbf (float __x) ; > > > > >extern float scalblnf (float __x, long int __n) ; extern float __scalblnf (float __x, long int __n) ; > > > >extern float nearbyintf (float __x) ; extern float __nearbyintf (float __x) ; > > > >extern float roundf (float __x) __attribute__ ((__const__)); extern float __roundf (float __x) __attribute__ ((__const__)); > > > >extern float truncf (float __x) __attribute__ ((__const__)); extern float __truncf (float __x) __attribute__ ((__const__)); > > > > >extern float remquof (float __x, float __y, int *__quo) ; extern float __remquof (float __x, float __y, int *__quo) ; > > > > > > >extern long int lrintf (float __x) ; extern long int __lrintf (float __x) ; >extern long long int llrintf (float __x) ; extern long long int __llrintf (float __x) ; > > > >extern long int lroundf (float __x) ; extern long int __lroundf (float __x) ; >extern long long int llroundf (float __x) ; extern long long int __llroundf (float __x) ; > > > >extern float fdimf (float __x, float __y) ; extern float __fdimf (float __x, float __y) ; > > >extern float fmaxf (float __x, float __y) ; extern float __fmaxf (float __x, float __y) ; > > >extern float fminf (float __x, float __y) ; extern float __fminf (float __x, float __y) ; > > > >extern int __fpclassifyf (float __value) > __attribute__ ((__const__)); > > >extern int __signbitf (float __value) > __attribute__ ((__const__)); > > > >extern float fmaf (float __x, float __y, float __z) ; extern float __fmaf (float __x, float __y, float __z) ; > > > > >extern float scalbf (float __x, float __n) ; extern float __scalbf (float __x, float __n) ; ># 94 "/usr/include/math.h" 2 3 4 ># 114 "/usr/include/math.h" 3 4 ># 1 "/usr/include/bits/mathcalls.h" 1 3 4 ># 53 "/usr/include/bits/mathcalls.h" 3 4 > > >extern long double acosl (long double __x) ; extern long double __acosl (long double __x) ; > >extern long double asinl (long double __x) ; extern long double __asinl (long double __x) ; > >extern long double atanl (long double __x) ; extern long double __atanl (long double __x) ; > >extern long double atan2l (long double __y, long double __x) ; extern long double __atan2l (long double __y, long double __x) ; > > >extern long double cosl (long double __x) ; extern long double __cosl (long double __x) ; > >extern long double sinl (long double __x) ; extern long double __sinl (long double __x) ; > >extern long double tanl (long double __x) ; extern long double __tanl (long double __x) ; > > > > >extern long double coshl (long double __x) ; extern long double __coshl (long double __x) ; > >extern long double sinhl (long double __x) ; extern long double __sinhl (long double __x) ; > >extern long double tanhl (long double __x) ; extern long double __tanhl (long double __x) ; > > > > >extern void sincosl (long double __x, long double *__sinx, long double *__cosx) ; extern void __sincosl (long double __x, long double *__sinx, long double *__cosx) ; > > > > > > >extern long double acoshl (long double __x) ; extern long double __acoshl (long double __x) ; > >extern long double asinhl (long double __x) ; extern long double __asinhl (long double __x) ; > >extern long double atanhl (long double __x) ; extern long double __atanhl (long double __x) ; > > > > > > > >extern long double expl (long double __x) ; extern long double __expl (long double __x) ; > > >extern long double frexpl (long double __x, int *__exponent) ; extern long double __frexpl (long double __x, int *__exponent) ; > > >extern long double ldexpl (long double __x, int __exponent) ; extern long double __ldexpl (long double __x, int __exponent) ; > > >extern long double logl (long double __x) ; extern long double __logl (long double __x) ; > > >extern long double log10l (long double __x) ; extern long double __log10l (long double __x) ; > > >extern long double modfl (long double __x, long double *__iptr) ; extern long double __modfl (long double __x, long double *__iptr) ; > > > > >extern long double exp10l (long double __x) ; extern long double __exp10l (long double __x) ; > >extern long double pow10l (long double __x) ; extern long double __pow10l (long double __x) ; > > > > > >extern long double expm1l (long double __x) ; extern long double __expm1l (long double __x) ; > > >extern long double log1pl (long double __x) ; extern long double __log1pl (long double __x) ; > > >extern long double logbl (long double __x) ; extern long double __logbl (long double __x) ; > > > > > > >extern long double exp2l (long double __x) ; extern long double __exp2l (long double __x) ; > > >extern long double log2l (long double __x) ; extern long double __log2l (long double __x) ; > > > > > > > > >extern long double powl (long double __x, long double __y) ; extern long double __powl (long double __x, long double __y) ; > > >extern long double sqrtl (long double __x) ; extern long double __sqrtl (long double __x) ; > > > > > >extern long double hypotl (long double __x, long double __y) ; extern long double __hypotl (long double __x, long double __y) ; > > > > > > >extern long double cbrtl (long double __x) ; extern long double __cbrtl (long double __x) ; > > > > > > > > >extern long double ceill (long double __x) __attribute__ ((__const__)); extern long double __ceill (long double __x) __attribute__ ((__const__)); > > >extern long double fabsl (long double __x) __attribute__ ((__const__)); extern long double __fabsl (long double __x) __attribute__ ((__const__)); > > >extern long double floorl (long double __x) __attribute__ ((__const__)); extern long double __floorl (long double __x) __attribute__ ((__const__)); > > >extern long double fmodl (long double __x, long double __y) ; extern long double __fmodl (long double __x, long double __y) ; > > > > >extern int __isinfl (long double __value) __attribute__ ((__const__)); > > >extern int __finitel (long double __value) __attribute__ ((__const__)); > > > > > >extern int isinfl (long double __value) __attribute__ ((__const__)); > > >extern int finitel (long double __value) __attribute__ ((__const__)); > > >extern long double dreml (long double __x, long double __y) ; extern long double __dreml (long double __x, long double __y) ; > > > >extern long double significandl (long double __x) ; extern long double __significandl (long double __x) ; > > > > > >extern long double copysignl (long double __x, long double __y) __attribute__ ((__const__)); extern long double __copysignl (long double __x, long double __y) __attribute__ ((__const__)); > > > > > > >extern long double nanl (__const char *__tagb) __attribute__ ((__const__)); extern long double __nanl (__const char *__tagb) __attribute__ ((__const__)); > > > > > >extern int __isnanl (long double __value) __attribute__ ((__const__)); > > > >extern int isnanl (long double __value) __attribute__ ((__const__)); > > >extern long double j0l (long double) ; extern long double __j0l (long double) ; >extern long double j1l (long double) ; extern long double __j1l (long double) ; >extern long double jnl (int, long double) ; extern long double __jnl (int, long double) ; >extern long double y0l (long double) ; extern long double __y0l (long double) ; >extern long double y1l (long double) ; extern long double __y1l (long double) ; >extern long double ynl (int, long double) ; extern long double __ynl (int, long double) ; > > > > > > >extern long double erfl (long double) ; extern long double __erfl (long double) ; >extern long double erfcl (long double) ; extern long double __erfcl (long double) ; >extern long double lgammal (long double) ; extern long double __lgammal (long double) ; > > > > > > >extern long double tgammal (long double) ; extern long double __tgammal (long double) ; > > > > > >extern long double gammal (long double) ; extern long double __gammal (long double) ; > > > > > > >extern long double lgammal_r (long double, int *__signgamp) ; extern long double __lgammal_r (long double, int *__signgamp) ; > > > > > > > >extern long double rintl (long double __x) ; extern long double __rintl (long double __x) ; > > >extern long double nextafterl (long double __x, long double __y) __attribute__ ((__const__)); extern long double __nextafterl (long double __x, long double __y) __attribute__ ((__const__)); > >extern long double nexttowardl (long double __x, long double __y) __attribute__ ((__const__)); extern long double __nexttowardl (long double __x, long double __y) __attribute__ ((__const__)); > > > >extern long double remainderl (long double __x, long double __y) ; extern long double __remainderl (long double __x, long double __y) ; > > > >extern long double scalbnl (long double __x, int __n) ; extern long double __scalbnl (long double __x, int __n) ; > > > >extern int ilogbl (long double __x) ; extern int __ilogbl (long double __x) ; > > > > >extern long double scalblnl (long double __x, long int __n) ; extern long double __scalblnl (long double __x, long int __n) ; > > > >extern long double nearbyintl (long double __x) ; extern long double __nearbyintl (long double __x) ; > > > >extern long double roundl (long double __x) __attribute__ ((__const__)); extern long double __roundl (long double __x) __attribute__ ((__const__)); > > > >extern long double truncl (long double __x) __attribute__ ((__const__)); extern long double __truncl (long double __x) __attribute__ ((__const__)); > > > > >extern long double remquol (long double __x, long double __y, int *__quo) ; extern long double __remquol (long double __x, long double __y, int *__quo) ; > > > > > > >extern long int lrintl (long double __x) ; extern long int __lrintl (long double __x) ; >extern long long int llrintl (long double __x) ; extern long long int __llrintl (long double __x) ; > > > >extern long int lroundl (long double __x) ; extern long int __lroundl (long double __x) ; >extern long long int llroundl (long double __x) ; extern long long int __llroundl (long double __x) ; > > > >extern long double fdiml (long double __x, long double __y) ; extern long double __fdiml (long double __x, long double __y) ; > > >extern long double fmaxl (long double __x, long double __y) ; extern long double __fmaxl (long double __x, long double __y) ; > > >extern long double fminl (long double __x, long double __y) ; extern long double __fminl (long double __x, long double __y) ; > > > >extern int __fpclassifyl (long double __value) > __attribute__ ((__const__)); > > >extern int __signbitl (long double __value) > __attribute__ ((__const__)); > > > >extern long double fmal (long double __x, long double __y, long double __z) ; extern long double __fmal (long double __x, long double __y, long double __z) ; > > > > >extern long double scalbl (long double __x, long double __n) ; extern long double __scalbl (long double __x, long double __n) ; ># 115 "/usr/include/math.h" 2 3 4 ># 130 "/usr/include/math.h" 3 4 >extern int signgam; ># 171 "/usr/include/math.h" 3 4 >enum > { > FP_NAN, > > FP_INFINITE, > > FP_ZERO, > > FP_SUBNORMAL, > > FP_NORMAL > > }; ># 257 "/usr/include/math.h" 3 4 >typedef enum >{ > _IEEE_ = -1, > _SVID_, > _XOPEN_, > _POSIX_, > _ISOC_ >} _LIB_VERSION_TYPE; > > > > >extern _LIB_VERSION_TYPE _LIB_VERSION; ># 282 "/usr/include/math.h" 3 4 >struct exception > > { > int type; > char *name; > double arg1; > double arg2; > double retval; > }; > > > > >extern int matherr (struct exception *__exc); ># 382 "/usr/include/math.h" 3 4 ># 1 "/usr/include/bits/mathinline.h" 1 3 4 ># 127 "/usr/include/bits/mathinline.h" 3 4 >extern __inline int >__signbitf (float __x) >{ > __extension__ union { float __f; int __i; } __u = { __f: __x }; > return __u.__i < 0; >} >extern __inline int >__signbit (double __x) >{ > __extension__ union { double __d; int __i[2]; } __u = { __d: __x }; > return __u.__i[1] < 0; >} >extern __inline int >__signbitl (long double __x) >{ > __extension__ union { long double __l; int __i[3]; } __u = { __l: __x }; > return (__u.__i[2] & 0x8000) != 0; >} ># 383 "/usr/include/math.h" 2 3 4 ># 438 "/usr/include/math.h" 3 4 > ># 60 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/limits.h" 1 3 4 ># 11 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/limits.h" 3 4 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/syslimits.h" 1 3 4 > > > > > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/limits.h" 1 3 4 ># 122 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/limits.h" 3 4 ># 1 "/usr/include/limits.h" 1 3 4 ># 144 "/usr/include/limits.h" 3 4 ># 1 "/usr/include/bits/posix1_lim.h" 1 3 4 ># 145 "/usr/include/bits/posix1_lim.h" 3 4 ># 1 "/usr/include/bits/local_lim.h" 1 3 4 ># 36 "/usr/include/bits/local_lim.h" 3 4 ># 1 "/usr/include/linux/limits.h" 1 3 4 ># 37 "/usr/include/bits/local_lim.h" 2 3 4 ># 146 "/usr/include/bits/posix1_lim.h" 2 3 4 ># 145 "/usr/include/limits.h" 2 3 4 > > > ># 1 "/usr/include/bits/posix2_lim.h" 1 3 4 ># 149 "/usr/include/limits.h" 2 3 4 > > > ># 1 "/usr/include/bits/xopen_lim.h" 1 3 4 ># 34 "/usr/include/bits/xopen_lim.h" 3 4 ># 1 "/usr/include/bits/stdio_lim.h" 1 3 4 ># 35 "/usr/include/bits/xopen_lim.h" 2 3 4 ># 153 "/usr/include/limits.h" 2 3 4 ># 123 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/limits.h" 2 3 4 ># 8 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/syslimits.h" 2 3 4 ># 12 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/limits.h" 2 3 4 ># 62 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 > > ># 1 "/usr/include/string.h" 1 3 4 ># 28 "/usr/include/string.h" 3 4 > > > > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 34 "/usr/include/string.h" 2 3 4 > > > > >extern void *memcpy (void *__restrict __dest, > __const void *__restrict __src, size_t __n) ; > > >extern void *memmove (void *__dest, __const void *__src, size_t __n) > ; > > > > > > >extern void *memccpy (void *__restrict __dest, __const void *__restrict __src, > int __c, size_t __n) > ; > > > > > >extern void *memset (void *__s, int __c, size_t __n) ; > > >extern int memcmp (__const void *__s1, __const void *__s2, size_t __n) > __attribute__ ((__pure__)); > > >extern void *memchr (__const void *__s, int __c, size_t __n) > __attribute__ ((__pure__)); > > > > > >extern void *rawmemchr (__const void *__s, int __c) __attribute__ ((__pure__)); > > >extern void *memrchr (__const void *__s, int __c, size_t __n) > __attribute__ ((__pure__)); > > > > > >extern char *strcpy (char *__restrict __dest, __const char *__restrict __src) > ; > >extern char *strncpy (char *__restrict __dest, > __const char *__restrict __src, size_t __n) ; > > >extern char *strcat (char *__restrict __dest, __const char *__restrict __src) > ; > >extern char *strncat (char *__restrict __dest, __const char *__restrict __src, > size_t __n) ; > > >extern int strcmp (__const char *__s1, __const char *__s2) > __attribute__ ((__pure__)); > >extern int strncmp (__const char *__s1, __const char *__s2, size_t __n) > __attribute__ ((__pure__)); > > >extern int strcoll (__const char *__s1, __const char *__s2) > __attribute__ ((__pure__)); > >extern size_t strxfrm (char *__restrict __dest, > __const char *__restrict __src, size_t __n) ; > ># 117 "/usr/include/string.h" 3 4 >extern int strcoll_l (__const char *__s1, __const char *__s2, __locale_t __l) > __attribute__ ((__pure__)); > >extern size_t strxfrm_l (char *__dest, __const char *__src, size_t __n, > __locale_t __l) ; > > > > >extern char *strdup (__const char *__s) __attribute__ ((__malloc__)); > > > > > > >extern char *strndup (__const char *__string, size_t __n) > __attribute__ ((__malloc__)); ># 160 "/usr/include/string.h" 3 4 > > >extern char *strchr (__const char *__s, int __c) __attribute__ ((__pure__)); > >extern char *strrchr (__const char *__s, int __c) __attribute__ ((__pure__)); > > > > > >extern char *strchrnul (__const char *__s, int __c) __attribute__ ((__pure__)); > > > > > >extern size_t strcspn (__const char *__s, __const char *__reject) > __attribute__ ((__pure__)); > > >extern size_t strspn (__const char *__s, __const char *__accept) > __attribute__ ((__pure__)); > >extern char *strpbrk (__const char *__s, __const char *__accept) > __attribute__ ((__pure__)); > >extern char *strstr (__const char *__haystack, __const char *__needle) > __attribute__ ((__pure__)); > > > >extern char *strtok (char *__restrict __s, __const char *__restrict __delim) > ; > > > > >extern char *__strtok_r (char *__restrict __s, > __const char *__restrict __delim, > char **__restrict __save_ptr) ; > >extern char *strtok_r (char *__restrict __s, __const char *__restrict __delim, > char **__restrict __save_ptr) ; > > > > >extern char *strcasestr (__const char *__haystack, __const char *__needle) > __attribute__ ((__pure__)); > > > > > > >extern void *memmem (__const void *__haystack, size_t __haystacklen, > __const void *__needle, size_t __needlelen) > __attribute__ ((__pure__)); > > > >extern void *__mempcpy (void *__restrict __dest, > __const void *__restrict __src, size_t __n) ; >extern void *mempcpy (void *__restrict __dest, > __const void *__restrict __src, size_t __n) ; > > > > > >extern size_t strlen (__const char *__s) __attribute__ ((__pure__)); > > > > > >extern size_t strnlen (__const char *__string, size_t __maxlen) > __attribute__ ((__pure__)); > > > > > >extern char *strerror (int __errnum) ; > ># 268 "/usr/include/string.h" 3 4 >extern char *strerror_r (int __errnum, char *__buf, size_t __buflen) ; > > > > > >extern void __bzero (void *__s, size_t __n) ; > > > >extern void bcopy (__const void *__src, void *__dest, size_t __n) ; > > >extern void bzero (void *__s, size_t __n) ; > > >extern int bcmp (__const void *__s1, __const void *__s2, size_t __n) > __attribute__ ((__pure__)); > > >extern char *index (__const char *__s, int __c) __attribute__ ((__pure__)); > > >extern char *rindex (__const char *__s, int __c) __attribute__ ((__pure__)); > > > >extern int ffs (int __i) __attribute__ ((__const__)); > > > > >extern int ffsl (long int __l) __attribute__ ((__const__)); > >__extension__ extern int ffsll (long long int __ll) > __attribute__ ((__const__)); > > > > >extern int strcasecmp (__const char *__s1, __const char *__s2) > __attribute__ ((__pure__)); > > >extern int strncasecmp (__const char *__s1, __const char *__s2, size_t __n) > __attribute__ ((__pure__)); > > > > > >extern int strcasecmp_l (__const char *__s1, __const char *__s2, > __locale_t __loc) __attribute__ ((__pure__)); > >extern int strncasecmp_l (__const char *__s1, __const char *__s2, > size_t __n, __locale_t __loc) > __attribute__ ((__pure__)); > > > > > >extern char *strsep (char **__restrict __stringp, > __const char *__restrict __delim) ; > > > > >extern int strverscmp (__const char *__s1, __const char *__s2) > __attribute__ ((__pure__)); > > >extern char *strsignal (int __sig) ; > > >extern char *__stpcpy (char *__restrict __dest, __const char *__restrict __src) > ; >extern char *stpcpy (char *__restrict __dest, __const char *__restrict __src) > ; > > > >extern char *__stpncpy (char *__restrict __dest, > __const char *__restrict __src, size_t __n) ; >extern char *stpncpy (char *__restrict __dest, > __const char *__restrict __src, size_t __n) ; > > >extern char *strfry (char *__string) ; > > >extern void *memfrob (void *__s, size_t __n) ; > > > > > > >extern char *basename (__const char *__filename) ; ># 393 "/usr/include/string.h" 3 4 ># 1 "/usr/include/bits/string.h" 1 3 4 ># 394 "/usr/include/string.h" 2 3 4 > > ># 1 "/usr/include/bits/string2.h" 1 3 4 ># 394 "/usr/include/bits/string2.h" 3 4 >extern void *__rawmemchr (const void *__s, int __c); ># 969 "/usr/include/bits/string2.h" 3 4 >extern __inline size_t __strcspn_c1 (__const char *__s, int __reject); >extern __inline size_t >__strcspn_c1 (__const char *__s, int __reject) >{ > register size_t __result = 0; > while (__s[__result] != '\0' && __s[__result] != __reject) > ++__result; > return __result; >} > >extern __inline size_t __strcspn_c2 (__const char *__s, int __reject1, > int __reject2); >extern __inline size_t >__strcspn_c2 (__const char *__s, int __reject1, int __reject2) >{ > register size_t __result = 0; > while (__s[__result] != '\0' && __s[__result] != __reject1 > && __s[__result] != __reject2) > ++__result; > return __result; >} > >extern __inline size_t __strcspn_c3 (__const char *__s, int __reject1, > int __reject2, int __reject3); >extern __inline size_t >__strcspn_c3 (__const char *__s, int __reject1, int __reject2, > int __reject3) >{ > register size_t __result = 0; > while (__s[__result] != '\0' && __s[__result] != __reject1 > && __s[__result] != __reject2 && __s[__result] != __reject3) > ++__result; > return __result; >} ># 1045 "/usr/include/bits/string2.h" 3 4 >extern __inline size_t __strspn_c1 (__const char *__s, int __accept); >extern __inline size_t >__strspn_c1 (__const char *__s, int __accept) >{ > register size_t __result = 0; > > while (__s[__result] == __accept) > ++__result; > return __result; >} > >extern __inline size_t __strspn_c2 (__const char *__s, int __accept1, > int __accept2); >extern __inline size_t >__strspn_c2 (__const char *__s, int __accept1, int __accept2) >{ > register size_t __result = 0; > > while (__s[__result] == __accept1 || __s[__result] == __accept2) > ++__result; > return __result; >} > >extern __inline size_t __strspn_c3 (__const char *__s, int __accept1, > int __accept2, int __accept3); >extern __inline size_t >__strspn_c3 (__const char *__s, int __accept1, int __accept2, int __accept3) >{ > register size_t __result = 0; > > while (__s[__result] == __accept1 || __s[__result] == __accept2 > || __s[__result] == __accept3) > ++__result; > return __result; >} ># 1121 "/usr/include/bits/string2.h" 3 4 >extern __inline char *__strpbrk_c2 (__const char *__s, int __accept1, > int __accept2); >extern __inline char * >__strpbrk_c2 (__const char *__s, int __accept1, int __accept2) >{ > > while (*__s != '\0' && *__s != __accept1 && *__s != __accept2) > ++__s; > return *__s == '\0' ? ((void *)0) : (char *) (size_t) __s; >} > >extern __inline char *__strpbrk_c3 (__const char *__s, int __accept1, > int __accept2, int __accept3); >extern __inline char * >__strpbrk_c3 (__const char *__s, int __accept1, int __accept2, > int __accept3) >{ > > while (*__s != '\0' && *__s != __accept1 && *__s != __accept2 > && *__s != __accept3) > ++__s; > return *__s == '\0' ? ((void *)0) : (char *) (size_t) __s; >} ># 1173 "/usr/include/bits/string2.h" 3 4 >extern __inline char *__strtok_r_1c (char *__s, char __sep, char **__nextp); >extern __inline char * >__strtok_r_1c (char *__s, char __sep, char **__nextp) >{ > char *__result; > if (__s == ((void *)0)) > __s = *__nextp; > while (*__s == __sep) > ++__s; > __result = ((void *)0); > if (*__s != '\0') > { > __result = __s++; > while (*__s != '\0') > if (*__s++ == __sep) > { > __s[-1] = '\0'; > break; > } > *__nextp = __s; > } > return __result; >} ># 1205 "/usr/include/bits/string2.h" 3 4 >extern char *__strsep_g (char **__stringp, __const char *__delim); ># 1223 "/usr/include/bits/string2.h" 3 4 >extern __inline char *__strsep_1c (char **__s, char __reject); >extern __inline char * >__strsep_1c (char **__s, char __reject) >{ > register char *__retval = *__s; > if (__retval != ((void *)0) && (*__s = (__extension__ (__builtin_constant_p (__reject) && !__builtin_constant_p (__retval) && (__reject) == '\0' ? (char *) __rawmemchr (__retval, __reject) : __builtin_strchr (__retval, __reject)))) != ((void *)0)) > *(*__s)++ = '\0'; > return __retval; >} > >extern __inline char *__strsep_2c (char **__s, char __reject1, char __reject2); >extern __inline char * >__strsep_2c (char **__s, char __reject1, char __reject2) >{ > register char *__retval = *__s; > if (__retval != ((void *)0)) > { > register char *__cp = __retval; > while (1) > { > if (*__cp == '\0') > { > __cp = ((void *)0); > break; > } > if (*__cp == __reject1 || *__cp == __reject2) > { > *__cp++ = '\0'; > break; > } > ++__cp; > } > *__s = __cp; > } > return __retval; >} > >extern __inline char *__strsep_3c (char **__s, char __reject1, char __reject2, > char __reject3); >extern __inline char * >__strsep_3c (char **__s, char __reject1, char __reject2, char __reject3) >{ > register char *__retval = *__s; > if (__retval != ((void *)0)) > { > register char *__cp = __retval; > while (1) > { > if (*__cp == '\0') > { > __cp = ((void *)0); > break; > } > if (*__cp == __reject1 || *__cp == __reject2 || *__cp == __reject3) > { > *__cp++ = '\0'; > break; > } > ++__cp; > } > *__s = __cp; > } > return __retval; >} ># 1304 "/usr/include/bits/string2.h" 3 4 >extern char *__strdup (__const char *__string) __attribute__ ((__malloc__)); ># 1323 "/usr/include/bits/string2.h" 3 4 >extern char *__strndup (__const char *__string, size_t __n) > __attribute__ ((__malloc__)); ># 397 "/usr/include/string.h" 2 3 4 > > > > ># 65 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 > ># 1 "/usr/include/fpu_control.h" 1 3 4 ># 89 "/usr/include/fpu_control.h" 3 4 >typedef unsigned int fpu_control_t __attribute__ ((__mode__ (__HI__))); ># 100 "/usr/include/fpu_control.h" 3 4 >extern fpu_control_t __fpu_control; ># 67 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/float.h" 1 3 4 ># 70 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stdarg.h" 1 3 4 ># 71 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 ># 200 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" ># 1 "../../../../../../extras/Mesa/include/GL/gl.h" 1 ># 41 "../../../../../../extras/Mesa/include/GL/gl.h" ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 151 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 3 4 >typedef int ptrdiff_t; ># 42 "../../../../../../extras/Mesa/include/GL/gl.h" 2 ># 137 "../../../../../../extras/Mesa/include/GL/gl.h" >typedef unsigned int GLenum; >typedef unsigned char GLboolean; >typedef unsigned int GLbitfield; >typedef void GLvoid; >typedef signed char GLbyte; >typedef short GLshort; >typedef int GLint; >typedef unsigned char GLubyte; >typedef unsigned short GLushort; >typedef unsigned int GLuint; >typedef int GLsizei; >typedef float GLfloat; >typedef float GLclampf; >typedef double GLdouble; >typedef double GLclampd; ># 764 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glClearIndex( GLfloat c ); > >extern void glClearColor( GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha ); > >extern void glClear( GLbitfield mask ); > >extern void glIndexMask( GLuint mask ); > >extern void glColorMask( GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha ); > >extern void glAlphaFunc( GLenum func, GLclampf ref ); > >extern void glBlendFunc( GLenum sfactor, GLenum dfactor ); > >extern void glLogicOp( GLenum opcode ); > >extern void glCullFace( GLenum mode ); > >extern void glFrontFace( GLenum mode ); > >extern void glPointSize( GLfloat size ); > >extern void glLineWidth( GLfloat width ); > >extern void glLineStipple( GLint factor, GLushort pattern ); > >extern void glPolygonMode( GLenum face, GLenum mode ); > >extern void glPolygonOffset( GLfloat factor, GLfloat units ); > >extern void glPolygonStipple( const GLubyte *mask ); > >extern void glGetPolygonStipple( GLubyte *mask ); > >extern void glEdgeFlag( GLboolean flag ); > >extern void glEdgeFlagv( const GLboolean *flag ); > >extern void glScissor( GLint x, GLint y, GLsizei width, GLsizei height); > >extern void glClipPlane( GLenum plane, const GLdouble *equation ); > >extern void glGetClipPlane( GLenum plane, GLdouble *equation ); > >extern void glDrawBuffer( GLenum mode ); > >extern void glReadBuffer( GLenum mode ); > >extern void glEnable( GLenum cap ); > >extern void glDisable( GLenum cap ); > >extern GLboolean glIsEnabled( GLenum cap ); > > >extern void glEnableClientState( GLenum cap ); > >extern void glDisableClientState( GLenum cap ); > > >extern void glGetBooleanv( GLenum pname, GLboolean *params ); > >extern void glGetDoublev( GLenum pname, GLdouble *params ); > >extern void glGetFloatv( GLenum pname, GLfloat *params ); > >extern void glGetIntegerv( GLenum pname, GLint *params ); > > >extern void glPushAttrib( GLbitfield mask ); > >extern void glPopAttrib( void ); > > >extern void glPushClientAttrib( GLbitfield mask ); > >extern void glPopClientAttrib( void ); > > >extern GLint glRenderMode( GLenum mode ); > >extern GLenum glGetError( void ); > >extern const GLubyte* glGetString( GLenum name ); > >extern void glFinish( void ); > >extern void glFlush( void ); > >extern void glHint( GLenum target, GLenum mode ); > > > > > > >extern void glClearDepth( GLclampd depth ); > >extern void glDepthFunc( GLenum func ); > >extern void glDepthMask( GLboolean flag ); > >extern void glDepthRange( GLclampd near_val, GLclampd far_val ); > > > > > > >extern void glClearAccum( GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha ); > >extern void glAccum( GLenum op, GLfloat value ); > > > > > > >extern void glMatrixMode( GLenum mode ); > >extern void glOrtho( GLdouble left, GLdouble right, > GLdouble bottom, GLdouble top, > GLdouble near_val, GLdouble far_val ); > >extern void glFrustum( GLdouble left, GLdouble right, > GLdouble bottom, GLdouble top, > GLdouble near_val, GLdouble far_val ); > >extern void glViewport( GLint x, GLint y, > GLsizei width, GLsizei height ); > >extern void glPushMatrix( void ); > >extern void glPopMatrix( void ); > >extern void glLoadIdentity( void ); > >extern void glLoadMatrixd( const GLdouble *m ); >extern void glLoadMatrixf( const GLfloat *m ); > >extern void glMultMatrixd( const GLdouble *m ); >extern void glMultMatrixf( const GLfloat *m ); > >extern void glRotated( GLdouble angle, > GLdouble x, GLdouble y, GLdouble z ); >extern void glRotatef( GLfloat angle, > GLfloat x, GLfloat y, GLfloat z ); > >extern void glScaled( GLdouble x, GLdouble y, GLdouble z ); >extern void glScalef( GLfloat x, GLfloat y, GLfloat z ); > >extern void glTranslated( GLdouble x, GLdouble y, GLdouble z ); >extern void glTranslatef( GLfloat x, GLfloat y, GLfloat z ); > > > > > > >extern GLboolean glIsList( GLuint list ); > >extern void glDeleteLists( GLuint list, GLsizei range ); > >extern GLuint glGenLists( GLsizei range ); > >extern void glNewList( GLuint list, GLenum mode ); > >extern void glEndList( void ); > >extern void glCallList( GLuint list ); > >extern void glCallLists( GLsizei n, GLenum type, > const GLvoid *lists ); > >extern void glListBase( GLuint base ); > > > > > > >extern void glBegin( GLenum mode ); > >extern void glEnd( void ); > > >extern void glVertex2d( GLdouble x, GLdouble y ); >extern void glVertex2f( GLfloat x, GLfloat y ); >extern void glVertex2i( GLint x, GLint y ); >extern void glVertex2s( GLshort x, GLshort y ); > >extern void glVertex3d( GLdouble x, GLdouble y, GLdouble z ); >extern void glVertex3f( GLfloat x, GLfloat y, GLfloat z ); >extern void glVertex3i( GLint x, GLint y, GLint z ); >extern void glVertex3s( GLshort x, GLshort y, GLshort z ); > >extern void glVertex4d( GLdouble x, GLdouble y, GLdouble z, GLdouble w ); >extern void glVertex4f( GLfloat x, GLfloat y, GLfloat z, GLfloat w ); >extern void glVertex4i( GLint x, GLint y, GLint z, GLint w ); >extern void glVertex4s( GLshort x, GLshort y, GLshort z, GLshort w ); > >extern void glVertex2dv( const GLdouble *v ); >extern void glVertex2fv( const GLfloat *v ); >extern void glVertex2iv( const GLint *v ); >extern void glVertex2sv( const GLshort *v ); > >extern void glVertex3dv( const GLdouble *v ); >extern void glVertex3fv( const GLfloat *v ); >extern void glVertex3iv( const GLint *v ); >extern void glVertex3sv( const GLshort *v ); > >extern void glVertex4dv( const GLdouble *v ); >extern void glVertex4fv( const GLfloat *v ); >extern void glVertex4iv( const GLint *v ); >extern void glVertex4sv( const GLshort *v ); > > >extern void glNormal3b( GLbyte nx, GLbyte ny, GLbyte nz ); >extern void glNormal3d( GLdouble nx, GLdouble ny, GLdouble nz ); >extern void glNormal3f( GLfloat nx, GLfloat ny, GLfloat nz ); >extern void glNormal3i( GLint nx, GLint ny, GLint nz ); >extern void glNormal3s( GLshort nx, GLshort ny, GLshort nz ); > >extern void glNormal3bv( const GLbyte *v ); >extern void glNormal3dv( const GLdouble *v ); >extern void glNormal3fv( const GLfloat *v ); >extern void glNormal3iv( const GLint *v ); >extern void glNormal3sv( const GLshort *v ); > > >extern void glIndexd( GLdouble c ); >extern void glIndexf( GLfloat c ); >extern void glIndexi( GLint c ); >extern void glIndexs( GLshort c ); >extern void glIndexub( GLubyte c ); > >extern void glIndexdv( const GLdouble *c ); >extern void glIndexfv( const GLfloat *c ); >extern void glIndexiv( const GLint *c ); >extern void glIndexsv( const GLshort *c ); >extern void glIndexubv( const GLubyte *c ); > >extern void glColor3b( GLbyte red, GLbyte green, GLbyte blue ); >extern void glColor3d( GLdouble red, GLdouble green, GLdouble blue ); >extern void glColor3f( GLfloat red, GLfloat green, GLfloat blue ); >extern void glColor3i( GLint red, GLint green, GLint blue ); >extern void glColor3s( GLshort red, GLshort green, GLshort blue ); >extern void glColor3ub( GLubyte red, GLubyte green, GLubyte blue ); >extern void glColor3ui( GLuint red, GLuint green, GLuint blue ); >extern void glColor3us( GLushort red, GLushort green, GLushort blue ); > >extern void glColor4b( GLbyte red, GLbyte green, > GLbyte blue, GLbyte alpha ); >extern void glColor4d( GLdouble red, GLdouble green, > GLdouble blue, GLdouble alpha ); >extern void glColor4f( GLfloat red, GLfloat green, > GLfloat blue, GLfloat alpha ); >extern void glColor4i( GLint red, GLint green, > GLint blue, GLint alpha ); >extern void glColor4s( GLshort red, GLshort green, > GLshort blue, GLshort alpha ); >extern void glColor4ub( GLubyte red, GLubyte green, > GLubyte blue, GLubyte alpha ); >extern void glColor4ui( GLuint red, GLuint green, > GLuint blue, GLuint alpha ); >extern void glColor4us( GLushort red, GLushort green, > GLushort blue, GLushort alpha ); > > >extern void glColor3bv( const GLbyte *v ); >extern void glColor3dv( const GLdouble *v ); >extern void glColor3fv( const GLfloat *v ); >extern void glColor3iv( const GLint *v ); >extern void glColor3sv( const GLshort *v ); >extern void glColor3ubv( const GLubyte *v ); >extern void glColor3uiv( const GLuint *v ); >extern void glColor3usv( const GLushort *v ); > >extern void glColor4bv( const GLbyte *v ); >extern void glColor4dv( const GLdouble *v ); >extern void glColor4fv( const GLfloat *v ); >extern void glColor4iv( const GLint *v ); >extern void glColor4sv( const GLshort *v ); >extern void glColor4ubv( const GLubyte *v ); >extern void glColor4uiv( const GLuint *v ); >extern void glColor4usv( const GLushort *v ); > > >extern void glTexCoord1d( GLdouble s ); >extern void glTexCoord1f( GLfloat s ); >extern void glTexCoord1i( GLint s ); >extern void glTexCoord1s( GLshort s ); > >extern void glTexCoord2d( GLdouble s, GLdouble t ); >extern void glTexCoord2f( GLfloat s, GLfloat t ); >extern void glTexCoord2i( GLint s, GLint t ); >extern void glTexCoord2s( GLshort s, GLshort t ); > >extern void glTexCoord3d( GLdouble s, GLdouble t, GLdouble r ); >extern void glTexCoord3f( GLfloat s, GLfloat t, GLfloat r ); >extern void glTexCoord3i( GLint s, GLint t, GLint r ); >extern void glTexCoord3s( GLshort s, GLshort t, GLshort r ); > >extern void glTexCoord4d( GLdouble s, GLdouble t, GLdouble r, GLdouble q ); >extern void glTexCoord4f( GLfloat s, GLfloat t, GLfloat r, GLfloat q ); >extern void glTexCoord4i( GLint s, GLint t, GLint r, GLint q ); >extern void glTexCoord4s( GLshort s, GLshort t, GLshort r, GLshort q ); > >extern void glTexCoord1dv( const GLdouble *v ); >extern void glTexCoord1fv( const GLfloat *v ); >extern void glTexCoord1iv( const GLint *v ); >extern void glTexCoord1sv( const GLshort *v ); > >extern void glTexCoord2dv( const GLdouble *v ); >extern void glTexCoord2fv( const GLfloat *v ); >extern void glTexCoord2iv( const GLint *v ); >extern void glTexCoord2sv( const GLshort *v ); > >extern void glTexCoord3dv( const GLdouble *v ); >extern void glTexCoord3fv( const GLfloat *v ); >extern void glTexCoord3iv( const GLint *v ); >extern void glTexCoord3sv( const GLshort *v ); > >extern void glTexCoord4dv( const GLdouble *v ); >extern void glTexCoord4fv( const GLfloat *v ); >extern void glTexCoord4iv( const GLint *v ); >extern void glTexCoord4sv( const GLshort *v ); > > >extern void glRasterPos2d( GLdouble x, GLdouble y ); >extern void glRasterPos2f( GLfloat x, GLfloat y ); >extern void glRasterPos2i( GLint x, GLint y ); >extern void glRasterPos2s( GLshort x, GLshort y ); > >extern void glRasterPos3d( GLdouble x, GLdouble y, GLdouble z ); >extern void glRasterPos3f( GLfloat x, GLfloat y, GLfloat z ); >extern void glRasterPos3i( GLint x, GLint y, GLint z ); >extern void glRasterPos3s( GLshort x, GLshort y, GLshort z ); > >extern void glRasterPos4d( GLdouble x, GLdouble y, GLdouble z, GLdouble w ); >extern void glRasterPos4f( GLfloat x, GLfloat y, GLfloat z, GLfloat w ); >extern void glRasterPos4i( GLint x, GLint y, GLint z, GLint w ); >extern void glRasterPos4s( GLshort x, GLshort y, GLshort z, GLshort w ); > >extern void glRasterPos2dv( const GLdouble *v ); >extern void glRasterPos2fv( const GLfloat *v ); >extern void glRasterPos2iv( const GLint *v ); >extern void glRasterPos2sv( const GLshort *v ); > >extern void glRasterPos3dv( const GLdouble *v ); >extern void glRasterPos3fv( const GLfloat *v ); >extern void glRasterPos3iv( const GLint *v ); >extern void glRasterPos3sv( const GLshort *v ); > >extern void glRasterPos4dv( const GLdouble *v ); >extern void glRasterPos4fv( const GLfloat *v ); >extern void glRasterPos4iv( const GLint *v ); >extern void glRasterPos4sv( const GLshort *v ); > > >extern void glRectd( GLdouble x1, GLdouble y1, GLdouble x2, GLdouble y2 ); >extern void glRectf( GLfloat x1, GLfloat y1, GLfloat x2, GLfloat y2 ); >extern void glRecti( GLint x1, GLint y1, GLint x2, GLint y2 ); >extern void glRects( GLshort x1, GLshort y1, GLshort x2, GLshort y2 ); > > >extern void glRectdv( const GLdouble *v1, const GLdouble *v2 ); >extern void glRectfv( const GLfloat *v1, const GLfloat *v2 ); >extern void glRectiv( const GLint *v1, const GLint *v2 ); >extern void glRectsv( const GLshort *v1, const GLshort *v2 ); > > > > > > >extern void glVertexPointer( GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr ); > >extern void glNormalPointer( GLenum type, GLsizei stride, > const GLvoid *ptr ); > >extern void glColorPointer( GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr ); > >extern void glIndexPointer( GLenum type, GLsizei stride, > const GLvoid *ptr ); > >extern void glTexCoordPointer( GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr ); > >extern void glEdgeFlagPointer( GLsizei stride, const GLvoid *ptr ); > >extern void glGetPointerv( GLenum pname, GLvoid **params ); > >extern void glArrayElement( GLint i ); > >extern void glDrawArrays( GLenum mode, GLint first, GLsizei count ); > >extern void glDrawElements( GLenum mode, GLsizei count, > GLenum type, const GLvoid *indices ); > >extern void glInterleavedArrays( GLenum format, GLsizei stride, > const GLvoid *pointer ); > > > > > >extern void glShadeModel( GLenum mode ); > >extern void glLightf( GLenum light, GLenum pname, GLfloat param ); >extern void glLighti( GLenum light, GLenum pname, GLint param ); >extern void glLightfv( GLenum light, GLenum pname, > const GLfloat *params ); >extern void glLightiv( GLenum light, GLenum pname, > const GLint *params ); > >extern void glGetLightfv( GLenum light, GLenum pname, > GLfloat *params ); >extern void glGetLightiv( GLenum light, GLenum pname, > GLint *params ); > >extern void glLightModelf( GLenum pname, GLfloat param ); >extern void glLightModeli( GLenum pname, GLint param ); >extern void glLightModelfv( GLenum pname, const GLfloat *params ); >extern void glLightModeliv( GLenum pname, const GLint *params ); > >extern void glMaterialf( GLenum face, GLenum pname, GLfloat param ); >extern void glMateriali( GLenum face, GLenum pname, GLint param ); >extern void glMaterialfv( GLenum face, GLenum pname, const GLfloat *params ); >extern void glMaterialiv( GLenum face, GLenum pname, const GLint *params ); > >extern void glGetMaterialfv( GLenum face, GLenum pname, GLfloat *params ); >extern void glGetMaterialiv( GLenum face, GLenum pname, GLint *params ); > >extern void glColorMaterial( GLenum face, GLenum mode ); > > > > > > >extern void glPixelZoom( GLfloat xfactor, GLfloat yfactor ); > >extern void glPixelStoref( GLenum pname, GLfloat param ); >extern void glPixelStorei( GLenum pname, GLint param ); > >extern void glPixelTransferf( GLenum pname, GLfloat param ); >extern void glPixelTransferi( GLenum pname, GLint param ); > >extern void glPixelMapfv( GLenum map, GLsizei mapsize, > const GLfloat *values ); >extern void glPixelMapuiv( GLenum map, GLsizei mapsize, > const GLuint *values ); >extern void glPixelMapusv( GLenum map, GLsizei mapsize, > const GLushort *values ); > >extern void glGetPixelMapfv( GLenum map, GLfloat *values ); >extern void glGetPixelMapuiv( GLenum map, GLuint *values ); >extern void glGetPixelMapusv( GLenum map, GLushort *values ); > >extern void glBitmap( GLsizei width, GLsizei height, > GLfloat xorig, GLfloat yorig, > GLfloat xmove, GLfloat ymove, > const GLubyte *bitmap ); > >extern void glReadPixels( GLint x, GLint y, > GLsizei width, GLsizei height, > GLenum format, GLenum type, > GLvoid *pixels ); > >extern void glDrawPixels( GLsizei width, GLsizei height, > GLenum format, GLenum type, > const GLvoid *pixels ); > >extern void glCopyPixels( GLint x, GLint y, > GLsizei width, GLsizei height, > GLenum type ); > > > > > >extern void glStencilFunc( GLenum func, GLint ref, GLuint mask ); > >extern void glStencilMask( GLuint mask ); > >extern void glStencilOp( GLenum fail, GLenum zfail, GLenum zpass ); > >extern void glClearStencil( GLint s ); > > > > > > > >extern void glTexGend( GLenum coord, GLenum pname, GLdouble param ); >extern void glTexGenf( GLenum coord, GLenum pname, GLfloat param ); >extern void glTexGeni( GLenum coord, GLenum pname, GLint param ); > >extern void glTexGendv( GLenum coord, GLenum pname, const GLdouble *params ); >extern void glTexGenfv( GLenum coord, GLenum pname, const GLfloat *params ); >extern void glTexGeniv( GLenum coord, GLenum pname, const GLint *params ); > >extern void glGetTexGendv( GLenum coord, GLenum pname, GLdouble *params ); >extern void glGetTexGenfv( GLenum coord, GLenum pname, GLfloat *params ); >extern void glGetTexGeniv( GLenum coord, GLenum pname, GLint *params ); > > >extern void glTexEnvf( GLenum target, GLenum pname, GLfloat param ); >extern void glTexEnvi( GLenum target, GLenum pname, GLint param ); > >extern void glTexEnvfv( GLenum target, GLenum pname, const GLfloat *params ); >extern void glTexEnviv( GLenum target, GLenum pname, const GLint *params ); > >extern void glGetTexEnvfv( GLenum target, GLenum pname, GLfloat *params ); >extern void glGetTexEnviv( GLenum target, GLenum pname, GLint *params ); > > >extern void glTexParameterf( GLenum target, GLenum pname, GLfloat param ); >extern void glTexParameteri( GLenum target, GLenum pname, GLint param ); > >extern void glTexParameterfv( GLenum target, GLenum pname, > const GLfloat *params ); >extern void glTexParameteriv( GLenum target, GLenum pname, > const GLint *params ); > >extern void glGetTexParameterfv( GLenum target, > GLenum pname, GLfloat *params); >extern void glGetTexParameteriv( GLenum target, > GLenum pname, GLint *params ); > >extern void glGetTexLevelParameterfv( GLenum target, GLint level, > GLenum pname, GLfloat *params ); >extern void glGetTexLevelParameteriv( GLenum target, GLint level, > GLenum pname, GLint *params ); > > >extern void glTexImage1D( GLenum target, GLint level, > GLint internalFormat, > GLsizei width, GLint border, > GLenum format, GLenum type, > const GLvoid *pixels ); > >extern void glTexImage2D( GLenum target, GLint level, > GLint internalFormat, > GLsizei width, GLsizei height, > GLint border, GLenum format, GLenum type, > const GLvoid *pixels ); > >extern void glGetTexImage( GLenum target, GLint level, > GLenum format, GLenum type, > GLvoid *pixels ); > > > > >extern void glGenTextures( GLsizei n, GLuint *textures ); > >extern void glDeleteTextures( GLsizei n, const GLuint *textures); > >extern void glBindTexture( GLenum target, GLuint texture ); > >extern void glPrioritizeTextures( GLsizei n, > const GLuint *textures, > const GLclampf *priorities ); > >extern GLboolean glAreTexturesResident( GLsizei n, > const GLuint *textures, > GLboolean *residences ); > >extern GLboolean glIsTexture( GLuint texture ); > > >extern void glTexSubImage1D( GLenum target, GLint level, > GLint xoffset, > GLsizei width, GLenum format, > GLenum type, const GLvoid *pixels ); > > >extern void glTexSubImage2D( GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLsizei width, GLsizei height, > GLenum format, GLenum type, > const GLvoid *pixels ); > > >extern void glCopyTexImage1D( GLenum target, GLint level, > GLenum internalformat, > GLint x, GLint y, > GLsizei width, GLint border ); > > >extern void glCopyTexImage2D( GLenum target, GLint level, > GLenum internalformat, > GLint x, GLint y, > GLsizei width, GLsizei height, > GLint border ); > > >extern void glCopyTexSubImage1D( GLenum target, GLint level, > GLint xoffset, GLint x, GLint y, > GLsizei width ); > > >extern void glCopyTexSubImage2D( GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLint x, GLint y, > GLsizei width, GLsizei height ); > > > > > > >extern void glMap1d( GLenum target, GLdouble u1, GLdouble u2, > GLint stride, > GLint order, const GLdouble *points ); >extern void glMap1f( GLenum target, GLfloat u1, GLfloat u2, > GLint stride, > GLint order, const GLfloat *points ); > >extern void glMap2d( GLenum target, > GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, > GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, > const GLdouble *points ); >extern void glMap2f( GLenum target, > GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, > GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, > const GLfloat *points ); > >extern void glGetMapdv( GLenum target, GLenum query, GLdouble *v ); >extern void glGetMapfv( GLenum target, GLenum query, GLfloat *v ); >extern void glGetMapiv( GLenum target, GLenum query, GLint *v ); > >extern void glEvalCoord1d( GLdouble u ); >extern void glEvalCoord1f( GLfloat u ); > >extern void glEvalCoord1dv( const GLdouble *u ); >extern void glEvalCoord1fv( const GLfloat *u ); > >extern void glEvalCoord2d( GLdouble u, GLdouble v ); >extern void glEvalCoord2f( GLfloat u, GLfloat v ); > >extern void glEvalCoord2dv( const GLdouble *u ); >extern void glEvalCoord2fv( const GLfloat *u ); > >extern void glMapGrid1d( GLint un, GLdouble u1, GLdouble u2 ); >extern void glMapGrid1f( GLint un, GLfloat u1, GLfloat u2 ); > >extern void glMapGrid2d( GLint un, GLdouble u1, GLdouble u2, > GLint vn, GLdouble v1, GLdouble v2 ); >extern void glMapGrid2f( GLint un, GLfloat u1, GLfloat u2, > GLint vn, GLfloat v1, GLfloat v2 ); > >extern void glEvalPoint1( GLint i ); > >extern void glEvalPoint2( GLint i, GLint j ); > >extern void glEvalMesh1( GLenum mode, GLint i1, GLint i2 ); > >extern void glEvalMesh2( GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2 ); > > > > > > >extern void glFogf( GLenum pname, GLfloat param ); > >extern void glFogi( GLenum pname, GLint param ); > >extern void glFogfv( GLenum pname, const GLfloat *params ); > >extern void glFogiv( GLenum pname, const GLint *params ); > > > > > > >extern void glFeedbackBuffer( GLsizei size, GLenum type, GLfloat *buffer ); > >extern void glPassThrough( GLfloat token ); > >extern void glSelectBuffer( GLsizei size, GLuint *buffer ); > >extern void glInitNames( void ); > >extern void glLoadName( GLuint name ); > >extern void glPushName( GLuint name ); > >extern void glPopName( void ); ># 1509 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glDrawRangeElements( GLenum mode, GLuint start, > GLuint end, GLsizei count, GLenum type, const GLvoid *indices ); > >extern void glTexImage3D( GLenum target, GLint level, > GLint internalFormat, > GLsizei width, GLsizei height, > GLsizei depth, GLint border, > GLenum format, GLenum type, > const GLvoid *pixels ); > >extern void glTexSubImage3D( GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLint zoffset, GLsizei width, > GLsizei height, GLsizei depth, > GLenum format, > GLenum type, const GLvoid *pixels); > >extern void glCopyTexSubImage3D( GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLint zoffset, GLint x, > GLint y, GLsizei width, > GLsizei height ); > >typedef void ( * PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); >typedef void ( * PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); >typedef void ( * PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); >typedef void ( * PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); ># 1619 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glColorTable( GLenum target, GLenum internalformat, > GLsizei width, GLenum format, > GLenum type, const GLvoid *table ); > >extern void glColorSubTable( GLenum target, > GLsizei start, GLsizei count, > GLenum format, GLenum type, > const GLvoid *data ); > >extern void glColorTableParameteriv(GLenum target, GLenum pname, > const GLint *params); > >extern void glColorTableParameterfv(GLenum target, GLenum pname, > const GLfloat *params); > >extern void glCopyColorSubTable( GLenum target, GLsizei start, > GLint x, GLint y, GLsizei width ); > >extern void glCopyColorTable( GLenum target, GLenum internalformat, > GLint x, GLint y, GLsizei width ); > >extern void glGetColorTable( GLenum target, GLenum format, > GLenum type, GLvoid *table ); > >extern void glGetColorTableParameterfv( GLenum target, GLenum pname, > GLfloat *params ); > >extern void glGetColorTableParameteriv( GLenum target, GLenum pname, > GLint *params ); > >extern void glBlendEquation( GLenum mode ); > >extern void glBlendColor( GLclampf red, GLclampf green, > GLclampf blue, GLclampf alpha ); > >extern void glHistogram( GLenum target, GLsizei width, > GLenum internalformat, GLboolean sink ); > >extern void glResetHistogram( GLenum target ); > >extern void glGetHistogram( GLenum target, GLboolean reset, > GLenum format, GLenum type, > GLvoid *values ); > >extern void glGetHistogramParameterfv( GLenum target, GLenum pname, > GLfloat *params ); > >extern void glGetHistogramParameteriv( GLenum target, GLenum pname, > GLint *params ); > >extern void glMinmax( GLenum target, GLenum internalformat, > GLboolean sink ); > >extern void glResetMinmax( GLenum target ); > >extern void glGetMinmax( GLenum target, GLboolean reset, > GLenum format, GLenum types, > GLvoid *values ); > >extern void glGetMinmaxParameterfv( GLenum target, GLenum pname, > GLfloat *params ); > >extern void glGetMinmaxParameteriv( GLenum target, GLenum pname, > GLint *params ); > >extern void glConvolutionFilter1D( GLenum target, > GLenum internalformat, GLsizei width, GLenum format, GLenum type, > const GLvoid *image ); > >extern void glConvolutionFilter2D( GLenum target, > GLenum internalformat, GLsizei width, GLsizei height, GLenum format, > GLenum type, const GLvoid *image ); > >extern void glConvolutionParameterf( GLenum target, GLenum pname, > GLfloat params ); > >extern void glConvolutionParameterfv( GLenum target, GLenum pname, > const GLfloat *params ); > >extern void glConvolutionParameteri( GLenum target, GLenum pname, > GLint params ); > >extern void glConvolutionParameteriv( GLenum target, GLenum pname, > const GLint *params ); > >extern void glCopyConvolutionFilter1D( GLenum target, > GLenum internalformat, GLint x, GLint y, GLsizei width ); > >extern void glCopyConvolutionFilter2D( GLenum target, > GLenum internalformat, GLint x, GLint y, GLsizei width, > GLsizei height); > >extern void glGetConvolutionFilter( GLenum target, GLenum format, > GLenum type, GLvoid *image ); > >extern void glGetConvolutionParameterfv( GLenum target, GLenum pname, > GLfloat *params ); > >extern void glGetConvolutionParameteriv( GLenum target, GLenum pname, > GLint *params ); > >extern void glSeparableFilter2D( GLenum target, > GLenum internalformat, GLsizei width, GLsizei height, GLenum format, > GLenum type, const GLvoid *row, const GLvoid *column ); > >extern void glGetSeparableFilter( GLenum target, GLenum format, > GLenum type, GLvoid *row, GLvoid *column, GLvoid *span ); > >typedef void ( * PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); >typedef void ( * PFNGLBLENDEQUATIONPROC) (GLenum mode); >typedef void ( * PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); >typedef void ( * PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); >typedef void ( * PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); >typedef void ( * PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); >typedef void ( * PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); >typedef void ( * PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); >typedef void ( * PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); >typedef void ( * PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); >typedef void ( * PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); >typedef void ( * PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); >typedef void ( * PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); >typedef void ( * PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); >typedef void ( * PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); >typedef void ( * PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); >typedef void ( * PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); >typedef void ( * PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); >typedef void ( * PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); >typedef void ( * PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); >typedef void ( * PFNGLRESETHISTOGRAMPROC) (GLenum target); >typedef void ( * PFNGLRESETMINMAXPROC) (GLenum target); ># 1873 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glActiveTexture( GLenum texture ); > >extern void glClientActiveTexture( GLenum texture ); > >extern void glCompressedTexImage1D( GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data ); > >extern void glCompressedTexImage2D( GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data ); > >extern void glCompressedTexImage3D( GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data ); > >extern void glCompressedTexSubImage1D( GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data ); > >extern void glCompressedTexSubImage2D( GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data ); > >extern void glCompressedTexSubImage3D( GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data ); > >extern void glGetCompressedTexImage( GLenum target, GLint lod, GLvoid *img ); > >extern void glMultiTexCoord1d( GLenum target, GLdouble s ); > >extern void glMultiTexCoord1dv( GLenum target, const GLdouble *v ); > >extern void glMultiTexCoord1f( GLenum target, GLfloat s ); > >extern void glMultiTexCoord1fv( GLenum target, const GLfloat *v ); > >extern void glMultiTexCoord1i( GLenum target, GLint s ); > >extern void glMultiTexCoord1iv( GLenum target, const GLint *v ); > >extern void glMultiTexCoord1s( GLenum target, GLshort s ); > >extern void glMultiTexCoord1sv( GLenum target, const GLshort *v ); > >extern void glMultiTexCoord2d( GLenum target, GLdouble s, GLdouble t ); > >extern void glMultiTexCoord2dv( GLenum target, const GLdouble *v ); > >extern void glMultiTexCoord2f( GLenum target, GLfloat s, GLfloat t ); > >extern void glMultiTexCoord2fv( GLenum target, const GLfloat *v ); > >extern void glMultiTexCoord2i( GLenum target, GLint s, GLint t ); > >extern void glMultiTexCoord2iv( GLenum target, const GLint *v ); > >extern void glMultiTexCoord2s( GLenum target, GLshort s, GLshort t ); > >extern void glMultiTexCoord2sv( GLenum target, const GLshort *v ); > >extern void glMultiTexCoord3d( GLenum target, GLdouble s, GLdouble t, GLdouble r ); > >extern void glMultiTexCoord3dv( GLenum target, const GLdouble *v ); > >extern void glMultiTexCoord3f( GLenum target, GLfloat s, GLfloat t, GLfloat r ); > >extern void glMultiTexCoord3fv( GLenum target, const GLfloat *v ); > >extern void glMultiTexCoord3i( GLenum target, GLint s, GLint t, GLint r ); > >extern void glMultiTexCoord3iv( GLenum target, const GLint *v ); > >extern void glMultiTexCoord3s( GLenum target, GLshort s, GLshort t, GLshort r ); > >extern void glMultiTexCoord3sv( GLenum target, const GLshort *v ); > >extern void glMultiTexCoord4d( GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q ); > >extern void glMultiTexCoord4dv( GLenum target, const GLdouble *v ); > >extern void glMultiTexCoord4f( GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q ); > >extern void glMultiTexCoord4fv( GLenum target, const GLfloat *v ); > >extern void glMultiTexCoord4i( GLenum target, GLint s, GLint t, GLint r, GLint q ); > >extern void glMultiTexCoord4iv( GLenum target, const GLint *v ); > >extern void glMultiTexCoord4s( GLenum target, GLshort s, GLshort t, GLshort r, GLshort q ); > >extern void glMultiTexCoord4sv( GLenum target, const GLshort *v ); > > >extern void glLoadTransposeMatrixd( const GLdouble m[16] ); > >extern void glLoadTransposeMatrixf( const GLfloat m[16] ); > >extern void glMultTransposeMatrixd( const GLdouble m[16] ); > >extern void glMultTransposeMatrixf( const GLfloat m[16] ); > >extern void glSampleCoverage( GLclampf value, GLboolean invert ); > >typedef void ( * PFNGLACTIVETEXTUREPROC) (GLenum texture); >typedef void ( * PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); >typedef void ( * PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); >typedef void ( * PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); >typedef void ( * PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); >typedef void ( * PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); >typedef void ( * PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); >typedef void ( * PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); >typedef void ( * PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); >typedef void ( * PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); >typedef void ( * PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); >typedef void ( * PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); >typedef void ( * PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); >typedef void ( * PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); >typedef void ( * PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); >typedef void ( * PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); >typedef void ( * PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); >typedef void ( * PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); >typedef void ( * PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); >typedef void ( * PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); >typedef void ( * PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); >typedef void ( * PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); >typedef void ( * PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert); >typedef void ( * PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img); ># 2056 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glActiveTextureARB(GLenum texture); >extern void glClientActiveTextureARB(GLenum texture); >extern void glMultiTexCoord1dARB(GLenum target, GLdouble s); >extern void glMultiTexCoord1dvARB(GLenum target, const GLdouble *v); >extern void glMultiTexCoord1fARB(GLenum target, GLfloat s); >extern void glMultiTexCoord1fvARB(GLenum target, const GLfloat *v); >extern void glMultiTexCoord1iARB(GLenum target, GLint s); >extern void glMultiTexCoord1ivARB(GLenum target, const GLint *v); >extern void glMultiTexCoord1sARB(GLenum target, GLshort s); >extern void glMultiTexCoord1svARB(GLenum target, const GLshort *v); >extern void glMultiTexCoord2dARB(GLenum target, GLdouble s, GLdouble t); >extern void glMultiTexCoord2dvARB(GLenum target, const GLdouble *v); >extern void glMultiTexCoord2fARB(GLenum target, GLfloat s, GLfloat t); >extern void glMultiTexCoord2fvARB(GLenum target, const GLfloat *v); >extern void glMultiTexCoord2iARB(GLenum target, GLint s, GLint t); >extern void glMultiTexCoord2ivARB(GLenum target, const GLint *v); >extern void glMultiTexCoord2sARB(GLenum target, GLshort s, GLshort t); >extern void glMultiTexCoord2svARB(GLenum target, const GLshort *v); >extern void glMultiTexCoord3dARB(GLenum target, GLdouble s, GLdouble t, GLdouble r); >extern void glMultiTexCoord3dvARB(GLenum target, const GLdouble *v); >extern void glMultiTexCoord3fARB(GLenum target, GLfloat s, GLfloat t, GLfloat r); >extern void glMultiTexCoord3fvARB(GLenum target, const GLfloat *v); >extern void glMultiTexCoord3iARB(GLenum target, GLint s, GLint t, GLint r); >extern void glMultiTexCoord3ivARB(GLenum target, const GLint *v); >extern void glMultiTexCoord3sARB(GLenum target, GLshort s, GLshort t, GLshort r); >extern void glMultiTexCoord3svARB(GLenum target, const GLshort *v); >extern void glMultiTexCoord4dARB(GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); >extern void glMultiTexCoord4dvARB(GLenum target, const GLdouble *v); >extern void glMultiTexCoord4fARB(GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); >extern void glMultiTexCoord4fvARB(GLenum target, const GLfloat *v); >extern void glMultiTexCoord4iARB(GLenum target, GLint s, GLint t, GLint r, GLint q); >extern void glMultiTexCoord4ivARB(GLenum target, const GLint *v); >extern void glMultiTexCoord4sARB(GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); >extern void glMultiTexCoord4svARB(GLenum target, const GLshort *v); > >typedef void ( * PFNGLACTIVETEXTUREARBPROC) (GLenum texture); >typedef void ( * PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); >typedef void ( * PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); >typedef void ( * PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); >typedef void ( * PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); >typedef void ( * PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); >typedef void ( * PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); >typedef void ( * PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); >typedef void ( * PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); >typedef void ( * PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); >typedef void ( * PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); >typedef void ( * PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); >typedef void ( * PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); >typedef void ( * PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); >typedef void ( * PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); >typedef void ( * PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); >typedef void ( * PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); >typedef void ( * PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); >typedef void ( * PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); >typedef void ( * PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); >typedef void ( * PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); >typedef void ( * PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); >typedef void ( * PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); ># 2140 "../../../../../../extras/Mesa/include/GL/gl.h" ># 1 "../../../../../../extras/Mesa/include/GL/glext.h" 1 ># 2852 "../../../../../../extras/Mesa/include/GL/glext.h" ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 2853 "../../../../../../extras/Mesa/include/GL/glext.h" 2 > > >typedef ptrdiff_t GLintptr; >typedef ptrdiff_t GLsizeiptr; > > > > >typedef ptrdiff_t GLintptrARB; >typedef ptrdiff_t GLsizeiptrARB; > > > > >typedef char GLcharARB; >typedef unsigned int GLhandleARB; > > > > >typedef unsigned short GLhalfNV; ># 3059 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum); >extern void glFogCoordf (GLfloat); >extern void glFogCoordfv (const GLfloat *); >extern void glFogCoordd (GLdouble); >extern void glFogCoorddv (const GLdouble *); >extern void glFogCoordPointer (GLenum, GLsizei, const GLvoid *); >extern void glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei); >extern void glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); >extern void glPointParameterf (GLenum, GLfloat); >extern void glPointParameterfv (GLenum, const GLfloat *); >extern void glPointParameteri (GLenum, GLint); >extern void glPointParameteriv (GLenum, const GLint *); >extern void glSecondaryColor3b (GLbyte, GLbyte, GLbyte); >extern void glSecondaryColor3bv (const GLbyte *); >extern void glSecondaryColor3d (GLdouble, GLdouble, GLdouble); >extern void glSecondaryColor3dv (const GLdouble *); >extern void glSecondaryColor3f (GLfloat, GLfloat, GLfloat); >extern void glSecondaryColor3fv (const GLfloat *); >extern void glSecondaryColor3i (GLint, GLint, GLint); >extern void glSecondaryColor3iv (const GLint *); >extern void glSecondaryColor3s (GLshort, GLshort, GLshort); >extern void glSecondaryColor3sv (const GLshort *); >extern void glSecondaryColor3ub (GLubyte, GLubyte, GLubyte); >extern void glSecondaryColor3ubv (const GLubyte *); >extern void glSecondaryColor3ui (GLuint, GLuint, GLuint); >extern void glSecondaryColor3uiv (const GLuint *); >extern void glSecondaryColor3us (GLushort, GLushort, GLushort); >extern void glSecondaryColor3usv (const GLushort *); >extern void glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *); >extern void glWindowPos2d (GLdouble, GLdouble); >extern void glWindowPos2dv (const GLdouble *); >extern void glWindowPos2f (GLfloat, GLfloat); >extern void glWindowPos2fv (const GLfloat *); >extern void glWindowPos2i (GLint, GLint); >extern void glWindowPos2iv (const GLint *); >extern void glWindowPos2s (GLshort, GLshort); >extern void glWindowPos2sv (const GLshort *); >extern void glWindowPos3d (GLdouble, GLdouble, GLdouble); >extern void glWindowPos3dv (const GLdouble *); >extern void glWindowPos3f (GLfloat, GLfloat, GLfloat); >extern void glWindowPos3fv (const GLfloat *); >extern void glWindowPos3i (GLint, GLint, GLint); >extern void glWindowPos3iv (const GLint *); >extern void glWindowPos3s (GLshort, GLshort, GLshort); >extern void glWindowPos3sv (const GLshort *); > >typedef void ( * PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); >typedef void ( * PFNGLFOGCOORDFPROC) (GLfloat coord); >typedef void ( * PFNGLFOGCOORDFVPROC) (const GLfloat *coord); >typedef void ( * PFNGLFOGCOORDDPROC) (GLdouble coord); >typedef void ( * PFNGLFOGCOORDDVPROC) (const GLdouble *coord); >typedef void ( * PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); >typedef void ( * PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); >typedef void ( * PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); >typedef void ( * PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); >typedef void ( * PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); >typedef void ( * PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); >typedef void ( * PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); >typedef void ( * PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); >typedef void ( * PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); >typedef void ( * PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); >typedef void ( * PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); >typedef void ( * PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); >typedef void ( * PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); >typedef void ( * PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); >typedef void ( * PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); >typedef void ( * PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); >typedef void ( * PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); >typedef void ( * PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); >typedef void ( * PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); >typedef void ( * PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); >typedef void ( * PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); >typedef void ( * PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); >typedef void ( * PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); >typedef void ( * PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); >typedef void ( * PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); >typedef void ( * PFNGLWINDOWPOS2IVPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); >typedef void ( * PFNGLWINDOWPOS2SVPROC) (const GLshort *v); >typedef void ( * PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); >typedef void ( * PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); >typedef void ( * PFNGLWINDOWPOS3IVPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); >typedef void ( * PFNGLWINDOWPOS3SVPROC) (const GLshort *v); > > > > > >extern void glGenQueries (GLsizei, GLuint *); >extern void glDeleteQueries (GLsizei, const GLuint *); >extern GLboolean glIsQuery (GLuint); >extern void glBeginQuery (GLenum, GLuint); >extern void glEndQuery (GLenum); >extern void glGetQueryiv (GLenum, GLenum, GLint *); >extern void glGetQueryObjectiv (GLuint, GLenum, GLint *); >extern void glGetQueryObjectuiv (GLuint, GLenum, GLuint *); >extern void glBindBuffer (GLenum, GLuint); >extern void glDeleteBuffers (GLsizei, const GLuint *); >extern void glGenBuffers (GLsizei, GLuint *); >extern GLboolean glIsBuffer (GLuint); >extern void glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum); >extern void glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *); >extern void glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *); >extern GLvoid* glMapBuffer (GLenum, GLenum); >extern GLboolean glUnmapBuffer (GLenum); >extern void glGetBufferParameteriv (GLenum, GLenum, GLint *); >extern void glGetBufferPointerv (GLenum, GLenum, GLvoid* *); > >typedef void ( * PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); >typedef void ( * PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); >typedef GLboolean ( * PFNGLISQUERYPROC) (GLuint id); >typedef void ( * PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); >typedef void ( * PFNGLENDQUERYPROC) (GLenum target); >typedef void ( * PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); >typedef void ( * PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); >typedef void ( * PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); >typedef void ( * PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); >typedef void ( * PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); >typedef GLboolean ( * PFNGLISBUFFERPROC) (GLuint buffer); >typedef void ( * PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); >typedef void ( * PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); >typedef void ( * PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); >typedef GLvoid* ( * PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); >typedef GLboolean ( * PFNGLUNMAPBUFFERPROC) (GLenum target); >typedef void ( * PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params); ># 3273 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glLoadTransposeMatrixfARB (const GLfloat *); >extern void glLoadTransposeMatrixdARB (const GLdouble *); >extern void glMultTransposeMatrixfARB (const GLfloat *); >extern void glMultTransposeMatrixdARB (const GLdouble *); > >typedef void ( * PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); >typedef void ( * PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); >typedef void ( * PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); >typedef void ( * PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); > > > > > >extern void glSampleCoverageARB (GLclampf, GLboolean); > >typedef void ( * PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert); ># 3303 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); >extern void glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); >extern void glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); >extern void glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); >extern void glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); >extern void glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); >extern void glGetCompressedTexImageARB (GLenum, GLint, GLvoid *); > >typedef void ( * PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); >typedef void ( * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); ># 3327 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glPointParameterfARB (GLenum, GLfloat); >extern void glPointParameterfvARB (GLenum, const GLfloat *); > >typedef void ( * PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); > > > > > >extern void glWeightbvARB (GLint, const GLbyte *); >extern void glWeightsvARB (GLint, const GLshort *); >extern void glWeightivARB (GLint, const GLint *); >extern void glWeightfvARB (GLint, const GLfloat *); >extern void glWeightdvARB (GLint, const GLdouble *); >extern void glWeightubvARB (GLint, const GLubyte *); >extern void glWeightusvARB (GLint, const GLushort *); >extern void glWeightuivARB (GLint, const GLuint *); >extern void glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *); >extern void glVertexBlendARB (GLint); > >typedef void ( * PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); >typedef void ( * PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); >typedef void ( * PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); >typedef void ( * PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); >typedef void ( * PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); >typedef void ( * PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); >typedef void ( * PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); >typedef void ( * PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); >typedef void ( * PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); >typedef void ( * PFNGLVERTEXBLENDARBPROC) (GLint count); > > > > > >extern void glCurrentPaletteMatrixARB (GLint); >extern void glMatrixIndexubvARB (GLint, const GLubyte *); >extern void glMatrixIndexusvARB (GLint, const GLushort *); >extern void glMatrixIndexuivARB (GLint, const GLuint *); >extern void glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *); > >typedef void ( * PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); >typedef void ( * PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); >typedef void ( * PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); >typedef void ( * PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); >typedef void ( * PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); ># 3407 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glWindowPos2dARB (GLdouble, GLdouble); >extern void glWindowPos2dvARB (const GLdouble *); >extern void glWindowPos2fARB (GLfloat, GLfloat); >extern void glWindowPos2fvARB (const GLfloat *); >extern void glWindowPos2iARB (GLint, GLint); >extern void glWindowPos2ivARB (const GLint *); >extern void glWindowPos2sARB (GLshort, GLshort); >extern void glWindowPos2svARB (const GLshort *); >extern void glWindowPos3dARB (GLdouble, GLdouble, GLdouble); >extern void glWindowPos3dvARB (const GLdouble *); >extern void glWindowPos3fARB (GLfloat, GLfloat, GLfloat); >extern void glWindowPos3fvARB (const GLfloat *); >extern void glWindowPos3iARB (GLint, GLint, GLint); >extern void glWindowPos3ivARB (const GLint *); >extern void glWindowPos3sARB (GLshort, GLshort, GLshort); >extern void glWindowPos3svARB (const GLshort *); > >typedef void ( * PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); >typedef void ( * PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); >typedef void ( * PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); >typedef void ( * PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); >typedef void ( * PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); >typedef void ( * PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); >typedef void ( * PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); >typedef void ( * PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); >typedef void ( * PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); > > > > > >extern void glVertexAttrib1dARB (GLuint, GLdouble); >extern void glVertexAttrib1dvARB (GLuint, const GLdouble *); >extern void glVertexAttrib1fARB (GLuint, GLfloat); >extern void glVertexAttrib1fvARB (GLuint, const GLfloat *); >extern void glVertexAttrib1sARB (GLuint, GLshort); >extern void glVertexAttrib1svARB (GLuint, const GLshort *); >extern void glVertexAttrib2dARB (GLuint, GLdouble, GLdouble); >extern void glVertexAttrib2dvARB (GLuint, const GLdouble *); >extern void glVertexAttrib2fARB (GLuint, GLfloat, GLfloat); >extern void glVertexAttrib2fvARB (GLuint, const GLfloat *); >extern void glVertexAttrib2sARB (GLuint, GLshort, GLshort); >extern void glVertexAttrib2svARB (GLuint, const GLshort *); >extern void glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble); >extern void glVertexAttrib3dvARB (GLuint, const GLdouble *); >extern void glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat); >extern void glVertexAttrib3fvARB (GLuint, const GLfloat *); >extern void glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort); >extern void glVertexAttrib3svARB (GLuint, const GLshort *); >extern void glVertexAttrib4NbvARB (GLuint, const GLbyte *); >extern void glVertexAttrib4NivARB (GLuint, const GLint *); >extern void glVertexAttrib4NsvARB (GLuint, const GLshort *); >extern void glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); >extern void glVertexAttrib4NubvARB (GLuint, const GLubyte *); >extern void glVertexAttrib4NuivARB (GLuint, const GLuint *); >extern void glVertexAttrib4NusvARB (GLuint, const GLushort *); >extern void glVertexAttrib4bvARB (GLuint, const GLbyte *); >extern void glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glVertexAttrib4dvARB (GLuint, const GLdouble *); >extern void glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glVertexAttrib4fvARB (GLuint, const GLfloat *); >extern void glVertexAttrib4ivARB (GLuint, const GLint *); >extern void glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort); >extern void glVertexAttrib4svARB (GLuint, const GLshort *); >extern void glVertexAttrib4ubvARB (GLuint, const GLubyte *); >extern void glVertexAttrib4uivARB (GLuint, const GLuint *); >extern void glVertexAttrib4usvARB (GLuint, const GLushort *); >extern void glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); >extern void glEnableVertexAttribArrayARB (GLuint); >extern void glDisableVertexAttribArrayARB (GLuint); >extern void glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *); >extern void glBindProgramARB (GLenum, GLuint); >extern void glDeleteProgramsARB (GLsizei, const GLuint *); >extern void glGenProgramsARB (GLsizei, GLuint *); >extern void glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *); >extern void glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *); >extern void glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *); >extern void glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *); >extern void glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *); >extern void glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *); >extern void glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *); >extern void glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *); >extern void glGetProgramivARB (GLenum, GLenum, GLint *); >extern void glGetProgramStringARB (GLenum, GLenum, GLvoid *); >extern void glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *); >extern void glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *); >extern void glGetVertexAttribivARB (GLuint, GLenum, GLint *); >extern void glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *); >extern GLboolean glIsProgramARB (GLuint); > >typedef void ( * PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); >typedef void ( * PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); >typedef void ( * PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); >typedef void ( * PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); >typedef void ( * PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); >typedef void ( * PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); >typedef void ( * PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); >typedef void ( * PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); >typedef void ( * PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); >typedef void ( * PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); >typedef void ( * PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); >typedef void ( * PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); >typedef void ( * PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); >typedef void ( * PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); >typedef void ( * PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); >typedef void ( * PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); >typedef void ( * PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); >typedef void ( * PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); >typedef void ( * PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); >typedef void ( * PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); >typedef void ( * PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); >typedef void ( * PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); >typedef void ( * PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); >typedef void ( * PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); >typedef void ( * PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); >typedef void ( * PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); >typedef void ( * PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); >typedef void ( * PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); >typedef void ( * PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); >typedef void ( * PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); >typedef void ( * PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); >typedef void ( * PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); >typedef void ( * PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); >typedef void ( * PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); >typedef void ( * PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); >typedef void ( * PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); >typedef void ( * PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); >typedef void ( * PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); >typedef void ( * PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer); >typedef GLboolean ( * PFNGLISPROGRAMARBPROC) (GLuint program); ># 3580 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glBindBufferARB (GLenum, GLuint); >extern void glDeleteBuffersARB (GLsizei, const GLuint *); >extern void glGenBuffersARB (GLsizei, GLuint *); >extern GLboolean glIsBufferARB (GLuint); >extern void glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum); >extern void glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *); >extern void glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *); >extern GLvoid* glMapBufferARB (GLenum, GLenum); >extern GLboolean glUnmapBufferARB (GLenum); >extern void glGetBufferParameterivARB (GLenum, GLenum, GLint *); >extern void glGetBufferPointervARB (GLenum, GLenum, GLvoid* *); > >typedef void ( * PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); >typedef void ( * PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); >typedef void ( * PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); >typedef GLboolean ( * PFNGLISBUFFERARBPROC) (GLuint buffer); >typedef void ( * PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); >typedef void ( * PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); >typedef void ( * PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); >typedef GLvoid* ( * PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); >typedef GLboolean ( * PFNGLUNMAPBUFFERARBPROC) (GLenum target); >typedef void ( * PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params); > > > > > >extern void glGenQueriesARB (GLsizei, GLuint *); >extern void glDeleteQueriesARB (GLsizei, const GLuint *); >extern GLboolean glIsQueryARB (GLuint); >extern void glBeginQueryARB (GLenum, GLuint); >extern void glEndQueryARB (GLenum); >extern void glGetQueryivARB (GLenum, GLenum, GLint *); >extern void glGetQueryObjectivARB (GLuint, GLenum, GLint *); >extern void glGetQueryObjectuivARB (GLuint, GLenum, GLuint *); > >typedef void ( * PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); >typedef void ( * PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); >typedef GLboolean ( * PFNGLISQUERYARBPROC) (GLuint id); >typedef void ( * PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); >typedef void ( * PFNGLENDQUERYARBPROC) (GLenum target); >typedef void ( * PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); >typedef void ( * PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); > > > > > >extern void glDeleteObjectARB (GLhandleARB); >extern GLhandleARB glGetHandleARB (GLenum); >extern void glDetachObjectARB (GLhandleARB, GLhandleARB); >extern GLhandleARB glCreateShaderObjectARB (GLenum); >extern void glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *); >extern void glCompileShaderARB (GLhandleARB); >extern GLhandleARB glCreateProgramObjectARB (void); >extern void glAttachObjectARB (GLhandleARB, GLhandleARB); >extern void glLinkProgramARB (GLhandleARB); >extern void glUseProgramObjectARB (GLhandleARB); >extern void glValidateProgramARB (GLhandleARB); >extern void glUniform1fARB (GLint, GLfloat); >extern void glUniform2fARB (GLint, GLfloat, GLfloat); >extern void glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat); >extern void glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glUniform1iARB (GLint, GLint); >extern void glUniform2iARB (GLint, GLint, GLint); >extern void glUniform3iARB (GLint, GLint, GLint, GLint); >extern void glUniform4iARB (GLint, GLint, GLint, GLint, GLint); >extern void glUniform1fvARB (GLint, GLsizei, const GLfloat *); >extern void glUniform2fvARB (GLint, GLsizei, const GLfloat *); >extern void glUniform3fvARB (GLint, GLsizei, const GLfloat *); >extern void glUniform4fvARB (GLint, GLsizei, const GLfloat *); >extern void glUniform1ivARB (GLint, GLsizei, const GLint *); >extern void glUniform2ivARB (GLint, GLsizei, const GLint *); >extern void glUniform3ivARB (GLint, GLsizei, const GLint *); >extern void glUniform4ivARB (GLint, GLsizei, const GLint *); >extern void glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *); >extern void glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *); >extern void glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *); >extern void glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *); >extern void glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *); >extern void glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); >extern void glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *); >extern GLint glGetUniformLocationARB (GLhandleARB, const GLcharARB *); >extern void glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); >extern void glGetUniformfvARB (GLhandleARB, GLint, GLfloat *); >extern void glGetUniformivARB (GLhandleARB, GLint, GLint *); >extern void glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); > >typedef void ( * PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); >typedef GLhandleARB ( * PFNGLGETHANDLEARBPROC) (GLenum pname); >typedef void ( * PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); >typedef GLhandleARB ( * PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); >typedef void ( * PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); >typedef void ( * PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); >typedef GLhandleARB ( * PFNGLCREATEPROGRAMOBJECTARBPROC) (void); >typedef void ( * PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); >typedef void ( * PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); >typedef void ( * PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); >typedef void ( * PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); >typedef void ( * PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); >typedef void ( * PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); >typedef void ( * PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); >typedef void ( * PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); >typedef void ( * PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); >typedef void ( * PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); >typedef void ( * PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); >typedef void ( * PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); >typedef void ( * PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); >typedef void ( * PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); >typedef void ( * PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); >typedef void ( * PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); >typedef void ( * PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); >typedef void ( * PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); >typedef void ( * PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); >typedef void ( * PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); >typedef void ( * PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); >typedef void ( * PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); >typedef void ( * PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); >typedef void ( * PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); >typedef void ( * PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); >typedef void ( * PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); >typedef GLint ( * PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); >typedef void ( * PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); >typedef void ( * PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); >typedef void ( * PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); >typedef void ( * PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); > > > > > >extern void glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *); >extern void glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); >extern GLint glGetAttribLocationARB (GLhandleARB, const GLcharARB *); > >typedef void ( * PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); >typedef void ( * PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); >typedef GLint ( * PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); ># 3746 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glDrawBuffersARB (GLsizei, const GLenum *); > >typedef void ( * PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); ># 3762 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf); > >typedef void ( * PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); > > > > > >extern void glPolygonOffsetEXT (GLfloat, GLfloat); > >typedef void ( * PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); ># 3782 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); >extern void glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); > >typedef void ( * PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); >typedef void ( * PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); > > > > > >extern void glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *); >extern void glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *); > >typedef void ( * PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); >typedef void ( * PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); > > > > > >extern void glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *); >extern void glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); > >typedef void ( * PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); >typedef void ( * PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); > > > > > >extern void glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint); >extern void glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint); >extern void glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei); >extern void glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); >extern void glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); > >typedef void ( * PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); >typedef void ( * PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); >typedef void ( * PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); >typedef void ( * PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); >typedef void ( * PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); > > > > > >extern void glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); >extern void glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *); >extern void glGetHistogramParameterivEXT (GLenum, GLenum, GLint *); >extern void glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); >extern void glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *); >extern void glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *); >extern void glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean); >extern void glMinmaxEXT (GLenum, GLenum, GLboolean); >extern void glResetHistogramEXT (GLenum); >extern void glResetMinmaxEXT (GLenum); > >typedef void ( * PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); >typedef void ( * PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); >typedef void ( * PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); >typedef void ( * PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); >typedef void ( * PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); >typedef void ( * PFNGLRESETMINMAXEXTPROC) (GLenum target); > > > > > >extern void glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); >extern void glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); >extern void glConvolutionParameterfEXT (GLenum, GLenum, GLfloat); >extern void glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *); >extern void glConvolutionParameteriEXT (GLenum, GLenum, GLint); >extern void glConvolutionParameterivEXT (GLenum, GLenum, const GLint *); >extern void glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei); >extern void glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); >extern void glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *); >extern void glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *); >extern void glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *); >extern void glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); >extern void glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); > >typedef void ( * PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); >typedef void ( * PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); >typedef void ( * PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); >typedef void ( * PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); >typedef void ( * PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); >typedef void ( * PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); >typedef void ( * PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); >typedef void ( * PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); >typedef void ( * PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); ># 3890 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); >extern void glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *); >extern void glColorTableParameterivSGI (GLenum, GLenum, const GLint *); >extern void glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei); >extern void glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *); >extern void glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *); >extern void glGetColorTableParameterivSGI (GLenum, GLenum, GLint *); > >typedef void ( * PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); >typedef void ( * PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); >typedef void ( * PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); >typedef void ( * PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); > > > > > >extern void glPixelTexGenSGIX (GLenum); > >typedef void ( * PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); > > > > > >extern void glPixelTexGenParameteriSGIS (GLenum, GLint); >extern void glPixelTexGenParameterivSGIS (GLenum, const GLint *); >extern void glPixelTexGenParameterfSGIS (GLenum, GLfloat); >extern void glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *); >extern void glGetPixelTexGenParameterivSGIS (GLenum, GLint *); >extern void glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *); > >typedef void ( * PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); >typedef void ( * PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); >typedef void ( * PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); >typedef void ( * PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); > > > > > >extern void glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); >extern void glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); > >typedef void ( * PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); >typedef void ( * PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); ># 3954 "../../../../../../extras/Mesa/include/GL/glext.h" >extern GLboolean glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *); >extern void glBindTextureEXT (GLenum, GLuint); >extern void glDeleteTexturesEXT (GLsizei, const GLuint *); >extern void glGenTexturesEXT (GLsizei, GLuint *); >extern GLboolean glIsTextureEXT (GLuint); >extern void glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *); > >typedef GLboolean ( * PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); >typedef void ( * PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); >typedef void ( * PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); >typedef void ( * PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); >typedef GLboolean ( * PFNGLISTEXTUREEXTPROC) (GLuint texture); >typedef void ( * PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); > > > > > >extern void glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *); >extern void glGetDetailTexFuncSGIS (GLenum, GLfloat *); > >typedef void ( * PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); >typedef void ( * PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); > > > > > >extern void glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *); >extern void glGetSharpenTexFuncSGIS (GLenum, GLfloat *); > >typedef void ( * PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); >typedef void ( * PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); ># 4000 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glSampleMaskSGIS (GLclampf, GLboolean); >extern void glSamplePatternSGIS (GLenum); > >typedef void ( * PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); >typedef void ( * PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); ># 4014 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glArrayElementEXT (GLint); >extern void glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); >extern void glDrawArraysEXT (GLenum, GLint, GLsizei); >extern void glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *); >extern void glGetPointervEXT (GLenum, GLvoid* *); >extern void glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); >extern void glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); >extern void glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); >extern void glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); > >typedef void ( * PFNGLARRAYELEMENTEXTPROC) (GLint i); >typedef void ( * PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); >typedef void ( * PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); >typedef void ( * PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); >typedef void ( * PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params); >typedef void ( * PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); >typedef void ( * PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); >typedef void ( * PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); >typedef void ( * PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); ># 4062 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glBlendEquationEXT (GLenum); > >typedef void ( * PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); ># 4090 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glSpriteParameterfSGIX (GLenum, GLfloat); >extern void glSpriteParameterfvSGIX (GLenum, const GLfloat *); >extern void glSpriteParameteriSGIX (GLenum, GLint); >extern void glSpriteParameterivSGIX (GLenum, const GLint *); > >typedef void ( * PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); >typedef void ( * PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); ># 4108 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glPointParameterfEXT (GLenum, GLfloat); >extern void glPointParameterfvEXT (GLenum, const GLfloat *); > >typedef void ( * PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); > > > > > >extern void glPointParameterfSGIS (GLenum, GLfloat); >extern void glPointParameterfvSGIS (GLenum, const GLfloat *); > >typedef void ( * PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); > > > > > >extern GLint glGetInstrumentsSGIX (void); >extern void glInstrumentsBufferSGIX (GLsizei, GLint *); >extern GLint glPollInstrumentsSGIX (GLint *); >extern void glReadInstrumentsSGIX (GLint); >extern void glStartInstrumentsSGIX (void); >extern void glStopInstrumentsSGIX (GLint); > >typedef GLint ( * PFNGLGETINSTRUMENTSSGIXPROC) (void); >typedef void ( * PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); >typedef GLint ( * PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); >typedef void ( * PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); >typedef void ( * PFNGLSTARTINSTRUMENTSSGIXPROC) (void); >typedef void ( * PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); ># 4150 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glFrameZoomSGIX (GLint); > >typedef void ( * PFNGLFRAMEZOOMSGIXPROC) (GLint factor); > > > > > >extern void glTagSampleBufferSGIX (void); > >typedef void ( * PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); > > > > > >extern void glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *); >extern void glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *); >extern void glDeformSGIX (GLbitfield); >extern void glLoadIdentityDeformationMapSGIX (GLbitfield); > >typedef void ( * PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); >typedef void ( * PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); >typedef void ( * PFNGLDEFORMSGIXPROC) (GLbitfield mask); >typedef void ( * PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); > > > > > >extern void glReferencePlaneSGIX (const GLdouble *); > >typedef void ( * PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); > > > > > >extern void glFlushRasterSGIX (void); > >typedef void ( * PFNGLFLUSHRASTERSGIXPROC) (void); ># 4200 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glFogFuncSGIS (GLsizei, const GLfloat *); >extern void glGetFogFuncSGIS (GLfloat *); > >typedef void ( * PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); >typedef void ( * PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); ># 4214 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glImageTransformParameteriHP (GLenum, GLenum, GLint); >extern void glImageTransformParameterfHP (GLenum, GLenum, GLfloat); >extern void glImageTransformParameterivHP (GLenum, GLenum, const GLint *); >extern void glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *); >extern void glGetImageTransformParameterivHP (GLenum, GLenum, GLint *); >extern void glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *); > >typedef void ( * PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); >typedef void ( * PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); >typedef void ( * PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); ># 4240 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); >extern void glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei); > >typedef void ( * PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); >typedef void ( * PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); ># 4254 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glHintPGI (GLenum, GLint); > >typedef void ( * PFNGLHINTPGIPROC) (GLenum target, GLint mode); > > > > > >extern void glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); >extern void glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *); >extern void glGetColorTableParameterivEXT (GLenum, GLenum, GLint *); >extern void glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *); > >typedef void ( * PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); >typedef void ( * PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); >typedef void ( * PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); ># 4280 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *); >extern void glGetListParameterivSGIX (GLuint, GLenum, GLint *); >extern void glListParameterfSGIX (GLuint, GLenum, GLfloat); >extern void glListParameterfvSGIX (GLuint, GLenum, const GLfloat *); >extern void glListParameteriSGIX (GLuint, GLenum, GLint); >extern void glListParameterivSGIX (GLuint, GLenum, const GLint *); > >typedef void ( * PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); >typedef void ( * PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); >typedef void ( * PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); >typedef void ( * PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); ># 4318 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glIndexMaterialEXT (GLenum, GLenum); > >typedef void ( * PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); > > > > > >extern void glIndexFuncEXT (GLenum, GLclampf); > >typedef void ( * PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); ># 4338 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glLockArraysEXT (GLint, GLsizei); >extern void glUnlockArraysEXT (void); > >typedef void ( * PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); >typedef void ( * PFNGLUNLOCKARRAYSEXTPROC) (void); > > > > > >extern void glCullParameterdvEXT (GLenum, GLdouble *); >extern void glCullParameterfvEXT (GLenum, GLfloat *); > >typedef void ( * PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); >typedef void ( * PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); ># 4362 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glFragmentColorMaterialSGIX (GLenum, GLenum); >extern void glFragmentLightfSGIX (GLenum, GLenum, GLfloat); >extern void glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *); >extern void glFragmentLightiSGIX (GLenum, GLenum, GLint); >extern void glFragmentLightivSGIX (GLenum, GLenum, const GLint *); >extern void glFragmentLightModelfSGIX (GLenum, GLfloat); >extern void glFragmentLightModelfvSGIX (GLenum, const GLfloat *); >extern void glFragmentLightModeliSGIX (GLenum, GLint); >extern void glFragmentLightModelivSGIX (GLenum, const GLint *); >extern void glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat); >extern void glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *); >extern void glFragmentMaterialiSGIX (GLenum, GLenum, GLint); >extern void glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *); >extern void glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *); >extern void glGetFragmentLightivSGIX (GLenum, GLenum, GLint *); >extern void glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *); >extern void glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *); >extern void glLightEnviSGIX (GLenum, GLint); > >typedef void ( * PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); >typedef void ( * PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); >typedef void ( * PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); >typedef void ( * PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); >typedef void ( * PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); >typedef void ( * PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); >typedef void ( * PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); >typedef void ( * PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); >typedef void ( * PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); >typedef void ( * PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); >typedef void ( * PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); >typedef void ( * PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); ># 4412 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); > >typedef void ( * PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); ># 4428 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glApplyTextureEXT (GLenum); >extern void glTextureLightEXT (GLenum); >extern void glTextureMaterialEXT (GLenum, GLenum); > >typedef void ( * PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); >typedef void ( * PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); >typedef void ( * PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); ># 4448 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glAsyncMarkerSGIX (GLuint); >extern GLint glFinishAsyncSGIX (GLuint *); >extern GLint glPollAsyncSGIX (GLuint *); >extern GLuint glGenAsyncMarkersSGIX (GLsizei); >extern void glDeleteAsyncMarkersSGIX (GLuint, GLsizei); >extern GLboolean glIsAsyncMarkerSGIX (GLuint); > >typedef void ( * PFNGLASYNCMARKERSGIXPROC) (GLuint marker); >typedef GLint ( * PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); >typedef GLint ( * PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); >typedef GLuint ( * PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); >typedef void ( * PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); >typedef GLboolean ( * PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); ># 4474 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glVertexPointervINTEL (GLint, GLenum, const GLvoid* *); >extern void glNormalPointervINTEL (GLenum, const GLvoid* *); >extern void glColorPointervINTEL (GLint, GLenum, const GLvoid* *); >extern void glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *); > >typedef void ( * PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); >typedef void ( * PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer); >typedef void ( * PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); >typedef void ( * PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); ># 4492 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glPixelTransformParameteriEXT (GLenum, GLenum, GLint); >extern void glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat); >extern void glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *); >extern void glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *); > >typedef void ( * PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); >typedef void ( * PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); >typedef void ( * PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); ># 4518 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte); >extern void glSecondaryColor3bvEXT (const GLbyte *); >extern void glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble); >extern void glSecondaryColor3dvEXT (const GLdouble *); >extern void glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat); >extern void glSecondaryColor3fvEXT (const GLfloat *); >extern void glSecondaryColor3iEXT (GLint, GLint, GLint); >extern void glSecondaryColor3ivEXT (const GLint *); >extern void glSecondaryColor3sEXT (GLshort, GLshort, GLshort); >extern void glSecondaryColor3svEXT (const GLshort *); >extern void glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte); >extern void glSecondaryColor3ubvEXT (const GLubyte *); >extern void glSecondaryColor3uiEXT (GLuint, GLuint, GLuint); >extern void glSecondaryColor3uivEXT (const GLuint *); >extern void glSecondaryColor3usEXT (GLushort, GLushort, GLushort); >extern void glSecondaryColor3usvEXT (const GLushort *); >extern void glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *); > >typedef void ( * PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); >typedef void ( * PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); >typedef void ( * PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); >typedef void ( * PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); >typedef void ( * PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); >typedef void ( * PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); >typedef void ( * PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); >typedef void ( * PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); >typedef void ( * PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); >typedef void ( * PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); >typedef void ( * PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); >typedef void ( * PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); >typedef void ( * PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); >typedef void ( * PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); >typedef void ( * PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); >typedef void ( * PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); >typedef void ( * PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); > > > > > >extern void glTextureNormalEXT (GLenum); > >typedef void ( * PFNGLTEXTURENORMALEXTPROC) (GLenum mode); > > > > > >extern void glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei); >extern void glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); > >typedef void ( * PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); >typedef void ( * PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); > > > > > >extern void glFogCoordfEXT (GLfloat); >extern void glFogCoordfvEXT (const GLfloat *); >extern void glFogCoorddEXT (GLdouble); >extern void glFogCoorddvEXT (const GLdouble *); >extern void glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *); > >typedef void ( * PFNGLFOGCOORDFEXTPROC) (GLfloat coord); >typedef void ( * PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); >typedef void ( * PFNGLFOGCOORDDEXTPROC) (GLdouble coord); >typedef void ( * PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); >typedef void ( * PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); ># 4596 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glTangent3bEXT (GLbyte, GLbyte, GLbyte); >extern void glTangent3bvEXT (const GLbyte *); >extern void glTangent3dEXT (GLdouble, GLdouble, GLdouble); >extern void glTangent3dvEXT (const GLdouble *); >extern void glTangent3fEXT (GLfloat, GLfloat, GLfloat); >extern void glTangent3fvEXT (const GLfloat *); >extern void glTangent3iEXT (GLint, GLint, GLint); >extern void glTangent3ivEXT (const GLint *); >extern void glTangent3sEXT (GLshort, GLshort, GLshort); >extern void glTangent3svEXT (const GLshort *); >extern void glBinormal3bEXT (GLbyte, GLbyte, GLbyte); >extern void glBinormal3bvEXT (const GLbyte *); >extern void glBinormal3dEXT (GLdouble, GLdouble, GLdouble); >extern void glBinormal3dvEXT (const GLdouble *); >extern void glBinormal3fEXT (GLfloat, GLfloat, GLfloat); >extern void glBinormal3fvEXT (const GLfloat *); >extern void glBinormal3iEXT (GLint, GLint, GLint); >extern void glBinormal3ivEXT (const GLint *); >extern void glBinormal3sEXT (GLshort, GLshort, GLshort); >extern void glBinormal3svEXT (const GLshort *); >extern void glTangentPointerEXT (GLenum, GLsizei, const GLvoid *); >extern void glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *); > >typedef void ( * PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); >typedef void ( * PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); >typedef void ( * PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); >typedef void ( * PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); >typedef void ( * PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); >typedef void ( * PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); >typedef void ( * PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); >typedef void ( * PFNGLTANGENT3IVEXTPROC) (const GLint *v); >typedef void ( * PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); >typedef void ( * PFNGLTANGENT3SVEXTPROC) (const GLshort *v); >typedef void ( * PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); >typedef void ( * PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); >typedef void ( * PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); >typedef void ( * PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); >typedef void ( * PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); >typedef void ( * PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); >typedef void ( * PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); >typedef void ( * PFNGLBINORMAL3IVEXTPROC) (const GLint *v); >typedef void ( * PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); >typedef void ( * PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); >typedef void ( * PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); >typedef void ( * PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); ># 4662 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glFinishTextureSUNX (void); > >typedef void ( * PFNGLFINISHTEXTURESUNXPROC) (void); > > > > > >extern void glGlobalAlphaFactorbSUN (GLbyte); >extern void glGlobalAlphaFactorsSUN (GLshort); >extern void glGlobalAlphaFactoriSUN (GLint); >extern void glGlobalAlphaFactorfSUN (GLfloat); >extern void glGlobalAlphaFactordSUN (GLdouble); >extern void glGlobalAlphaFactorubSUN (GLubyte); >extern void glGlobalAlphaFactorusSUN (GLushort); >extern void glGlobalAlphaFactoruiSUN (GLuint); > >typedef void ( * PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); >typedef void ( * PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); >typedef void ( * PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); >typedef void ( * PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); >typedef void ( * PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); >typedef void ( * PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); >typedef void ( * PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); >typedef void ( * PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); > > > > > >extern void glReplacementCodeuiSUN (GLuint); >extern void glReplacementCodeusSUN (GLushort); >extern void glReplacementCodeubSUN (GLubyte); >extern void glReplacementCodeuivSUN (const GLuint *); >extern void glReplacementCodeusvSUN (const GLushort *); >extern void glReplacementCodeubvSUN (const GLubyte *); >extern void glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *); > >typedef void ( * PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); >typedef void ( * PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); >typedef void ( * PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); >typedef void ( * PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); >typedef void ( * PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); >typedef void ( * PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); >typedef void ( * PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer); > > > > > >extern void glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat); >extern void glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *); >extern void glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); >extern void glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *); >extern void glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *); >extern void glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *); >extern void glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); >extern void glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *); >extern void glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *); >extern void glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); >extern void glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *); >extern void glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); >extern void glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); >extern void glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); >extern void glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); >extern void glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *); >extern void glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *); >extern void glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); >extern void glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); >extern void glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); >extern void glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); >extern void glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); >extern void glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); > >typedef void ( * PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); >typedef void ( * PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); >typedef void ( * PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); >typedef void ( * PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); >typedef void ( * PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); >typedef void ( * PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); > > > > > >extern void glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum); > >typedef void ( * PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); > > > > > >extern void glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum); > >typedef void ( * PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); ># 4850 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glVertexWeightfEXT (GLfloat); >extern void glVertexWeightfvEXT (const GLfloat *); >extern void glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *); > >typedef void ( * PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); >typedef void ( * PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); >typedef void ( * PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); ># 4866 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glFlushVertexArrayRangeNV (void); >extern void glVertexArrayRangeNV (GLsizei, const GLvoid *); > >typedef void ( * PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); >typedef void ( * PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); > > > > > >extern void glCombinerParameterfvNV (GLenum, const GLfloat *); >extern void glCombinerParameterfNV (GLenum, GLfloat); >extern void glCombinerParameterivNV (GLenum, const GLint *); >extern void glCombinerParameteriNV (GLenum, GLint); >extern void glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum); >extern void glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean); >extern void glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum); >extern void glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *); >extern void glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *); >extern void glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *); >extern void glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *); >extern void glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *); >extern void glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *); > >typedef void ( * PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); >typedef void ( * PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); >typedef void ( * PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); >typedef void ( * PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); >typedef void ( * PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); >typedef void ( * PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); >typedef void ( * PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); >typedef void ( * PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); >typedef void ( * PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); ># 4924 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glResizeBuffersMESA (void); > >typedef void ( * PFNGLRESIZEBUFFERSMESAPROC) (void); > > > > > >extern void glWindowPos2dMESA (GLdouble, GLdouble); >extern void glWindowPos2dvMESA (const GLdouble *); >extern void glWindowPos2fMESA (GLfloat, GLfloat); >extern void glWindowPos2fvMESA (const GLfloat *); >extern void glWindowPos2iMESA (GLint, GLint); >extern void glWindowPos2ivMESA (const GLint *); >extern void glWindowPos2sMESA (GLshort, GLshort); >extern void glWindowPos2svMESA (const GLshort *); >extern void glWindowPos3dMESA (GLdouble, GLdouble, GLdouble); >extern void glWindowPos3dvMESA (const GLdouble *); >extern void glWindowPos3fMESA (GLfloat, GLfloat, GLfloat); >extern void glWindowPos3fvMESA (const GLfloat *); >extern void glWindowPos3iMESA (GLint, GLint, GLint); >extern void glWindowPos3ivMESA (const GLint *); >extern void glWindowPos3sMESA (GLshort, GLshort, GLshort); >extern void glWindowPos3svMESA (const GLshort *); >extern void glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble); >extern void glWindowPos4dvMESA (const GLdouble *); >extern void glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat); >extern void glWindowPos4fvMESA (const GLfloat *); >extern void glWindowPos4iMESA (GLint, GLint, GLint, GLint); >extern void glWindowPos4ivMESA (const GLint *); >extern void glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort); >extern void glWindowPos4svMESA (const GLshort *); > >typedef void ( * PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); >typedef void ( * PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); >typedef void ( * PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); >typedef void ( * PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); >typedef void ( * PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); >typedef void ( * PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); >typedef void ( * PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); >typedef void ( * PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); >typedef void ( * PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); >typedef void ( * PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); >typedef void ( * PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); >typedef void ( * PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); >typedef void ( * PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); >typedef void ( * PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); >typedef void ( * PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); ># 4990 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint); >extern void glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint); > >typedef void ( * PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); >typedef void ( * PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); > > > > > >extern void glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); >extern void glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); >extern void glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint); >extern void glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); >extern void glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); >extern void glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); >extern void glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); >extern void glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); > >typedef void ( * PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); >typedef void ( * PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); >typedef void ( * PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride); >typedef void ( * PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); >typedef void ( * PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); >typedef void ( * PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); >typedef void ( * PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); >typedef void ( * PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); ># 5046 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glTbufferMask3DFX (GLuint); > >typedef void ( * PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); > > > > > >extern void glSampleMaskEXT (GLclampf, GLboolean); >extern void glSamplePatternEXT (GLenum); > >typedef void ( * PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); >typedef void ( * PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); ># 5080 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean); > >typedef void ( * PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); > > > > > >extern void glIglooInterfaceSGIX (GLenum, const GLvoid *); > >typedef void ( * PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); ># 5104 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glDeleteFencesNV (GLsizei, const GLuint *); >extern void glGenFencesNV (GLsizei, GLuint *); >extern GLboolean glIsFenceNV (GLuint); >extern GLboolean glTestFenceNV (GLuint); >extern void glGetFenceivNV (GLuint, GLenum, GLint *); >extern void glFinishFenceNV (GLuint); >extern void glSetFenceNV (GLuint, GLenum); > >typedef void ( * PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); >typedef void ( * PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); >typedef GLboolean ( * PFNGLISFENCENVPROC) (GLuint fence); >typedef GLboolean ( * PFNGLTESTFENCENVPROC) (GLuint fence); >typedef void ( * PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); >typedef void ( * PFNGLFINISHFENCENVPROC) (GLuint fence); >typedef void ( * PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); > > > > > >extern void glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *); >extern void glMapParameterivNV (GLenum, GLenum, const GLint *); >extern void glMapParameterfvNV (GLenum, GLenum, const GLfloat *); >extern void glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *); >extern void glGetMapParameterivNV (GLenum, GLenum, GLint *); >extern void glGetMapParameterfvNV (GLenum, GLenum, GLfloat *); >extern void glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *); >extern void glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); >extern void glEvalMapsNV (GLenum, GLenum); > >typedef void ( * PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); >typedef void ( * PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); >typedef void ( * PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); >typedef void ( * PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); >typedef void ( * PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); >typedef void ( * PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); >typedef void ( * PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); ># 5152 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *); >extern void glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *); > >typedef void ( * PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); >typedef void ( * PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); ># 5182 "../../../../../../extras/Mesa/include/GL/glext.h" >extern GLboolean glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *); >extern void glBindProgramNV (GLenum, GLuint); >extern void glDeleteProgramsNV (GLsizei, const GLuint *); >extern void glExecuteProgramNV (GLenum, GLuint, const GLfloat *); >extern void glGenProgramsNV (GLsizei, GLuint *); >extern void glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *); >extern void glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); >extern void glGetProgramivNV (GLuint, GLenum, GLint *); >extern void glGetProgramStringNV (GLuint, GLenum, GLubyte *); >extern void glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *); >extern void glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *); >extern void glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *); >extern void glGetVertexAttribivNV (GLuint, GLenum, GLint *); >extern void glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *); >extern GLboolean glIsProgramNV (GLuint); >extern void glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *); >extern void glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *); >extern void glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *); >extern void glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *); >extern void glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *); >extern void glRequestResidentProgramsNV (GLsizei, const GLuint *); >extern void glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum); >extern void glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *); >extern void glVertexAttrib1dNV (GLuint, GLdouble); >extern void glVertexAttrib1dvNV (GLuint, const GLdouble *); >extern void glVertexAttrib1fNV (GLuint, GLfloat); >extern void glVertexAttrib1fvNV (GLuint, const GLfloat *); >extern void glVertexAttrib1sNV (GLuint, GLshort); >extern void glVertexAttrib1svNV (GLuint, const GLshort *); >extern void glVertexAttrib2dNV (GLuint, GLdouble, GLdouble); >extern void glVertexAttrib2dvNV (GLuint, const GLdouble *); >extern void glVertexAttrib2fNV (GLuint, GLfloat, GLfloat); >extern void glVertexAttrib2fvNV (GLuint, const GLfloat *); >extern void glVertexAttrib2sNV (GLuint, GLshort, GLshort); >extern void glVertexAttrib2svNV (GLuint, const GLshort *); >extern void glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble); >extern void glVertexAttrib3dvNV (GLuint, const GLdouble *); >extern void glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat); >extern void glVertexAttrib3fvNV (GLuint, const GLfloat *); >extern void glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort); >extern void glVertexAttrib3svNV (GLuint, const GLshort *); >extern void glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glVertexAttrib4dvNV (GLuint, const GLdouble *); >extern void glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glVertexAttrib4fvNV (GLuint, const GLfloat *); >extern void glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort); >extern void glVertexAttrib4svNV (GLuint, const GLshort *); >extern void glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); >extern void glVertexAttrib4ubvNV (GLuint, const GLubyte *); >extern void glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *); >extern void glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *); >extern void glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *); >extern void glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *); >extern void glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *); >extern void glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *); >extern void glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *); >extern void glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *); >extern void glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *); >extern void glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *); >extern void glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *); >extern void glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *); >extern void glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *); > >typedef GLboolean ( * PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); >typedef void ( * PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); >typedef void ( * PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); >typedef void ( * PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); >typedef void ( * PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); >typedef void ( * PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); >typedef void ( * PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); >typedef void ( * PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); >typedef void ( * PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); >typedef void ( * PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); >typedef void ( * PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); >typedef void ( * PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); >typedef GLboolean ( * PFNGLISPROGRAMNVPROC) (GLuint id); >typedef void ( * PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); >typedef void ( * PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); >typedef void ( * PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); >typedef void ( * PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v); >typedef void ( * PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v); >typedef void ( * PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); >typedef void ( * PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); >typedef void ( * PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); >typedef void ( * PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); >typedef void ( * PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); >typedef void ( * PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); >typedef void ( * PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); >typedef void ( * PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); >typedef void ( * PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); >typedef void ( * PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); >typedef void ( * PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); >typedef void ( * PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); >typedef void ( * PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); >typedef void ( * PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); >typedef void ( * PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); >typedef void ( * PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); >typedef void ( * PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); >typedef void ( * PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); ># 5340 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glTexBumpParameterivATI (GLenum, const GLint *); >extern void glTexBumpParameterfvATI (GLenum, const GLfloat *); >extern void glGetTexBumpParameterivATI (GLenum, GLint *); >extern void glGetTexBumpParameterfvATI (GLenum, GLfloat *); > >typedef void ( * PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); >typedef void ( * PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); >typedef void ( * PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); >typedef void ( * PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); > > > > > >extern GLuint glGenFragmentShadersATI (GLuint); >extern void glBindFragmentShaderATI (GLuint); >extern void glDeleteFragmentShaderATI (GLuint); >extern void glBeginFragmentShaderATI (void); >extern void glEndFragmentShaderATI (void); >extern void glPassTexCoordATI (GLuint, GLuint, GLenum); >extern void glSampleMapATI (GLuint, GLuint, GLenum); >extern void glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); >extern void glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); >extern void glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); >extern void glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); >extern void glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); >extern void glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); >extern void glSetFragmentShaderConstantATI (GLuint, const GLfloat *); > >typedef GLuint ( * PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); >typedef void ( * PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); >typedef void ( * PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); >typedef void ( * PFNGLBEGINFRAGMENTSHADERATIPROC) (void); >typedef void ( * PFNGLENDFRAGMENTSHADERATIPROC) (void); >typedef void ( * PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); >typedef void ( * PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); >typedef void ( * PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); >typedef void ( * PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); >typedef void ( * PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); >typedef void ( * PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); >typedef void ( * PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); >typedef void ( * PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); >typedef void ( * PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); > > > > > >extern void glPNTrianglesiATI (GLenum, GLint); >extern void glPNTrianglesfATI (GLenum, GLfloat); > >typedef void ( * PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); > > > > > >extern GLuint glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum); >extern GLboolean glIsObjectBufferATI (GLuint); >extern void glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum); >extern void glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *); >extern void glGetObjectBufferivATI (GLuint, GLenum, GLint *); >extern void glFreeObjectBufferATI (GLuint); >extern void glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint); >extern void glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *); >extern void glGetArrayObjectivATI (GLenum, GLenum, GLint *); >extern void glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint); >extern void glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *); >extern void glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *); > >typedef GLuint ( * PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); >typedef GLboolean ( * PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); >typedef void ( * PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); >typedef void ( * PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); >typedef void ( * PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); >typedef void ( * PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); >typedef void ( * PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); >typedef void ( * PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); >typedef void ( * PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); > > > > > >extern void glBeginVertexShaderEXT (void); >extern void glEndVertexShaderEXT (void); >extern void glBindVertexShaderEXT (GLuint); >extern GLuint glGenVertexShadersEXT (GLuint); >extern void glDeleteVertexShaderEXT (GLuint); >extern void glShaderOp1EXT (GLenum, GLuint, GLuint); >extern void glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint); >extern void glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint); >extern void glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); >extern void glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); >extern void glInsertComponentEXT (GLuint, GLuint, GLuint); >extern void glExtractComponentEXT (GLuint, GLuint, GLuint); >extern GLuint glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint); >extern void glSetInvariantEXT (GLuint, GLenum, const GLvoid *); >extern void glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *); >extern void glVariantbvEXT (GLuint, const GLbyte *); >extern void glVariantsvEXT (GLuint, const GLshort *); >extern void glVariantivEXT (GLuint, const GLint *); >extern void glVariantfvEXT (GLuint, const GLfloat *); >extern void glVariantdvEXT (GLuint, const GLdouble *); >extern void glVariantubvEXT (GLuint, const GLubyte *); >extern void glVariantusvEXT (GLuint, const GLushort *); >extern void glVariantuivEXT (GLuint, const GLuint *); >extern void glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *); >extern void glEnableVariantClientStateEXT (GLuint); >extern void glDisableVariantClientStateEXT (GLuint); >extern GLuint glBindLightParameterEXT (GLenum, GLenum); >extern GLuint glBindMaterialParameterEXT (GLenum, GLenum); >extern GLuint glBindTexGenParameterEXT (GLenum, GLenum, GLenum); >extern GLuint glBindTextureUnitParameterEXT (GLenum, GLenum); >extern GLuint glBindParameterEXT (GLenum); >extern GLboolean glIsVariantEnabledEXT (GLuint, GLenum); >extern void glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *); >extern void glGetVariantIntegervEXT (GLuint, GLenum, GLint *); >extern void glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *); >extern void glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *); >extern void glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *); >extern void glGetInvariantIntegervEXT (GLuint, GLenum, GLint *); >extern void glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *); >extern void glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *); >extern void glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *); >extern void glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *); > >typedef void ( * PFNGLBEGINVERTEXSHADEREXTPROC) (void); >typedef void ( * PFNGLENDVERTEXSHADEREXTPROC) (void); >typedef void ( * PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); >typedef GLuint ( * PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); >typedef void ( * PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); >typedef void ( * PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); >typedef void ( * PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); >typedef void ( * PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); >typedef void ( * PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); >typedef void ( * PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); >typedef void ( * PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); >typedef void ( * PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); >typedef GLuint ( * PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); >typedef void ( * PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); >typedef void ( * PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); >typedef void ( * PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); >typedef void ( * PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); >typedef void ( * PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); >typedef void ( * PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); >typedef void ( * PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); >typedef void ( * PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); >typedef void ( * PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); >typedef void ( * PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); >typedef void ( * PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); >typedef void ( * PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); >typedef void ( * PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); >typedef GLuint ( * PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); >typedef GLuint ( * PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); >typedef GLuint ( * PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); >typedef GLuint ( * PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); >typedef GLuint ( * PFNGLBINDPARAMETEREXTPROC) (GLenum value); >typedef GLboolean ( * PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); >typedef void ( * PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); >typedef void ( * PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); >typedef void ( * PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); >typedef void ( * PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data); >typedef void ( * PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); >typedef void ( * PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); >typedef void ( * PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); >typedef void ( * PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); >typedef void ( * PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); >typedef void ( * PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); > > > > > >extern void glVertexStream1sATI (GLenum, GLshort); >extern void glVertexStream1svATI (GLenum, const GLshort *); >extern void glVertexStream1iATI (GLenum, GLint); >extern void glVertexStream1ivATI (GLenum, const GLint *); >extern void glVertexStream1fATI (GLenum, GLfloat); >extern void glVertexStream1fvATI (GLenum, const GLfloat *); >extern void glVertexStream1dATI (GLenum, GLdouble); >extern void glVertexStream1dvATI (GLenum, const GLdouble *); >extern void glVertexStream2sATI (GLenum, GLshort, GLshort); >extern void glVertexStream2svATI (GLenum, const GLshort *); >extern void glVertexStream2iATI (GLenum, GLint, GLint); >extern void glVertexStream2ivATI (GLenum, const GLint *); >extern void glVertexStream2fATI (GLenum, GLfloat, GLfloat); >extern void glVertexStream2fvATI (GLenum, const GLfloat *); >extern void glVertexStream2dATI (GLenum, GLdouble, GLdouble); >extern void glVertexStream2dvATI (GLenum, const GLdouble *); >extern void glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort); >extern void glVertexStream3svATI (GLenum, const GLshort *); >extern void glVertexStream3iATI (GLenum, GLint, GLint, GLint); >extern void glVertexStream3ivATI (GLenum, const GLint *); >extern void glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); >extern void glVertexStream3fvATI (GLenum, const GLfloat *); >extern void glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); >extern void glVertexStream3dvATI (GLenum, const GLdouble *); >extern void glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort); >extern void glVertexStream4svATI (GLenum, const GLshort *); >extern void glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint); >extern void glVertexStream4ivATI (GLenum, const GLint *); >extern void glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glVertexStream4fvATI (GLenum, const GLfloat *); >extern void glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glVertexStream4dvATI (GLenum, const GLdouble *); >extern void glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte); >extern void glNormalStream3bvATI (GLenum, const GLbyte *); >extern void glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort); >extern void glNormalStream3svATI (GLenum, const GLshort *); >extern void glNormalStream3iATI (GLenum, GLint, GLint, GLint); >extern void glNormalStream3ivATI (GLenum, const GLint *); >extern void glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); >extern void glNormalStream3fvATI (GLenum, const GLfloat *); >extern void glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); >extern void glNormalStream3dvATI (GLenum, const GLdouble *); >extern void glClientActiveVertexStreamATI (GLenum); >extern void glVertexBlendEnviATI (GLenum, GLint); >extern void glVertexBlendEnvfATI (GLenum, GLfloat); > >typedef void ( * PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); >typedef void ( * PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); >typedef void ( * PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); >typedef void ( * PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); >typedef void ( * PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); >typedef void ( * PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); >typedef void ( * PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); >typedef void ( * PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); >typedef void ( * PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); >typedef void ( * PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); >typedef void ( * PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); >typedef void ( * PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); >typedef void ( * PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); >typedef void ( * PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); >typedef void ( * PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); >typedef void ( * PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); >typedef void ( * PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); >typedef void ( * PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); >typedef void ( * PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); >typedef void ( * PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); >typedef void ( * PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); >typedef void ( * PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); >typedef void ( * PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); >typedef void ( * PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); >typedef void ( * PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); >typedef void ( * PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); >typedef void ( * PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); >typedef void ( * PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); >typedef void ( * PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); >typedef void ( * PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); >typedef void ( * PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); >typedef void ( * PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); >typedef void ( * PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); >typedef void ( * PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); >typedef void ( * PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); >typedef void ( * PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); >typedef void ( * PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); >typedef void ( * PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); >typedef void ( * PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); >typedef void ( * PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); >typedef void ( * PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); >typedef void ( * PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); > > > > > >extern void glElementPointerATI (GLenum, const GLvoid *); >extern void glDrawElementArrayATI (GLenum, GLsizei); >extern void glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei); > >typedef void ( * PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); >typedef void ( * PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); >typedef void ( * PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); > > > > > >extern void glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei); > >typedef void ( * PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); ># 5646 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glGenOcclusionQueriesNV (GLsizei, GLuint *); >extern void glDeleteOcclusionQueriesNV (GLsizei, const GLuint *); >extern GLboolean glIsOcclusionQueryNV (GLuint); >extern void glBeginOcclusionQueryNV (GLuint); >extern void glEndOcclusionQueryNV (void); >extern void glGetOcclusionQueryivNV (GLuint, GLenum, GLint *); >extern void glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *); > >typedef void ( * PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); >typedef void ( * PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); >typedef GLboolean ( * PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); >typedef void ( * PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); >typedef void ( * PFNGLENDOCCLUSIONQUERYNVPROC) (void); >typedef void ( * PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); >typedef void ( * PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); > > > > > >extern void glPointParameteriNV (GLenum, GLint); >extern void glPointParameterivNV (GLenum, const GLint *); > >typedef void ( * PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); >typedef void ( * PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); ># 5688 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glActiveStencilFaceEXT (GLenum); > >typedef void ( * PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); ># 5704 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glElementPointerAPPLE (GLenum, const GLvoid *); >extern void glDrawElementArrayAPPLE (GLenum, GLint, GLsizei); >extern void glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei); >extern void glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei); >extern void glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei); > >typedef void ( * PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); >typedef void ( * PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); >typedef void ( * PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); >typedef void ( * PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); >typedef void ( * PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); > > > > > >extern void glGenFencesAPPLE (GLsizei, GLuint *); >extern void glDeleteFencesAPPLE (GLsizei, const GLuint *); >extern void glSetFenceAPPLE (GLuint); >extern GLboolean glIsFenceAPPLE (GLuint); >extern GLboolean glTestFenceAPPLE (GLuint); >extern void glFinishFenceAPPLE (GLuint); >extern GLboolean glTestObjectAPPLE (GLenum, GLuint); >extern void glFinishObjectAPPLE (GLenum, GLint); > >typedef void ( * PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); >typedef void ( * PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); >typedef void ( * PFNGLSETFENCEAPPLEPROC) (GLuint fence); >typedef GLboolean ( * PFNGLISFENCEAPPLEPROC) (GLuint fence); >typedef GLboolean ( * PFNGLTESTFENCEAPPLEPROC) (GLuint fence); >typedef void ( * PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); >typedef GLboolean ( * PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); >typedef void ( * PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); > > > > > >extern void glBindVertexArrayAPPLE (GLuint); >extern void glDeleteVertexArraysAPPLE (GLsizei, const GLuint *); >extern void glGenVertexArraysAPPLE (GLsizei, const GLuint *); >extern GLboolean glIsVertexArrayAPPLE (GLuint); > >typedef void ( * PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); >typedef void ( * PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); >typedef void ( * PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); >typedef GLboolean ( * PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); > > > > > >extern void glVertexArrayRangeAPPLE (GLsizei, GLvoid *); >extern void glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *); >extern void glVertexArrayParameteriAPPLE (GLenum, GLint); > >typedef void ( * PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); >typedef void ( * PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); >typedef void ( * PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); ># 5776 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glDrawBuffersATI (GLsizei, const GLenum *); > >typedef void ( * PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); ># 5804 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat); >extern void glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble); >extern void glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *); >extern void glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *); >extern void glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *); >extern void glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *); > >typedef void ( * PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); >typedef void ( * PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); >typedef void ( * PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); >typedef void ( * PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); >typedef void ( * PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); >typedef void ( * PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); > > > > > >extern void glVertex2hNV (GLhalfNV, GLhalfNV); >extern void glVertex2hvNV (const GLhalfNV *); >extern void glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV); >extern void glVertex3hvNV (const GLhalfNV *); >extern void glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glVertex4hvNV (const GLhalfNV *); >extern void glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV); >extern void glNormal3hvNV (const GLhalfNV *); >extern void glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); >extern void glColor3hvNV (const GLhalfNV *); >extern void glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glColor4hvNV (const GLhalfNV *); >extern void glTexCoord1hNV (GLhalfNV); >extern void glTexCoord1hvNV (const GLhalfNV *); >extern void glTexCoord2hNV (GLhalfNV, GLhalfNV); >extern void glTexCoord2hvNV (const GLhalfNV *); >extern void glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV); >extern void glTexCoord3hvNV (const GLhalfNV *); >extern void glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glTexCoord4hvNV (const GLhalfNV *); >extern void glMultiTexCoord1hNV (GLenum, GLhalfNV); >extern void glMultiTexCoord1hvNV (GLenum, const GLhalfNV *); >extern void glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV); >extern void glMultiTexCoord2hvNV (GLenum, const GLhalfNV *); >extern void glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glMultiTexCoord3hvNV (GLenum, const GLhalfNV *); >extern void glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glMultiTexCoord4hvNV (GLenum, const GLhalfNV *); >extern void glFogCoordhNV (GLhalfNV); >extern void glFogCoordhvNV (const GLhalfNV *); >extern void glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); >extern void glSecondaryColor3hvNV (const GLhalfNV *); >extern void glVertexWeighthNV (GLhalfNV); >extern void glVertexWeighthvNV (const GLhalfNV *); >extern void glVertexAttrib1hNV (GLuint, GLhalfNV); >extern void glVertexAttrib1hvNV (GLuint, const GLhalfNV *); >extern void glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV); >extern void glVertexAttrib2hvNV (GLuint, const GLhalfNV *); >extern void glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glVertexAttrib3hvNV (GLuint, const GLhalfNV *); >extern void glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); >extern void glVertexAttrib4hvNV (GLuint, const GLhalfNV *); >extern void glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *); >extern void glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *); >extern void glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *); >extern void glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *); > >typedef void ( * PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); >typedef void ( * PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); >typedef void ( * PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); >typedef void ( * PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); >typedef void ( * PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); >typedef void ( * PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); >typedef void ( * PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); >typedef void ( * PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); >typedef void ( * PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); >typedef void ( * PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); >typedef void ( * PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); >typedef void ( * PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); >typedef void ( * PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); >typedef void ( * PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); >typedef void ( * PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); >typedef void ( * PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); >typedef void ( * PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); >typedef void ( * PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); >typedef void ( * PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); >typedef void ( * PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); >typedef void ( * PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); >typedef void ( * PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); >typedef void ( * PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); >typedef void ( * PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); >typedef void ( * PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); >typedef void ( * PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); >typedef void ( * PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); >typedef void ( * PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); >typedef void ( * PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); >typedef void ( * PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); > > > > > >extern void glPixelDataRangeNV (GLenum, GLsizei, GLvoid *); >extern void glFlushPixelDataRangeNV (GLenum); > >typedef void ( * PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer); >typedef void ( * PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); > > > > > >extern void glPrimitiveRestartNV (void); >extern void glPrimitiveRestartIndexNV (GLuint); > >typedef void ( * PFNGLPRIMITIVERESTARTNVPROC) (void); >typedef void ( * PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); ># 5948 "../../../../../../extras/Mesa/include/GL/glext.h" >extern GLvoid* glMapObjectBufferATI (GLuint); >extern void glUnmapObjectBufferATI (GLuint); > >typedef GLvoid* ( * PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); >typedef void ( * PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); > > > > > >extern void glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum); >extern void glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint); > >typedef void ( * PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); >typedef void ( * PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); > > > > > >extern void glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint); >extern void glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *); >extern void glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *); > >typedef void ( * PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); >typedef void ( * PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); >typedef void ( * PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); > > > > > >extern void glDepthBoundsEXT (GLclampd, GLclampd); > >typedef void ( * PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); ># 5992 "../../../../../../extras/Mesa/include/GL/glext.h" >extern void glBlendEquationSeparateEXT (GLenum, GLenum); > >typedef void ( * PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); ># 2141 "../../../../../../extras/Mesa/include/GL/gl.h" 2 ># 2163 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glEnableTraceMESA( GLbitfield mask ); >extern void glDisableTraceMESA( GLbitfield mask ); >extern void glNewTraceMESA( GLbitfield mask, const GLubyte * traceName ); >extern void glEndTraceMESA( void ); >extern void glTraceAssertAttribMESA( GLbitfield attribMask ); >extern void glTraceCommentMESA( const GLubyte * comment ); >extern void glTraceTextureMESA( GLuint name, const GLubyte* comment ); >extern void glTraceListMESA( GLuint name, const GLubyte* comment ); >extern void glTracePointerMESA( GLvoid* pointer, const GLubyte* comment ); >extern void glTracePointerRangeMESA( const GLvoid* first, const GLvoid* last, const GLubyte* comment ); ># 2205 "../../../../../../extras/Mesa/include/GL/gl.h" >typedef void (*GLprogramcallbackMESA)(GLenum target, GLvoid *data); > >extern void >glProgramCallbackMESA(GLenum target, GLprogramcallbackMESA callback, > GLvoid *data); > >extern void >glGetProgramRegisterfvMESA(GLenum target, GLsizei len, const GLubyte *name, > GLfloat *v); ># 2223 "../../../../../../extras/Mesa/include/GL/gl.h" >extern void glBlendEquationSeparateATI( GLenum modeRGB, GLenum modeA ); >typedef void ( * PFNGLBLENDEQUATIONSEPARATEATIPROC) (GLenum modeRGB, GLenum modeA); ># 201 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 ># 211 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" ># 1 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" 1 ># 54 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >typedef struct __GLcontextRec __GLcontext; >typedef struct __GLinterfaceRec __GLinterface; ># 74 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >typedef struct __GLcontextModesRec { > struct __GLcontextModesRec * next; > > GLboolean rgbMode; > GLboolean floatMode; > GLboolean colorIndexMode; > GLuint doubleBufferMode; > GLuint stereoMode; > > GLboolean haveAccumBuffer; > GLboolean haveDepthBuffer; > GLboolean haveStencilBuffer; > > GLint redBits, greenBits, blueBits, alphaBits; > GLuint redMask, greenMask, blueMask, alphaMask; > GLint rgbBits; > GLint indexBits; > > GLint accumRedBits, accumGreenBits, accumBlueBits, accumAlphaBits; > GLint depthBits; > GLint stencilBits; > > GLint numAuxBuffers; > > GLint level; > > GLint pixmapMode; > > > GLint visualID; > GLint visualType; > > > > > GLint visualRating; > > > GLint transparentPixel; > > GLint transparentRed, transparentGreen, transparentBlue, transparentAlpha; > GLint transparentIndex; > > > GLint sampleBuffers; > GLint samples; > > > GLint drawableType; > GLint renderType; > GLint xRenderable; > GLint fbconfigID; > > > GLint maxPbufferWidth; > GLint maxPbufferHeight; > GLint maxPbufferPixels; > GLint optimalPbufferWidth; > GLint optimalPbufferHeight; > > > GLint visualSelectGroup; > > > GLint swapMethod; > > GLint screen; >} __GLcontextModes; ># 190 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >typedef struct __GLdrawableRegionRec __GLdrawableRegion; >typedef struct __GLdrawableBufferRec __GLdrawableBuffer; >typedef struct __GLdrawablePrivateRec __GLdrawablePrivate; > >typedef struct __GLregionRectRec { > > GLint x0, y0; > > GLint x1, y1; >} __GLregionRect; > >struct __GLdrawableRegionRec { > GLint numRects; > __GLregionRect *rects; > __GLregionRect boundingRect; >}; ># 226 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >typedef void (*__GLbufFallbackInitFn)(__GLdrawableBuffer *buf, > __GLdrawablePrivate *glPriv, GLint bits); >typedef void (*__GLbufMainInitFn)(__GLdrawableBuffer *buf, > __GLdrawablePrivate *glPriv, GLint bits, > __GLbufFallbackInitFn back); ># 247 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >struct __GLdrawableBufferRec { > > > > GLint width, height, depth; > > > > > void *base; > > > > > GLuint size; > > > > > GLuint elementSize; > GLuint elementSizeLog2; > > > > > > > GLint outerWidth; > > > > > GLint byteWidth; > > > > > > void *handle; > > > GLboolean (*resize)(__GLdrawableBuffer *buf, > GLint x, GLint y, GLuint width, GLuint height, > __GLdrawablePrivate *glPriv, GLuint bufferMask); > void (*lock)(__GLdrawableBuffer *buf, __GLdrawablePrivate *glPriv); > void (*unlock)(__GLdrawableBuffer *buf, __GLdrawablePrivate *glPriv); > void (*fill)(__GLdrawableBuffer *buf, __GLdrawablePrivate *glPriv, > GLuint val, GLint x, GLint y, GLint w, GLint h); > void (*free)(__GLdrawableBuffer *buf, __GLdrawablePrivate *glPriv); > > > void (*freePrivate)(__GLdrawableBuffer *buf, __GLdrawablePrivate *glPriv); > > > > void *private; > > > > void *other; > __GLbufMainInitFn mainInit; > __GLbufFallbackInitFn fallbackInit; >}; > > > > >struct __GLdrawablePrivateRec { > > > > __GLcontextModes *modes; > > > > > GLuint width, height; > > > > > GLint xOrigin, yOrigin; ># 343 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" > GLint yInverted; > > > > > GLuint accelBufferMask; > > > > > __GLdrawableBuffer frontBuffer; > __GLdrawableBuffer backBuffer; > __GLdrawableBuffer accumBuffer; > __GLdrawableBuffer depthBuffer; > __GLdrawableBuffer stencilBuffer; > > > > > __GLdrawableRegion ownershipRegion; > > > > > void *lock; ># 376 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" > void *(*malloc)(size_t size); > void *(*calloc)(size_t numElem, size_t elemSize); > void *(*realloc)(void *oldAddr, size_t newSize); > void (*free)(void *addr); > > GLboolean (*addSwapRect)(__GLdrawablePrivate *glPriv, > GLint x, GLint y, GLsizei width, GLsizei height); > void (*setClipRect)(__GLdrawablePrivate *glPriv, > GLint x, GLint y, GLsizei width, GLsizei height); > void (*updateClipRegion)(__GLdrawablePrivate *glPriv); > GLboolean (*resize)(__GLdrawablePrivate *glPriv); > void (*getDrawableSize)(__GLdrawablePrivate *glPriv, > GLint *x, GLint *y, GLuint *width, GLuint *height); > > void (*lockDP)(__GLdrawablePrivate *glPriv, __GLcontext *gc); > void (*unlockDP)(__GLdrawablePrivate *glPriv); > > > > > > void *private; > > void (*freePrivate)(__GLdrawablePrivate *); > > > void *other; >}; ># 430 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >typedef struct __GLimportsRec { > > void * (*malloc)(__GLcontext *gc, size_t size); > void *(*calloc)(__GLcontext *gc, size_t numElem, size_t elemSize); > void *(*realloc)(__GLcontext *gc, void *oldAddr, size_t newSize); > void (*free)(__GLcontext *gc, void *addr); > > > void (*warning)(__GLcontext *gc, char *fmt); > void (*fatal)(__GLcontext *gc, char *fmt); > > > char *( *getenv)(__GLcontext *gc, const char *var); > int ( *atoi)(__GLcontext *gc, const char *str); > int ( *sprintf)(__GLcontext *gc, char *str, const char *fmt, ...); > void *( *fopen)(__GLcontext *gc, const char *path, const char *mode); > int ( *fclose)(__GLcontext *gc, void *stream); > int ( *fprintf)(__GLcontext *gc, void *stream, const char *fmt, ...); > > > __GLdrawablePrivate *(*getDrawablePrivate)(__GLcontext *gc); > __GLdrawablePrivate *(*getReadablePrivate)(__GLcontext *gc); > > > void *other; >} __GLimports; > > > > > > > >typedef struct __GLexportsRec { > > GLboolean (*destroyContext)(__GLcontext *gc); > GLboolean (*loseCurrent)(__GLcontext *gc); > > GLboolean (*makeCurrent)(__GLcontext *gc); > GLboolean (*shareContext)(__GLcontext *gc, __GLcontext *gcShare); > GLboolean (*copyContext)(__GLcontext *dst, const __GLcontext *src, GLuint mask); > GLboolean (*forceCurrent)(__GLcontext *gc); > > > GLboolean (*notifyResize)(__GLcontext *gc); > void (*notifyDestroy)(__GLcontext *gc); > void (*notifySwapBuffers)(__GLcontext *gc); > > > struct __GLdispatchStateRec* (*dispatchExec)(__GLcontext *gc); > void (*beginDispatchOverride)(__GLcontext *gc); > void (*endDispatchOverride)(__GLcontext *gc); >} __GLexports; ># 491 "../../../../../../extras/Mesa/include/GL/internal/glcore.h" >struct __GLinterfaceRec { > __GLimports imports; > __GLexports exports; >}; > >extern __GLcontext *__glCoreCreateContext(__GLimports *, __GLcontextModes *); >extern void __glCoreNopDispatch(void); ># 212 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 ># 227 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" >typedef GLushort GLhalfARB; ># 345 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" >typedef union { GLfloat f; GLint i; } fi_type; > > ># 1 "../../../../../../extras/Mesa/src/mesa/main/config.h" 1 ># 349 "../../../../../../extras/Mesa/src/mesa/main/glheader.h" 2 ># 7 "gamma_texmem.c" 2 ># 1 "../../../../../../extras/Mesa/src/mesa/main/colormac.h" 1 ># 36 "../../../../../../extras/Mesa/src/mesa/main/colormac.h" ># 1 "../../../../../../extras/Mesa/src/mesa/main/imports.h" 1 ># 280 "../../../../../../extras/Mesa/src/mesa/main/imports.h" >static __inline__ GLfloat LOG2(GLfloat val) >{ > fi_type num; > GLint log_2; > num.f = val; > log_2 = ((num.i >> 23) & 255) - 128; > num.i &= ~(255 << 23); > num.i += 127 << 23; > num.f = ((-1.0f/3) * num.f + 2) * num.f - 2.0f/3; > return num.f + log_2; >} ># 306 "../../../../../../extras/Mesa/src/mesa/main/imports.h" >static __inline__ int IS_INF_OR_NAN( float x ) >{ > fi_type tmp; > tmp.f = x; > return !(int)((unsigned int)((tmp.i & 0x7fffffff)-0x7f800000) >> 31); >} ># 382 "../../../../../../extras/Mesa/src/mesa/main/imports.h" >static __inline__ int iround(float f) >{ > int r; > __asm__ ("fistpl %0" : "=m" (r) : "t" (f) : "st"); > return r; >} ># 436 "../../../../../../extras/Mesa/src/mesa/main/imports.h" >static __inline__ int ifloor(float f) >{ > int ai, bi; > double af, bf; > af = (3 << 22) + 0.5 + (double)f; > bf = (3 << 22) + 0.5 - (double)f; > > __asm__ ("fstps %0" : "=m" (ai) : "t" (af) : "st"); > __asm__ ("fstps %0" : "=m" (bi) : "t" (bf) : "st"); > return (ai - bi) >> 1; >} ># 483 "../../../../../../extras/Mesa/src/mesa/main/imports.h" >static __inline__ int iceil(float f) >{ > int ai, bi; > double af, bf; > af = (3 << 22) + 0.5 + (double)f; > bf = (3 << 22) + 0.5 - (double)f; > > __asm__ ("fstps %0" : "=m" (ai) : "t" (af) : "st"); > __asm__ ("fstps %0" : "=m" (bi) : "t" (bf) : "st"); > return (ai - bi + 1) >> 1; >} ># 655 "../../../../../../extras/Mesa/src/mesa/main/imports.h" >extern void * >_mesa_malloc( size_t bytes ); > >extern void * >_mesa_calloc( size_t bytes ); > >extern void >_mesa_free( void *ptr ); > >extern void * >_mesa_align_malloc( size_t bytes, unsigned long alignment ); > >extern void * >_mesa_align_calloc( size_t bytes, unsigned long alignment ); > >extern void >_mesa_align_free( void *ptr ); > >extern void * >_mesa_realloc( void *oldBuffer, size_t oldSize, size_t newSize ); > >extern void * >_mesa_memcpy( void *dest, const void *src, size_t n ); > >extern void >_mesa_memset( void *dst, int val, size_t n ); > >extern void >_mesa_memset16( unsigned short *dst, unsigned short val, size_t n ); > >extern void >_mesa_bzero( void *dst, size_t n ); > > >extern double >_mesa_sin(double a); > >extern double >_mesa_cos(double a); > >extern double >_mesa_sqrtd(double x); > >extern float >_mesa_sqrtf(float x); > >extern float >_mesa_inv_sqrtf(float x); > >extern double >_mesa_pow(double x, double y); > >extern float >_mesa_log2(float x); > >extern unsigned int >_mesa_bitcount(unsigned int n); > >extern GLhalfARB >_mesa_float_to_half(float f); > >extern float >_mesa_half_to_float(GLhalfARB h); > > >extern char * >_mesa_getenv( const char *var ); > >extern char * >_mesa_strstr( const char *haystack, const char *needle ); > >extern char * >_mesa_strncat( char *dest, const char *src, size_t n ); > >extern char * >_mesa_strcpy( char *dest, const char *src ); > >extern char * >_mesa_strncpy( char *dest, const char *src, size_t n ); > >extern size_t >_mesa_strlen( const char *s ); > >extern int >_mesa_strcmp( const char *s1, const char *s2 ); > >extern int >_mesa_strncmp( const char *s1, const char *s2, size_t n ); > >extern char * >_mesa_strdup( const char *s ); > >extern int >_mesa_atoi( const char *s ); > >extern double >_mesa_strtod( const char *s, char **end ); > >extern int >_mesa_sprintf( char *str, const char *fmt, ... ); > >extern void >_mesa_printf( const char *fmtString, ... ); > > >extern void >_mesa_warning( __GLcontext *gc, const char *fmtString, ... ); > >extern void >_mesa_problem( const __GLcontext *ctx, const char *fmtString, ... ); > >extern void >_mesa_error( __GLcontext *ctx, GLenum error, const char *fmtString, ... ); > >extern void >_mesa_debug( const __GLcontext *ctx, const char *fmtString, ... ); > > >extern void >_mesa_init_default_imports( __GLimports *imports, void *driverCtx ); ># 37 "../../../../../../extras/Mesa/src/mesa/main/colormac.h" 2 > ># 1 "../../../../../../extras/Mesa/src/mesa/main/macros.h" 1 ># 43 "../../../../../../extras/Mesa/src/mesa/main/macros.h" >extern GLfloat _mesa_ubyte_to_float_color_tab[256]; ># 39 "../../../../../../extras/Mesa/src/mesa/main/colormac.h" 2 ># 8 "gamma_texmem.c" 2 > ># 1 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" 1 ># 40 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" ># 1 "../../../../../../extras/Mesa/src/mesa/glapi/glapitable.h" 1 ># 9 "../../../../../../extras/Mesa/src/mesa/glapi/glapitable.h" >struct _glapi_table >{ > void (* NewList)(GLuint list, GLenum mode); > void (* EndList)(void); > void (* CallList)(GLuint list); > void (* CallLists)(GLsizei n, GLenum type, const GLvoid * lists); > void (* DeleteLists)(GLuint list, GLsizei range); > GLuint (* GenLists)(GLsizei range); > void (* ListBase)(GLuint base); > void (* Begin)(GLenum mode); > void (* Bitmap)(GLsizei width, GLsizei height, GLfloat xorig, GLfloat yorig, GLfloat xmove, GLfloat ymove, const GLubyte * bitmap); > void (* Color3b)(GLbyte red, GLbyte green, GLbyte blue); > void (* Color3bv)(const GLbyte * v); > void (* Color3d)(GLdouble red, GLdouble green, GLdouble blue); > void (* Color3dv)(const GLdouble * v); > void (* Color3f)(GLfloat red, GLfloat green, GLfloat blue); > void (* Color3fv)(const GLfloat * v); > void (* Color3i)(GLint red, GLint green, GLint blue); > void (* Color3iv)(const GLint * v); > void (* Color3s)(GLshort red, GLshort green, GLshort blue); > void (* Color3sv)(const GLshort * v); > void (* Color3ub)(GLubyte red, GLubyte green, GLubyte blue); > void (* Color3ubv)(const GLubyte * v); > void (* Color3ui)(GLuint red, GLuint green, GLuint blue); > void (* Color3uiv)(const GLuint * v); > void (* Color3us)(GLushort red, GLushort green, GLushort blue); > void (* Color3usv)(const GLushort * v); > void (* Color4b)(GLbyte red, GLbyte green, GLbyte blue, GLbyte alpha); > void (* Color4bv)(const GLbyte * v); > void (* Color4d)(GLdouble red, GLdouble green, GLdouble blue, GLdouble alpha); > void (* Color4dv)(const GLdouble * v); > void (* Color4f)(GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); > void (* Color4fv)(const GLfloat * v); > void (* Color4i)(GLint red, GLint green, GLint blue, GLint alpha); > void (* Color4iv)(const GLint * v); > void (* Color4s)(GLshort red, GLshort green, GLshort blue, GLshort alpha); > void (* Color4sv)(const GLshort * v); > void (* Color4ub)(GLubyte red, GLubyte green, GLubyte blue, GLubyte alpha); > void (* Color4ubv)(const GLubyte * v); > void (* Color4ui)(GLuint red, GLuint green, GLuint blue, GLuint alpha); > void (* Color4uiv)(const GLuint * v); > void (* Color4us)(GLushort red, GLushort green, GLushort blue, GLushort alpha); > void (* Color4usv)(const GLushort * v); > void (* EdgeFlag)(GLboolean flag); > void (* EdgeFlagv)(const GLboolean * flag); > void (* End)(void); > void (* Indexd)(GLdouble c); > void (* Indexdv)(const GLdouble * c); > void (* Indexf)(GLfloat c); > void (* Indexfv)(const GLfloat * c); > void (* Indexi)(GLint c); > void (* Indexiv)(const GLint * c); > void (* Indexs)(GLshort c); > void (* Indexsv)(const GLshort * c); > void (* Normal3b)(GLbyte nx, GLbyte ny, GLbyte nz); > void (* Normal3bv)(const GLbyte * v); > void (* Normal3d)(GLdouble nx, GLdouble ny, GLdouble nz); > void (* Normal3dv)(const GLdouble * v); > void (* Normal3f)(GLfloat nx, GLfloat ny, GLfloat nz); > void (* Normal3fv)(const GLfloat * v); > void (* Normal3i)(GLint nx, GLint ny, GLint nz); > void (* Normal3iv)(const GLint * v); > void (* Normal3s)(GLshort nx, GLshort ny, GLshort nz); > void (* Normal3sv)(const GLshort * v); > void (* RasterPos2d)(GLdouble x, GLdouble y); > void (* RasterPos2dv)(const GLdouble * v); > void (* RasterPos2f)(GLfloat x, GLfloat y); > void (* RasterPos2fv)(const GLfloat * v); > void (* RasterPos2i)(GLint x, GLint y); > void (* RasterPos2iv)(const GLint * v); > void (* RasterPos2s)(GLshort x, GLshort y); > void (* RasterPos2sv)(const GLshort * v); > void (* RasterPos3d)(GLdouble x, GLdouble y, GLdouble z); > void (* RasterPos3dv)(const GLdouble * v); > void (* RasterPos3f)(GLfloat x, GLfloat y, GLfloat z); > void (* RasterPos3fv)(const GLfloat * v); > void (* RasterPos3i)(GLint x, GLint y, GLint z); > void (* RasterPos3iv)(const GLint * v); > void (* RasterPos3s)(GLshort x, GLshort y, GLshort z); > void (* RasterPos3sv)(const GLshort * v); > void (* RasterPos4d)(GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* RasterPos4dv)(const GLdouble * v); > void (* RasterPos4f)(GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* RasterPos4fv)(const GLfloat * v); > void (* RasterPos4i)(GLint x, GLint y, GLint z, GLint w); > void (* RasterPos4iv)(const GLint * v); > void (* RasterPos4s)(GLshort x, GLshort y, GLshort z, GLshort w); > void (* RasterPos4sv)(const GLshort * v); > void (* Rectd)(GLdouble x1, GLdouble y1, GLdouble x2, GLdouble y2); > void (* Rectdv)(const GLdouble * v1, const GLdouble * v2); > void (* Rectf)(GLfloat x1, GLfloat y1, GLfloat x2, GLfloat y2); > void (* Rectfv)(const GLfloat * v1, const GLfloat * v2); > void (* Recti)(GLint x1, GLint y1, GLint x2, GLint y2); > void (* Rectiv)(const GLint * v1, const GLint * v2); > void (* Rects)(GLshort x1, GLshort y1, GLshort x2, GLshort y2); > void (* Rectsv)(const GLshort * v1, const GLshort * v2); > void (* TexCoord1d)(GLdouble s); > void (* TexCoord1dv)(const GLdouble * v); > void (* TexCoord1f)(GLfloat s); > void (* TexCoord1fv)(const GLfloat * v); > void (* TexCoord1i)(GLint s); > void (* TexCoord1iv)(const GLint * v); > void (* TexCoord1s)(GLshort s); > void (* TexCoord1sv)(const GLshort * v); > void (* TexCoord2d)(GLdouble s, GLdouble t); > void (* TexCoord2dv)(const GLdouble * v); > void (* TexCoord2f)(GLfloat s, GLfloat t); > void (* TexCoord2fv)(const GLfloat * v); > void (* TexCoord2i)(GLint s, GLint t); > void (* TexCoord2iv)(const GLint * v); > void (* TexCoord2s)(GLshort s, GLshort t); > void (* TexCoord2sv)(const GLshort * v); > void (* TexCoord3d)(GLdouble s, GLdouble t, GLdouble r); > void (* TexCoord3dv)(const GLdouble * v); > void (* TexCoord3f)(GLfloat s, GLfloat t, GLfloat r); > void (* TexCoord3fv)(const GLfloat * v); > void (* TexCoord3i)(GLint s, GLint t, GLint r); > void (* TexCoord3iv)(const GLint * v); > void (* TexCoord3s)(GLshort s, GLshort t, GLshort r); > void (* TexCoord3sv)(const GLshort * v); > void (* TexCoord4d)(GLdouble s, GLdouble t, GLdouble r, GLdouble q); > void (* TexCoord4dv)(const GLdouble * v); > void (* TexCoord4f)(GLfloat s, GLfloat t, GLfloat r, GLfloat q); > void (* TexCoord4fv)(const GLfloat * v); > void (* TexCoord4i)(GLint s, GLint t, GLint r, GLint q); > void (* TexCoord4iv)(const GLint * v); > void (* TexCoord4s)(GLshort s, GLshort t, GLshort r, GLshort q); > void (* TexCoord4sv)(const GLshort * v); > void (* Vertex2d)(GLdouble x, GLdouble y); > void (* Vertex2dv)(const GLdouble * v); > void (* Vertex2f)(GLfloat x, GLfloat y); > void (* Vertex2fv)(const GLfloat * v); > void (* Vertex2i)(GLint x, GLint y); > void (* Vertex2iv)(const GLint * v); > void (* Vertex2s)(GLshort x, GLshort y); > void (* Vertex2sv)(const GLshort * v); > void (* Vertex3d)(GLdouble x, GLdouble y, GLdouble z); > void (* Vertex3dv)(const GLdouble * v); > void (* Vertex3f)(GLfloat x, GLfloat y, GLfloat z); > void (* Vertex3fv)(const GLfloat * v); > void (* Vertex3i)(GLint x, GLint y, GLint z); > void (* Vertex3iv)(const GLint * v); > void (* Vertex3s)(GLshort x, GLshort y, GLshort z); > void (* Vertex3sv)(const GLshort * v); > void (* Vertex4d)(GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* Vertex4dv)(const GLdouble * v); > void (* Vertex4f)(GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* Vertex4fv)(const GLfloat * v); > void (* Vertex4i)(GLint x, GLint y, GLint z, GLint w); > void (* Vertex4iv)(const GLint * v); > void (* Vertex4s)(GLshort x, GLshort y, GLshort z, GLshort w); > void (* Vertex4sv)(const GLshort * v); > void (* ClipPlane)(GLenum plane, const GLdouble * equation); > void (* ColorMaterial)(GLenum face, GLenum mode); > void (* CullFace)(GLenum mode); > void (* Fogf)(GLenum pname, GLfloat param); > void (* Fogfv)(GLenum pname, const GLfloat * params); > void (* Fogi)(GLenum pname, GLint param); > void (* Fogiv)(GLenum pname, const GLint * params); > void (* FrontFace)(GLenum mode); > void (* Hint)(GLenum target, GLenum mode); > void (* Lightf)(GLenum light, GLenum pname, GLfloat param); > void (* Lightfv)(GLenum light, GLenum pname, const GLfloat * params); > void (* Lighti)(GLenum light, GLenum pname, GLint param); > void (* Lightiv)(GLenum light, GLenum pname, const GLint * params); > void (* LightModelf)(GLenum pname, GLfloat param); > void (* LightModelfv)(GLenum pname, const GLfloat * params); > void (* LightModeli)(GLenum pname, GLint param); > void (* LightModeliv)(GLenum pname, const GLint * params); > void (* LineStipple)(GLint factor, GLushort pattern); > void (* LineWidth)(GLfloat width); > void (* Materialf)(GLenum face, GLenum pname, GLfloat param); > void (* Materialfv)(GLenum face, GLenum pname, const GLfloat * params); > void (* Materiali)(GLenum face, GLenum pname, GLint param); > void (* Materialiv)(GLenum face, GLenum pname, const GLint * params); > void (* PointSize)(GLfloat size); > void (* PolygonMode)(GLenum face, GLenum mode); > void (* PolygonStipple)(const GLubyte * mask); > void (* Scissor)(GLint x, GLint y, GLsizei width, GLsizei height); > void (* ShadeModel)(GLenum mode); > void (* TexParameterf)(GLenum target, GLenum pname, GLfloat param); > void (* TexParameterfv)(GLenum target, GLenum pname, const GLfloat * params); > void (* TexParameteri)(GLenum target, GLenum pname, GLint param); > void (* TexParameteriv)(GLenum target, GLenum pname, const GLint * params); > void (* TexImage1D)(GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid * pixels); > void (* TexImage2D)(GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid * pixels); > void (* TexEnvf)(GLenum target, GLenum pname, GLfloat param); > void (* TexEnvfv)(GLenum target, GLenum pname, const GLfloat * params); > void (* TexEnvi)(GLenum target, GLenum pname, GLint param); > void (* TexEnviv)(GLenum target, GLenum pname, const GLint * params); > void (* TexGend)(GLenum coord, GLenum pname, GLdouble param); > void (* TexGendv)(GLenum coord, GLenum pname, const GLdouble * params); > void (* TexGenf)(GLenum coord, GLenum pname, GLfloat param); > void (* TexGenfv)(GLenum coord, GLenum pname, const GLfloat * params); > void (* TexGeni)(GLenum coord, GLenum pname, GLint param); > void (* TexGeniv)(GLenum coord, GLenum pname, const GLint * params); > void (* FeedbackBuffer)(GLsizei size, GLenum type, GLfloat * buffer); > void (* SelectBuffer)(GLsizei size, GLuint * buffer); > GLint (* RenderMode)(GLenum mode); > void (* InitNames)(void); > void (* LoadName)(GLuint name); > void (* PassThrough)(GLfloat token); > void (* PopName)(void); > void (* PushName)(GLuint name); > void (* DrawBuffer)(GLenum mode); > void (* Clear)(GLbitfield mask); > void (* ClearAccum)(GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); > void (* ClearIndex)(GLfloat c); > void (* ClearColor)(GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); > void (* ClearStencil)(GLint s); > void (* ClearDepth)(GLclampd depth); > void (* StencilMask)(GLuint mask); > void (* ColorMask)(GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); > void (* DepthMask)(GLboolean flag); > void (* IndexMask)(GLuint mask); > void (* Accum)(GLenum op, GLfloat value); > void (* Disable)(GLenum cap); > void (* Enable)(GLenum cap); > void (* Finish)(void); > void (* Flush)(void); > void (* PopAttrib)(void); > void (* PushAttrib)(GLbitfield mask); > void (* Map1d)(GLenum target, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble * points); > void (* Map1f)(GLenum target, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat * points); > void (* Map2d)(GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble * points); > void (* Map2f)(GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat * points); > void (* MapGrid1d)(GLint un, GLdouble u1, GLdouble u2); > void (* MapGrid1f)(GLint un, GLfloat u1, GLfloat u2); > void (* MapGrid2d)(GLint un, GLdouble u1, GLdouble u2, GLint vn, GLdouble v1, GLdouble v2); > void (* MapGrid2f)(GLint un, GLfloat u1, GLfloat u2, GLint vn, GLfloat v1, GLfloat v2); > void (* EvalCoord1d)(GLdouble u); > void (* EvalCoord1dv)(const GLdouble * u); > void (* EvalCoord1f)(GLfloat u); > void (* EvalCoord1fv)(const GLfloat * u); > void (* EvalCoord2d)(GLdouble u, GLdouble v); > void (* EvalCoord2dv)(const GLdouble * u); > void (* EvalCoord2f)(GLfloat u, GLfloat v); > void (* EvalCoord2fv)(const GLfloat * u); > void (* EvalMesh1)(GLenum mode, GLint i1, GLint i2); > void (* EvalPoint1)(GLint i); > void (* EvalMesh2)(GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2); > void (* EvalPoint2)(GLint i, GLint j); > void (* AlphaFunc)(GLenum func, GLclampf ref); > void (* BlendFunc)(GLenum sfactor, GLenum dfactor); > void (* LogicOp)(GLenum opcode); > void (* StencilFunc)(GLenum func, GLint ref, GLuint mask); > void (* StencilOp)(GLenum fail, GLenum zfail, GLenum zpass); > void (* DepthFunc)(GLenum func); > void (* PixelZoom)(GLfloat xfactor, GLfloat yfactor); > void (* PixelTransferf)(GLenum pname, GLfloat param); > void (* PixelTransferi)(GLenum pname, GLint param); > void (* PixelStoref)(GLenum pname, GLfloat param); > void (* PixelStorei)(GLenum pname, GLint param); > void (* PixelMapfv)(GLenum map, GLsizei mapsize, const GLfloat * values); > void (* PixelMapuiv)(GLenum map, GLsizei mapsize, const GLuint * values); > void (* PixelMapusv)(GLenum map, GLsizei mapsize, const GLushort * values); > void (* ReadBuffer)(GLenum mode); > void (* CopyPixels)(GLint x, GLint y, GLsizei width, GLsizei height, GLenum type); > void (* ReadPixels)(GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLvoid * pixels); > void (* DrawPixels)(GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid * pixels); > void (* GetBooleanv)(GLenum pname, GLboolean * params); > void (* GetClipPlane)(GLenum plane, GLdouble * equation); > void (* GetDoublev)(GLenum pname, GLdouble * params); > GLenum (* GetError)(void); > void (* GetFloatv)(GLenum pname, GLfloat * params); > void (* GetIntegerv)(GLenum pname, GLint * params); > void (* GetLightfv)(GLenum light, GLenum pname, GLfloat * params); > void (* GetLightiv)(GLenum light, GLenum pname, GLint * params); > void (* GetMapdv)(GLenum target, GLenum query, GLdouble * v); > void (* GetMapfv)(GLenum target, GLenum query, GLfloat * v); > void (* GetMapiv)(GLenum target, GLenum query, GLint * v); > void (* GetMaterialfv)(GLenum face, GLenum pname, GLfloat * params); > void (* GetMaterialiv)(GLenum face, GLenum pname, GLint * params); > void (* GetPixelMapfv)(GLenum map, GLfloat * values); > void (* GetPixelMapuiv)(GLenum map, GLuint * values); > void (* GetPixelMapusv)(GLenum map, GLushort * values); > void (* GetPolygonStipple)(GLubyte * mask); > const GLubyte * (* GetString)(GLenum name); > void (* GetTexEnvfv)(GLenum target, GLenum pname, GLfloat * params); > void (* GetTexEnviv)(GLenum target, GLenum pname, GLint * params); > void (* GetTexGendv)(GLenum coord, GLenum pname, GLdouble * params); > void (* GetTexGenfv)(GLenum coord, GLenum pname, GLfloat * params); > void (* GetTexGeniv)(GLenum coord, GLenum pname, GLint * params); > void (* GetTexImage)(GLenum target, GLint level, GLenum format, GLenum type, GLvoid * pixels); > void (* GetTexParameterfv)(GLenum target, GLenum pname, GLfloat * params); > void (* GetTexParameteriv)(GLenum target, GLenum pname, GLint * params); > void (* GetTexLevelParameterfv)(GLenum target, GLint level, GLenum pname, GLfloat * params); > void (* GetTexLevelParameteriv)(GLenum target, GLint level, GLenum pname, GLint * params); > GLboolean (* IsEnabled)(GLenum cap); > GLboolean (* IsList)(GLuint list); > void (* DepthRange)(GLclampd zNear, GLclampd zFar); > void (* Frustum)(GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); > void (* LoadIdentity)(void); > void (* LoadMatrixf)(const GLfloat * m); > void (* LoadMatrixd)(const GLdouble * m); > void (* MatrixMode)(GLenum mode); > void (* MultMatrixf)(const GLfloat * m); > void (* MultMatrixd)(const GLdouble * m); > void (* Ortho)(GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); > void (* PopMatrix)(void); > void (* PushMatrix)(void); > void (* Rotated)(GLdouble angle, GLdouble x, GLdouble y, GLdouble z); > void (* Rotatef)(GLfloat angle, GLfloat x, GLfloat y, GLfloat z); > void (* Scaled)(GLdouble x, GLdouble y, GLdouble z); > void (* Scalef)(GLfloat x, GLfloat y, GLfloat z); > void (* Translated)(GLdouble x, GLdouble y, GLdouble z); > void (* Translatef)(GLfloat x, GLfloat y, GLfloat z); > void (* Viewport)(GLint x, GLint y, GLsizei width, GLsizei height); > void (* ArrayElement)(GLint i); > void (* BindTexture)(GLenum target, GLuint texture); > void (* ColorPointer)(GLint size, GLenum type, GLsizei stride, const GLvoid * pointer); > void (* DisableClientState)(GLenum array); > void (* DrawArrays)(GLenum mode, GLint first, GLsizei count); > void (* DrawElements)(GLenum mode, GLsizei count, GLenum type, const GLvoid * indices); > void (* EdgeFlagPointer)(GLsizei stride, const GLvoid * pointer); > void (* EnableClientState)(GLenum array); > void (* IndexPointer)(GLenum type, GLsizei stride, const GLvoid * pointer); > void (* Indexub)(GLubyte c); > void (* Indexubv)(const GLubyte * c); > void (* InterleavedArrays)(GLenum format, GLsizei stride, const GLvoid * pointer); > void (* NormalPointer)(GLenum type, GLsizei stride, const GLvoid * pointer); > void (* PolygonOffset)(GLfloat factor, GLfloat units); > void (* TexCoordPointer)(GLint size, GLenum type, GLsizei stride, const GLvoid * pointer); > void (* VertexPointer)(GLint size, GLenum type, GLsizei stride, const GLvoid * pointer); > GLboolean (* AreTexturesResident)(GLsizei n, const GLuint * textures, GLboolean * residences); > void (* CopyTexImage1D)(GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); > void (* CopyTexImage2D)(GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); > void (* CopyTexSubImage1D)(GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); > void (* CopyTexSubImage2D)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); > void (* DeleteTextures)(GLsizei n, const GLuint * textures); > void (* GenTextures)(GLsizei n, GLuint * textures); > void (* GetPointerv)(GLenum pname, GLvoid ** params); > GLboolean (* IsTexture)(GLuint texture); > void (* PrioritizeTextures)(GLsizei n, const GLuint * textures, const GLclampf * priorities); > void (* TexSubImage1D)(GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid * pixels); > void (* TexSubImage2D)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid * pixels); > void (* PopClientAttrib)(void); > void (* PushClientAttrib)(GLbitfield mask); > void (* BlendColor)(GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); > void (* BlendEquation)(GLenum mode); > void (* DrawRangeElements)(GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid * indices); > void (* ColorTable)(GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid * table); > void (* ColorTableParameterfv)(GLenum target, GLenum pname, const GLfloat * params); > void (* ColorTableParameteriv)(GLenum target, GLenum pname, const GLint * params); > void (* CopyColorTable)(GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); > void (* GetColorTable)(GLenum target, GLenum format, GLenum type, GLvoid * table); > void (* GetColorTableParameterfv)(GLenum target, GLenum pname, GLfloat * params); > void (* GetColorTableParameteriv)(GLenum target, GLenum pname, GLint * params); > void (* ColorSubTable)(GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid * data); > void (* CopyColorSubTable)(GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); > void (* ConvolutionFilter1D)(GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid * image); > void (* ConvolutionFilter2D)(GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid * image); > void (* ConvolutionParameterf)(GLenum target, GLenum pname, GLfloat params); > void (* ConvolutionParameterfv)(GLenum target, GLenum pname, const GLfloat * params); > void (* ConvolutionParameteri)(GLenum target, GLenum pname, GLint params); > void (* ConvolutionParameteriv)(GLenum target, GLenum pname, const GLint * params); > void (* CopyConvolutionFilter1D)(GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); > void (* CopyConvolutionFilter2D)(GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); > void (* GetConvolutionFilter)(GLenum target, GLenum format, GLenum type, GLvoid * image); > void (* GetConvolutionParameterfv)(GLenum target, GLenum pname, GLfloat * params); > void (* GetConvolutionParameteriv)(GLenum target, GLenum pname, GLint * params); > void (* GetSeparableFilter)(GLenum target, GLenum format, GLenum type, GLvoid * row, GLvoid * column, GLvoid * span); > void (* SeparableFilter2D)(GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid * row, const GLvoid * column); > void (* GetHistogram)(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid * values); > void (* GetHistogramParameterfv)(GLenum target, GLenum pname, GLfloat * params); > void (* GetHistogramParameteriv)(GLenum target, GLenum pname, GLint * params); > void (* GetMinmax)(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid * values); > void (* GetMinmaxParameterfv)(GLenum target, GLenum pname, GLfloat * params); > void (* GetMinmaxParameteriv)(GLenum target, GLenum pname, GLint * params); > void (* Histogram)(GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); > void (* Minmax)(GLenum target, GLenum internalformat, GLboolean sink); > void (* ResetHistogram)(GLenum target); > void (* ResetMinmax)(GLenum target); > void (* TexImage3D)(GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid * pixels); > void (* TexSubImage3D)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid * pixels); > void (* CopyTexSubImage3D)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); > void (* ActiveTextureARB)(GLenum texture); > void (* ClientActiveTextureARB)(GLenum texture); > void (* MultiTexCoord1dARB)(GLenum target, GLdouble s); > void (* MultiTexCoord1dvARB)(GLenum target, const GLdouble * v); > void (* MultiTexCoord1fARB)(GLenum target, GLfloat s); > void (* MultiTexCoord1fvARB)(GLenum target, const GLfloat * v); > void (* MultiTexCoord1iARB)(GLenum target, GLint s); > void (* MultiTexCoord1ivARB)(GLenum target, const GLint * v); > void (* MultiTexCoord1sARB)(GLenum target, GLshort s); > void (* MultiTexCoord1svARB)(GLenum target, const GLshort * v); > void (* MultiTexCoord2dARB)(GLenum target, GLdouble s, GLdouble t); > void (* MultiTexCoord2dvARB)(GLenum target, const GLdouble * v); > void (* MultiTexCoord2fARB)(GLenum target, GLfloat s, GLfloat t); > void (* MultiTexCoord2fvARB)(GLenum target, const GLfloat * v); > void (* MultiTexCoord2iARB)(GLenum target, GLint s, GLint t); > void (* MultiTexCoord2ivARB)(GLenum target, const GLint * v); > void (* MultiTexCoord2sARB)(GLenum target, GLshort s, GLshort t); > void (* MultiTexCoord2svARB)(GLenum target, const GLshort * v); > void (* MultiTexCoord3dARB)(GLenum target, GLdouble s, GLdouble t, GLdouble r); > void (* MultiTexCoord3dvARB)(GLenum target, const GLdouble * v); > void (* MultiTexCoord3fARB)(GLenum target, GLfloat s, GLfloat t, GLfloat r); > void (* MultiTexCoord3fvARB)(GLenum target, const GLfloat * v); > void (* MultiTexCoord3iARB)(GLenum target, GLint s, GLint t, GLint r); > void (* MultiTexCoord3ivARB)(GLenum target, const GLint * v); > void (* MultiTexCoord3sARB)(GLenum target, GLshort s, GLshort t, GLshort r); > void (* MultiTexCoord3svARB)(GLenum target, const GLshort * v); > void (* MultiTexCoord4dARB)(GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); > void (* MultiTexCoord4dvARB)(GLenum target, const GLdouble * v); > void (* MultiTexCoord4fARB)(GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); > void (* MultiTexCoord4fvARB)(GLenum target, const GLfloat * v); > void (* MultiTexCoord4iARB)(GLenum target, GLint s, GLint t, GLint r, GLint q); > void (* MultiTexCoord4ivARB)(GLenum target, const GLint * v); > void (* MultiTexCoord4sARB)(GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); > void (* MultiTexCoord4svARB)(GLenum target, const GLshort * v); > void (* LoadTransposeMatrixfARB)(const GLfloat * m); > void (* LoadTransposeMatrixdARB)(const GLdouble * m); > void (* MultTransposeMatrixfARB)(const GLfloat * m); > void (* MultTransposeMatrixdARB)(const GLdouble * m); > void (* SampleCoverageARB)(GLclampf value, GLboolean invert); > void (* __unused413)(void); > void (* PolygonOffsetEXT)(GLfloat factor, GLfloat bias); > void (* GetTexFilterFuncSGIS)(GLenum target, GLenum filter, GLfloat * weights); > void (* TexFilterFuncSGIS)(GLenum target, GLenum filter, GLsizei n, const GLfloat * weights); > void (* GetHistogramEXT)(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid * values); > void (* GetHistogramParameterfvEXT)(GLenum target, GLenum pname, GLfloat * params); > void (* GetHistogramParameterivEXT)(GLenum target, GLenum pname, GLint * params); > void (* GetMinmaxEXT)(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid * values); > void (* GetMinmaxParameterfvEXT)(GLenum target, GLenum pname, GLfloat * params); > void (* GetMinmaxParameterivEXT)(GLenum target, GLenum pname, GLint * params); > void (* GetConvolutionFilterEXT)(GLenum target, GLenum format, GLenum type, GLvoid * image); > void (* GetConvolutionParameterfvEXT)(GLenum target, GLenum pname, GLfloat * params); > void (* GetConvolutionParameterivEXT)(GLenum target, GLenum pname, GLint * params); > void (* GetSeparableFilterEXT)(GLenum target, GLenum format, GLenum type, GLvoid * row, GLvoid * column, GLvoid * span); > void (* GetColorTableSGI)(GLenum target, GLenum format, GLenum type, GLvoid * table); > void (* GetColorTableParameterfvSGI)(GLenum target, GLenum pname, GLfloat * params); > void (* GetColorTableParameterivSGI)(GLenum target, GLenum pname, GLint * params); > void (* PixelTexGenSGIX)(GLenum mode); > void (* PixelTexGenParameteriSGIS)(GLenum pname, GLint param); > void (* PixelTexGenParameterivSGIS)(GLenum pname, const GLint * params); > void (* PixelTexGenParameterfSGIS)(GLenum pname, GLfloat param); > void (* PixelTexGenParameterfvSGIS)(GLenum pname, const GLfloat * params); > void (* GetPixelTexGenParameterivSGIS)(GLenum pname, GLint * params); > void (* GetPixelTexGenParameterfvSGIS)(GLenum pname, GLfloat * params); > void (* TexImage4DSGIS)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid * pixels); > void (* TexSubImage4DSGIS)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid * pixels); > GLboolean (* AreTexturesResidentEXT)(GLsizei n, const GLuint * textures, GLboolean * residences); > void (* GenTexturesEXT)(GLsizei n, GLuint * textures); > GLboolean (* IsTextureEXT)(GLuint texture); > void (* DetailTexFuncSGIS)(GLenum target, GLsizei n, const GLfloat * points); > void (* GetDetailTexFuncSGIS)(GLenum target, GLfloat * points); > void (* SharpenTexFuncSGIS)(GLenum target, GLsizei n, const GLfloat * points); > void (* GetSharpenTexFuncSGIS)(GLenum target, GLfloat * points); > void (* SampleMaskSGIS)(GLclampf value, GLboolean invert); > void (* SamplePatternSGIS)(GLenum pattern); > void (* ColorPointerEXT)(GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid * pointer); > void (* EdgeFlagPointerEXT)(GLsizei stride, GLsizei count, const GLboolean * pointer); > void (* IndexPointerEXT)(GLenum type, GLsizei stride, GLsizei count, const GLvoid * pointer); > void (* NormalPointerEXT)(GLenum type, GLsizei stride, GLsizei count, const GLvoid * pointer); > void (* TexCoordPointerEXT)(GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid * pointer); > void (* VertexPointerEXT)(GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid * pointer); > void (* SpriteParameterfSGIX)(GLenum pname, GLfloat param); > void (* SpriteParameterfvSGIX)(GLenum pname, const GLfloat * params); > void (* SpriteParameteriSGIX)(GLenum pname, GLint param); > void (* SpriteParameterivSGIX)(GLenum pname, const GLint * params); > void (* PointParameterfEXT)(GLenum pname, GLfloat param); > void (* PointParameterfvEXT)(GLenum pname, const GLfloat * params); > GLint (* GetInstrumentsSGIX)(void); > void (* InstrumentsBufferSGIX)(GLsizei size, GLint * buffer); > GLint (* PollInstrumentsSGIX)(GLint * marker_p); > void (* ReadInstrumentsSGIX)(GLint marker); > void (* StartInstrumentsSGIX)(void); > void (* StopInstrumentsSGIX)(GLint marker); > void (* FrameZoomSGIX)(GLint factor); > void (* TagSampleBufferSGIX)(void); > void (* ReferencePlaneSGIX)(const GLdouble * equation); > void (* FlushRasterSGIX)(void); > void (* GetListParameterfvSGIX)(GLuint list, GLenum pname, GLfloat * params); > void (* GetListParameterivSGIX)(GLuint list, GLenum pname, GLint * params); > void (* ListParameterfSGIX)(GLuint list, GLenum pname, GLfloat param); > void (* ListParameterfvSGIX)(GLuint list, GLenum pname, const GLfloat * params); > void (* ListParameteriSGIX)(GLuint list, GLenum pname, GLint param); > void (* ListParameterivSGIX)(GLuint list, GLenum pname, const GLint * params); > void (* FragmentColorMaterialSGIX)(GLenum face, GLenum mode); > void (* FragmentLightfSGIX)(GLenum light, GLenum pname, GLfloat param); > void (* FragmentLightfvSGIX)(GLenum light, GLenum pname, const GLfloat * params); > void (* FragmentLightiSGIX)(GLenum light, GLenum pname, GLint param); > void (* FragmentLightivSGIX)(GLenum light, GLenum pname, const GLint * params); > void (* FragmentLightModelfSGIX)(GLenum pname, GLfloat param); > void (* FragmentLightModelfvSGIX)(GLenum pname, const GLfloat * params); > void (* FragmentLightModeliSGIX)(GLenum pname, GLint param); > void (* FragmentLightModelivSGIX)(GLenum pname, const GLint * params); > void (* FragmentMaterialfSGIX)(GLenum face, GLenum pname, GLfloat param); > void (* FragmentMaterialfvSGIX)(GLenum face, GLenum pname, const GLfloat * params); > void (* FragmentMaterialiSGIX)(GLenum face, GLenum pname, GLint param); > void (* FragmentMaterialivSGIX)(GLenum face, GLenum pname, const GLint * params); > void (* GetFragmentLightfvSGIX)(GLenum light, GLenum pname, GLfloat * params); > void (* GetFragmentLightivSGIX)(GLenum light, GLenum pname, GLint * params); > void (* GetFragmentMaterialfvSGIX)(GLenum face, GLenum pname, GLfloat * params); > void (* GetFragmentMaterialivSGIX)(GLenum face, GLenum pname, GLint * params); > void (* LightEnviSGIX)(GLenum pname, GLint param); > void (* VertexWeightfEXT)(GLfloat weight); > void (* VertexWeightfvEXT)(const GLfloat * weight); > void (* VertexWeightPointerEXT)(GLsizei size, GLenum type, GLsizei stride, const GLvoid * pointer); > void (* FlushVertexArrayRangeNV)(void); > void (* VertexArrayRangeNV)(GLsizei length, const GLvoid * pointer); > void (* CombinerParameterfvNV)(GLenum pname, const GLfloat * params); > void (* CombinerParameterfNV)(GLenum pname, GLfloat param); > void (* CombinerParameterivNV)(GLenum pname, const GLint * params); > void (* CombinerParameteriNV)(GLenum pname, GLint param); > void (* CombinerInputNV)(GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); > void (* CombinerOutputNV)(GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); > void (* FinalCombinerInputNV)(GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); > void (* GetCombinerInputParameterfvNV)(GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat * params); > void (* GetCombinerInputParameterivNV)(GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint * params); > void (* GetCombinerOutputParameterfvNV)(GLenum stage, GLenum portion, GLenum pname, GLfloat * params); > void (* GetCombinerOutputParameterivNV)(GLenum stage, GLenum portion, GLenum pname, GLint * params); > void (* GetFinalCombinerInputParameterfvNV)(GLenum variable, GLenum pname, GLfloat * params); > void (* GetFinalCombinerInputParameterivNV)(GLenum variable, GLenum pname, GLint * params); > void (* ResizeBuffersMESA)(void); > void (* WindowPos2dMESA)(GLdouble x, GLdouble y); > void (* WindowPos2dvMESA)(const GLdouble * v); > void (* WindowPos2fMESA)(GLfloat x, GLfloat y); > void (* WindowPos2fvMESA)(const GLfloat * v); > void (* WindowPos2iMESA)(GLint x, GLint y); > void (* WindowPos2ivMESA)(const GLint * v); > void (* WindowPos2sMESA)(GLshort x, GLshort y); > void (* WindowPos2svMESA)(const GLshort * v); > void (* WindowPos3dMESA)(GLdouble x, GLdouble y, GLdouble z); > void (* WindowPos3dvMESA)(const GLdouble * v); > void (* WindowPos3fMESA)(GLfloat x, GLfloat y, GLfloat z); > void (* WindowPos3fvMESA)(const GLfloat * v); > void (* WindowPos3iMESA)(GLint x, GLint y, GLint z); > void (* WindowPos3ivMESA)(const GLint * v); > void (* WindowPos3sMESA)(GLshort x, GLshort y, GLshort z); > void (* WindowPos3svMESA)(const GLshort * v); > void (* WindowPos4dMESA)(GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* WindowPos4dvMESA)(const GLdouble * v); > void (* WindowPos4fMESA)(GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* WindowPos4fvMESA)(const GLfloat * v); > void (* WindowPos4iMESA)(GLint x, GLint y, GLint z, GLint w); > void (* WindowPos4ivMESA)(const GLint * v); > void (* WindowPos4sMESA)(GLshort x, GLshort y, GLshort z, GLshort w); > void (* WindowPos4svMESA)(const GLshort * v); > void (* BlendFuncSeparateEXT)(GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); > void (* IndexMaterialEXT)(GLenum face, GLenum mode); > void (* IndexFuncEXT)(GLenum func, GLclampf ref); > void (* LockArraysEXT)(GLint first, GLsizei count); > void (* UnlockArraysEXT)(void); > void (* CullParameterdvEXT)(GLenum pname, GLdouble * params); > void (* CullParameterfvEXT)(GLenum pname, GLfloat * params); > void (* HintPGI)(GLenum target, GLint mode); > void (* FogCoordfEXT)(GLfloat coord); > void (* FogCoordfvEXT)(const GLfloat * coord); > void (* FogCoorddEXT)(GLdouble coord); > void (* FogCoorddvEXT)(const GLdouble * coord); > void (* FogCoordPointerEXT)(GLenum type, GLsizei stride, const GLvoid * pointer); > void (* GetColorTableEXT)(GLenum target, GLenum format, GLenum type, GLvoid * data); > void (* GetColorTableParameterivEXT)(GLenum target, GLenum pname, GLint * params); > void (* GetColorTableParameterfvEXT)(GLenum target, GLenum pname, GLfloat * params); > void (* TbufferMask3DFX)(GLuint mask); > void (* CompressedTexImage3DARB)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid * data); > void (* CompressedTexImage2DARB)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid * data); > void (* CompressedTexImage1DARB)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid * data); > void (* CompressedTexSubImage3DARB)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid * data); > void (* CompressedTexSubImage2DARB)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid * data); > void (* CompressedTexSubImage1DARB)(GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid * data); > void (* GetCompressedTexImageARB)(GLenum target, GLint level, GLvoid * img); > void (* SecondaryColor3bEXT)(GLbyte red, GLbyte green, GLbyte blue); > void (* SecondaryColor3bvEXT)(const GLbyte * v); > void (* SecondaryColor3dEXT)(GLdouble red, GLdouble green, GLdouble blue); > void (* SecondaryColor3dvEXT)(const GLdouble * v); > void (* SecondaryColor3fEXT)(GLfloat red, GLfloat green, GLfloat blue); > void (* SecondaryColor3fvEXT)(const GLfloat * v); > void (* SecondaryColor3iEXT)(GLint red, GLint green, GLint blue); > void (* SecondaryColor3ivEXT)(const GLint * v); > void (* SecondaryColor3sEXT)(GLshort red, GLshort green, GLshort blue); > void (* SecondaryColor3svEXT)(const GLshort * v); > void (* SecondaryColor3ubEXT)(GLubyte red, GLubyte green, GLubyte blue); > void (* SecondaryColor3ubvEXT)(const GLubyte * v); > void (* SecondaryColor3uiEXT)(GLuint red, GLuint green, GLuint blue); > void (* SecondaryColor3uivEXT)(const GLuint * v); > void (* SecondaryColor3usEXT)(GLushort red, GLushort green, GLushort blue); > void (* SecondaryColor3usvEXT)(const GLushort * v); > void (* SecondaryColorPointerEXT)(GLint size, GLenum type, GLsizei stride, const GLvoid * pointer); > GLboolean (* AreProgramsResidentNV)(GLsizei n, const GLuint * ids, GLboolean * residences); > void (* BindProgramNV)(GLenum target, GLuint id); > void (* DeleteProgramsNV)(GLsizei n, const GLuint * ids); > void (* ExecuteProgramNV)(GLenum target, GLuint id, const GLfloat * params); > void (* GenProgramsNV)(GLsizei n, GLuint * ids); > void (* GetProgramParameterdvNV)(GLenum target, GLuint index, GLenum pname, GLdouble * params); > void (* GetProgramParameterfvNV)(GLenum target, GLuint index, GLenum pname, GLfloat * params); > void (* GetProgramivNV)(GLuint id, GLenum pname, GLint * params); > void (* GetProgramStringNV)(GLuint id, GLenum pname, GLubyte * program); > void (* GetTrackMatrixivNV)(GLenum target, GLuint address, GLenum pname, GLint * params); > void (* GetVertexAttribdvNV)(GLuint index, GLenum pname, GLdouble * params); > void (* GetVertexAttribfvNV)(GLuint index, GLenum pname, GLfloat * params); > void (* GetVertexAttribivNV)(GLuint index, GLenum pname, GLint * params); > void (* GetVertexAttribPointervNV)(GLuint index, GLenum pname, GLvoid ** pointer); > GLboolean (* IsProgramNV)(GLuint id); > void (* LoadProgramNV)(GLenum target, GLuint id, GLsizei len, const GLubyte * program); > void (* ProgramParameter4dNV)(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* ProgramParameter4dvNV)(GLenum target, GLuint index, const GLdouble * params); > void (* ProgramParameter4fNV)(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* ProgramParameter4fvNV)(GLenum target, GLuint index, const GLfloat * params); > void (* ProgramParameters4dvNV)(GLenum target, GLuint index, GLuint num, const GLdouble * params); > void (* ProgramParameters4fvNV)(GLenum target, GLuint index, GLuint num, const GLfloat * params); > void (* RequestResidentProgramsNV)(GLsizei n, const GLuint * ids); > void (* TrackMatrixNV)(GLenum target, GLuint address, GLenum matrix, GLenum transform); > void (* VertexAttribPointerNV)(GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid * pointer); > void (* VertexAttrib1dNV)(GLuint index, GLdouble x); > void (* VertexAttrib1dvNV)(GLuint index, const GLdouble * v); > void (* VertexAttrib1fNV)(GLuint index, GLfloat x); > void (* VertexAttrib1fvNV)(GLuint index, const GLfloat * v); > void (* VertexAttrib1sNV)(GLuint index, GLshort x); > void (* VertexAttrib1svNV)(GLuint index, const GLshort * v); > void (* VertexAttrib2dNV)(GLuint index, GLdouble x, GLdouble y); > void (* VertexAttrib2dvNV)(GLuint index, const GLdouble * v); > void (* VertexAttrib2fNV)(GLuint index, GLfloat x, GLfloat y); > void (* VertexAttrib2fvNV)(GLuint index, const GLfloat * v); > void (* VertexAttrib2sNV)(GLuint index, GLshort x, GLshort y); > void (* VertexAttrib2svNV)(GLuint index, const GLshort * v); > void (* VertexAttrib3dNV)(GLuint index, GLdouble x, GLdouble y, GLdouble z); > void (* VertexAttrib3dvNV)(GLuint index, const GLdouble * v); > void (* VertexAttrib3fNV)(GLuint index, GLfloat x, GLfloat y, GLfloat z); > void (* VertexAttrib3fvNV)(GLuint index, const GLfloat * v); > void (* VertexAttrib3sNV)(GLuint index, GLshort x, GLshort y, GLshort z); > void (* VertexAttrib3svNV)(GLuint index, const GLshort * v); > void (* VertexAttrib4dNV)(GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* VertexAttrib4dvNV)(GLuint index, const GLdouble * v); > void (* VertexAttrib4fNV)(GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* VertexAttrib4fvNV)(GLuint index, const GLfloat * v); > void (* VertexAttrib4sNV)(GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); > void (* VertexAttrib4svNV)(GLuint index, const GLshort * v); > void (* VertexAttrib4ubNV)(GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); > void (* VertexAttrib4ubvNV)(GLuint index, const GLubyte * v); > void (* VertexAttribs1dvNV)(GLuint index, GLsizei n, const GLdouble * v); > void (* VertexAttribs1fvNV)(GLuint index, GLsizei n, const GLfloat * v); > void (* VertexAttribs1svNV)(GLuint index, GLsizei n, const GLshort * v); > void (* VertexAttribs2dvNV)(GLuint index, GLsizei n, const GLdouble * v); > void (* VertexAttribs2fvNV)(GLuint index, GLsizei n, const GLfloat * v); > void (* VertexAttribs2svNV)(GLuint index, GLsizei n, const GLshort * v); > void (* VertexAttribs3dvNV)(GLuint index, GLsizei n, const GLdouble * v); > void (* VertexAttribs3fvNV)(GLuint index, GLsizei n, const GLfloat * v); > void (* VertexAttribs3svNV)(GLuint index, GLsizei n, const GLshort * v); > void (* VertexAttribs4dvNV)(GLuint index, GLsizei n, const GLdouble * v); > void (* VertexAttribs4fvNV)(GLuint index, GLsizei n, const GLfloat * v); > void (* VertexAttribs4svNV)(GLuint index, GLsizei n, const GLshort * v); > void (* VertexAttribs4ubvNV)(GLuint index, GLsizei n, const GLubyte * v); > void (* PointParameteriNV)(GLenum pname, GLint params); > void (* PointParameterivNV)(GLenum pname, const GLint * params); > void (* MultiDrawArraysEXT)(GLenum mode, GLint * first, GLsizei * count, GLsizei primcount); > void (* MultiDrawElementsEXT)(GLenum mode, const GLsizei * count, GLenum type, const GLvoid ** indices, GLsizei primcount); > void (* ActiveStencilFaceEXT)(GLenum face); > void (* DeleteFencesNV)(GLsizei n, const GLuint * fences); > void (* GenFencesNV)(GLsizei n, GLuint * fences); > GLboolean (* IsFenceNV)(GLuint fence); > GLboolean (* TestFenceNV)(GLuint fence); > void (* GetFenceivNV)(GLuint fence, GLenum pname, GLint * params); > void (* FinishFenceNV)(GLuint fence); > void (* SetFenceNV)(GLuint fence, GLenum condition); > void (* VertexAttrib4bvARB)(GLuint index, const GLbyte * v); > void (* VertexAttrib4ivARB)(GLuint index, const GLint * v); > void (* VertexAttrib4ubvARB)(GLuint index, const GLubyte * v); > void (* VertexAttrib4usvARB)(GLuint index, const GLushort * v); > void (* VertexAttrib4uivARB)(GLuint index, const GLuint * v); > void (* VertexAttrib4NbvARB)(GLuint index, const GLbyte * v); > void (* VertexAttrib4NsvARB)(GLuint index, const GLshort * v); > void (* VertexAttrib4NivARB)(GLuint index, const GLint * v); > void (* VertexAttrib4NusvARB)(GLuint index, const GLushort * v); > void (* VertexAttrib4NuivARB)(GLuint index, const GLuint * v); > void (* VertexAttribPointerARB)(GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid * pointer); > void (* EnableVertexAttribArrayARB)(GLuint index); > void (* DisableVertexAttribArrayARB)(GLuint index); > void (* ProgramStringARB)(GLenum target, GLenum format, GLsizei len, const GLvoid * string); > void (* ProgramEnvParameter4dARB)(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* ProgramEnvParameter4dvARB)(GLenum target, GLuint index, const GLdouble * params); > void (* ProgramEnvParameter4fARB)(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* ProgramEnvParameter4fvARB)(GLenum target, GLuint index, const GLfloat * params); > void (* ProgramLocalParameter4dARB)(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* ProgramLocalParameter4dvARB)(GLenum target, GLuint index, const GLdouble * params); > void (* ProgramLocalParameter4fARB)(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* ProgramLocalParameter4fvARB)(GLenum target, GLuint index, const GLfloat * params); > void (* GetProgramEnvParameterdvARB)(GLenum target, GLuint index, GLdouble * params); > void (* GetProgramEnvParameterfvARB)(GLenum target, GLuint index, GLfloat * params); > void (* GetProgramLocalParameterdvARB)(GLenum target, GLuint index, GLdouble * params); > void (* GetProgramLocalParameterfvARB)(GLenum target, GLuint index, GLfloat * params); > void (* GetProgramivARB)(GLenum target, GLenum pname, GLint * params); > void (* GetProgramStringARB)(GLenum target, GLenum pname, GLvoid * string); > void (* ProgramNamedParameter4fNV)(GLuint id, GLsizei len, const GLubyte * name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); > void (* ProgramNamedParameter4dNV)(GLuint id, GLsizei len, const GLubyte * name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); > void (* ProgramNamedParameter4fvNV)(GLuint id, GLsizei len, const GLubyte * name, const GLfloat * v); > void (* ProgramNamedParameter4dvNV)(GLuint id, GLsizei len, const GLubyte * name, const GLdouble * v); > void (* GetProgramNamedParameterfvNV)(GLuint id, GLsizei len, const GLubyte * name, GLfloat * params); > void (* GetProgramNamedParameterdvNV)(GLuint id, GLsizei len, const GLubyte * name, GLdouble * params); > void (* BindBufferARB)(GLenum target, GLuint buffer); > void (* BufferDataARB)(GLenum target, GLsizeiptrARB size, const GLvoid * data, GLenum usage); > void (* BufferSubDataARB)(GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid * data); > void (* DeleteBuffersARB)(GLsizei n, const GLuint * buffer); > void (* GenBuffersARB)(GLsizei n, GLuint * buffer); > void (* GetBufferParameterivARB)(GLenum target, GLenum pname, GLint * params); > void (* GetBufferPointervARB)(GLenum target, GLenum pname, GLvoid ** params); > void (* GetBufferSubDataARB)(GLenum target, GLintptrARB offset, GLsizeiptrARB size, void * data); > GLboolean (* IsBufferARB)(GLuint buffer); > void * (* MapBufferARB)(GLenum target, GLenum access); > GLboolean (* UnmapBufferARB)(GLenum target); > void (* DepthBoundsEXT)(GLclampd zmin, GLclampd zmax); > void (* GenQueriesARB)(GLsizei n, GLuint * ids); > void (* DeleteQueriesARB)(GLsizei n, const GLuint * ids); > GLboolean (* IsQueryARB)(GLuint id); > void (* BeginQueryARB)(GLenum target, GLuint id); > void (* EndQueryARB)(GLenum target); > void (* GetQueryivARB)(GLenum target, GLenum pname, GLint * params); > void (* GetQueryObjectivARB)(GLuint id, GLenum pname, GLint * params); > void (* GetQueryObjectuivARB)(GLuint id, GLenum pname, GLuint * params); > void (* MultiModeDrawArraysIBM)(const GLenum * mode, const GLint * first, const GLsizei * count, GLsizei primcount, GLint modestride); > void (* MultiModeDrawElementsIBM)(const GLenum * mode, const GLsizei * count, GLenum type, const GLvoid * const * indices, GLsizei primcount, GLint modestride); > void (* BlendEquationSeparateEXT)(GLenum modeRGB, GLenum modeA); >}; ># 41 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" 2 ># 1 "../../../../../../extras/Mesa/src/mesa/glapi/glthread.h" 1 ># 197 "../../../../../../extras/Mesa/src/mesa/glapi/glthread.h" ># 1 "../../../../../../exports/include/X11/Xthreads.h" 1 ># 230 "../../../../../../exports/include/X11/Xthreads.h" ># 1 "/usr/include/pthread.h" 1 3 4 ># 20 "/usr/include/pthread.h" 3 4 ># 1 "/usr/include/sched.h" 1 3 4 ># 29 "/usr/include/sched.h" 3 4 ># 1 "/usr/include/time.h" 1 3 4 ># 30 "/usr/include/sched.h" 2 3 4 > > ># 1 "/usr/include/bits/sched.h" 1 3 4 ># 62 "/usr/include/bits/sched.h" 3 4 >struct sched_param > { > int __sched_priority; > }; > > > > > >extern int clone (int (*__fn) (void *__arg), void *__child_stack, > int __flags, void *__arg) ; > > > ># 98 "/usr/include/bits/sched.h" 3 4 >typedef unsigned long int __cpu_mask; > > > > > > >typedef struct >{ > __cpu_mask __bits[1024 / (8 * sizeof (__cpu_mask))]; >} cpu_set_t; ># 33 "/usr/include/sched.h" 2 3 4 > > > > > > > >extern int sched_setparam (__pid_t __pid, __const struct sched_param *__param) > ; > > >extern int sched_getparam (__pid_t __pid, struct sched_param *__param) ; > > >extern int sched_setscheduler (__pid_t __pid, int __policy, > __const struct sched_param *__param) ; > > >extern int sched_getscheduler (__pid_t __pid) ; > > >extern int sched_yield (void) ; > > >extern int sched_get_priority_max (int __algorithm) ; > > >extern int sched_get_priority_min (int __algorithm) ; > > >extern int sched_rr_get_interval (__pid_t __pid, struct timespec *__t) ; ># 76 "/usr/include/sched.h" 3 4 >extern int sched_setaffinity (__pid_t __pid, size_t __cpusetsize, > __const cpu_set_t *__cpuset) ; > > >extern int sched_getaffinity (__pid_t __pid, size_t __cpusetsize, > cpu_set_t *__cpuset) ; > > > ># 21 "/usr/include/pthread.h" 2 3 4 ># 1 "/usr/include/time.h" 1 3 4 ># 30 "/usr/include/time.h" 3 4 > > > > > > > > ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 39 "/usr/include/time.h" 2 3 4 > > > ># 1 "/usr/include/bits/time.h" 1 3 4 ># 43 "/usr/include/time.h" 2 3 4 ># 129 "/usr/include/time.h" 3 4 > > >struct tm >{ > int tm_sec; > int tm_min; > int tm_hour; > int tm_mday; > int tm_mon; > int tm_year; > int tm_wday; > int tm_yday; > int tm_isdst; > > > long int tm_gmtoff; > __const char *tm_zone; > > > > >}; > > > > > > > > >struct itimerspec > { > struct timespec it_interval; > struct timespec it_value; > }; > > >struct sigevent; ># 178 "/usr/include/time.h" 3 4 > > > >extern clock_t clock (void) ; > > >extern time_t time (time_t *__timer) ; > > >extern double difftime (time_t __time1, time_t __time0) > __attribute__ ((__const__)); > > >extern time_t mktime (struct tm *__tp) ; > > > > > >extern size_t strftime (char *__restrict __s, size_t __maxsize, > __const char *__restrict __format, > __const struct tm *__restrict __tp) ; > > > > > >extern char *strptime (__const char *__restrict __s, > __const char *__restrict __fmt, struct tm *__tp) > ; > > > > > > > >extern size_t strftime_l (char *__restrict __s, size_t __maxsize, > __const char *__restrict __format, > __const struct tm *__restrict __tp, > __locale_t __loc) ; > >extern char *strptime_l (__const char *__restrict __s, > __const char *__restrict __fmt, struct tm *__tp, > __locale_t __loc) ; > > > > > > >extern struct tm *gmtime (__const time_t *__timer) ; > > > >extern struct tm *localtime (__const time_t *__timer) ; > > > > > >extern struct tm *gmtime_r (__const time_t *__restrict __timer, > struct tm *__restrict __tp) ; > > > >extern struct tm *localtime_r (__const time_t *__restrict __timer, > struct tm *__restrict __tp) ; > > > > > >extern char *asctime (__const struct tm *__tp) ; > > >extern char *ctime (__const time_t *__timer) ; > > > > > > > >extern char *asctime_r (__const struct tm *__restrict __tp, > char *__restrict __buf) ; > > >extern char *ctime_r (__const time_t *__restrict __timer, > char *__restrict __buf) ; > > > > >extern char *__tzname[2]; >extern int __daylight; >extern long int __timezone; > > > > >extern char *tzname[2]; > > > >extern void tzset (void) ; > > > >extern int daylight; >extern long int timezone; > > > > > >extern int stime (__const time_t *__when) ; ># 309 "/usr/include/time.h" 3 4 >extern time_t timegm (struct tm *__tp) ; > > >extern time_t timelocal (struct tm *__tp) ; > > >extern int dysize (int __year) __attribute__ ((__const__)); ># 324 "/usr/include/time.h" 3 4 >extern int nanosleep (__const struct timespec *__requested_time, > struct timespec *__remaining); > > > >extern int clock_getres (clockid_t __clock_id, struct timespec *__res) ; > > >extern int clock_gettime (clockid_t __clock_id, struct timespec *__tp) ; > > >extern int clock_settime (clockid_t __clock_id, __const struct timespec *__tp) > ; > > > > > > >extern int clock_nanosleep (clockid_t __clock_id, int __flags, > __const struct timespec *__req, > struct timespec *__rem); > > >extern int clock_getcpuclockid (pid_t __pid, clockid_t *__clock_id) ; > > > > >extern int timer_create (clockid_t __clock_id, > struct sigevent *__restrict __evp, > timer_t *__restrict __timerid) ; > > >extern int timer_delete (timer_t __timerid) ; > > >extern int timer_settime (timer_t __timerid, int __flags, > __const struct itimerspec *__restrict __value, > struct itimerspec *__restrict __ovalue) ; > > >extern int timer_gettime (timer_t __timerid, struct itimerspec *__value) > ; > > >extern int timer_getoverrun (timer_t __timerid) ; ># 386 "/usr/include/time.h" 3 4 >extern int getdate_err; ># 395 "/usr/include/time.h" 3 4 >extern struct tm *getdate (__const char *__string); ># 409 "/usr/include/time.h" 3 4 >extern int getdate_r (__const char *__restrict __string, > struct tm *__restrict __resbufp); > > > ># 22 "/usr/include/pthread.h" 2 3 4 > > ># 1 "/usr/include/signal.h" 1 3 4 ># 31 "/usr/include/signal.h" 3 4 > > ># 1 "/usr/include/bits/sigset.h" 1 3 4 ># 34 "/usr/include/signal.h" 2 3 4 ># 395 "/usr/include/signal.h" 3 4 > ># 25 "/usr/include/pthread.h" 2 3 4 ># 1 "/usr/include/bits/pthreadtypes.h" 1 3 4 ># 26 "/usr/include/pthread.h" 2 3 4 ># 1 "/usr/include/bits/initspin.h" 1 3 4 ># 27 "/usr/include/pthread.h" 2 3 4 > > > ># 59 "/usr/include/pthread.h" 3 4 >enum >{ > PTHREAD_CREATE_JOINABLE, > > PTHREAD_CREATE_DETACHED > >}; > >enum >{ > PTHREAD_INHERIT_SCHED, > > PTHREAD_EXPLICIT_SCHED > >}; > >enum >{ > PTHREAD_SCOPE_SYSTEM, > > PTHREAD_SCOPE_PROCESS > >}; > >enum >{ > PTHREAD_MUTEX_TIMED_NP, > PTHREAD_MUTEX_RECURSIVE_NP, > PTHREAD_MUTEX_ERRORCHECK_NP, > PTHREAD_MUTEX_ADAPTIVE_NP > > , > PTHREAD_MUTEX_NORMAL = PTHREAD_MUTEX_TIMED_NP, > PTHREAD_MUTEX_RECURSIVE = PTHREAD_MUTEX_RECURSIVE_NP, > PTHREAD_MUTEX_ERRORCHECK = PTHREAD_MUTEX_ERRORCHECK_NP, > PTHREAD_MUTEX_DEFAULT = PTHREAD_MUTEX_NORMAL > > > > , PTHREAD_MUTEX_FAST_NP = PTHREAD_MUTEX_ADAPTIVE_NP > >}; > >enum >{ > PTHREAD_PROCESS_PRIVATE, > > PTHREAD_PROCESS_SHARED > >}; > > >enum >{ > PTHREAD_RWLOCK_PREFER_READER_NP, > PTHREAD_RWLOCK_PREFER_WRITER_NP, > PTHREAD_RWLOCK_PREFER_WRITER_NONRECURSIVE_NP, > PTHREAD_RWLOCK_DEFAULT_NP = PTHREAD_RWLOCK_PREFER_WRITER_NP >}; ># 131 "/usr/include/pthread.h" 3 4 >struct _pthread_cleanup_buffer >{ > void (*__routine) (void *); > void *__arg; > int __canceltype; > struct _pthread_cleanup_buffer *__prev; >}; > > > >enum >{ > PTHREAD_CANCEL_ENABLE, > > PTHREAD_CANCEL_DISABLE > >}; >enum >{ > PTHREAD_CANCEL_DEFERRED, > > PTHREAD_CANCEL_ASYNCHRONOUS > >}; ># 163 "/usr/include/pthread.h" 3 4 >extern int pthread_create (pthread_t *__restrict __threadp, > __const pthread_attr_t *__restrict __attr, > void *(*__start_routine) (void *), > void *__restrict __arg) ; > > >extern pthread_t pthread_self (void) ; > > >extern int pthread_equal (pthread_t __thread1, pthread_t __thread2) ; > > >extern void pthread_exit (void *__retval) __attribute__ ((__noreturn__)); > > > > >extern int pthread_join (pthread_t __th, void **__thread_return); > > > > > >extern int pthread_detach (pthread_t __th) ; > > > > > > > >extern int pthread_attr_init (pthread_attr_t *__attr) ; > > >extern int pthread_attr_destroy (pthread_attr_t *__attr) ; > > >extern int pthread_attr_setdetachstate (pthread_attr_t *__attr, > int __detachstate) ; > > >extern int pthread_attr_getdetachstate (__const pthread_attr_t *__attr, > int *__detachstate) ; > > >extern int pthread_attr_setschedparam (pthread_attr_t *__restrict __attr, > __const struct sched_param *__restrict > __param) ; > > >extern int pthread_attr_getschedparam (__const pthread_attr_t *__restrict > __attr, > struct sched_param *__restrict __param) > ; > > >extern int pthread_attr_setschedpolicy (pthread_attr_t *__attr, int __policy) > ; > > >extern int pthread_attr_getschedpolicy (__const pthread_attr_t *__restrict > __attr, int *__restrict __policy) > ; > > >extern int pthread_attr_setinheritsched (pthread_attr_t *__attr, > int __inherit) ; > > >extern int pthread_attr_getinheritsched (__const pthread_attr_t *__restrict > __attr, int *__restrict __inherit) > ; > > >extern int pthread_attr_setscope (pthread_attr_t *__attr, int __scope) > ; > > >extern int pthread_attr_getscope (__const pthread_attr_t *__restrict __attr, > int *__restrict __scope) ; > > > >extern int pthread_attr_setguardsize (pthread_attr_t *__attr, > size_t __guardsize) ; > > >extern int pthread_attr_getguardsize (__const pthread_attr_t *__restrict > __attr, size_t *__restrict __guardsize) > ; > > > > > > >extern int pthread_attr_setstackaddr (pthread_attr_t *__attr, > void *__stackaddr) ; > > >extern int pthread_attr_getstackaddr (__const pthread_attr_t *__restrict > __attr, void **__restrict __stackaddr) > ; > > > > > >extern int pthread_attr_setstack (pthread_attr_t *__attr, void *__stackaddr, > size_t __stacksize) ; > > >extern int pthread_attr_getstack (__const pthread_attr_t *__restrict __attr, > void **__restrict __stackaddr, > size_t *__restrict __stacksize) ; > > > > > >extern int pthread_attr_setstacksize (pthread_attr_t *__attr, > size_t __stacksize) ; > > >extern int pthread_attr_getstacksize (__const pthread_attr_t *__restrict > __attr, size_t *__restrict __stacksize) > ; > > > > > >extern int pthread_getattr_np (pthread_t __th, pthread_attr_t *__attr) ; > > > > > > >extern int pthread_setschedparam (pthread_t __target_thread, int __policy, > __const struct sched_param *__param) > ; > > >extern int pthread_getschedparam (pthread_t __target_thread, > int *__restrict __policy, > struct sched_param *__restrict __param) > ; > > > >extern int pthread_getconcurrency (void) ; > > >extern int pthread_setconcurrency (int __level) ; > > > > > > > >extern int pthread_yield (void) ; > > > > > > >extern int pthread_mutex_init (pthread_mutex_t *__restrict __mutex, > __const pthread_mutexattr_t *__restrict > __mutex_attr) ; > > >extern int pthread_mutex_destroy (pthread_mutex_t *__mutex) ; > > >extern int pthread_mutex_trylock (pthread_mutex_t *__mutex) ; > > >extern int pthread_mutex_lock (pthread_mutex_t *__mutex) ; > > > >extern int pthread_mutex_timedlock (pthread_mutex_t *__restrict __mutex, > __const struct timespec *__restrict > __abstime) ; > > > >extern int pthread_mutex_unlock (pthread_mutex_t *__mutex) ; > > > > > > >extern int pthread_mutexattr_init (pthread_mutexattr_t *__attr) ; > > >extern int pthread_mutexattr_destroy (pthread_mutexattr_t *__attr) ; > > >extern int pthread_mutexattr_getpshared (__const pthread_mutexattr_t * > __restrict __attr, > int *__restrict __pshared) ; > > >extern int pthread_mutexattr_setpshared (pthread_mutexattr_t *__attr, > int __pshared) ; > > > > > >extern int pthread_mutexattr_settype (pthread_mutexattr_t *__attr, int __kind) > ; > > >extern int pthread_mutexattr_gettype (__const pthread_mutexattr_t *__restrict > __attr, int *__restrict __kind) ; > > > > > > > >extern int pthread_cond_init (pthread_cond_t *__restrict __cond, > __const pthread_condattr_t *__restrict > __cond_attr) ; > > >extern int pthread_cond_destroy (pthread_cond_t *__cond) ; > > >extern int pthread_cond_signal (pthread_cond_t *__cond) ; > > >extern int pthread_cond_broadcast (pthread_cond_t *__cond) ; > > > >extern int pthread_cond_wait (pthread_cond_t *__restrict __cond, > pthread_mutex_t *__restrict __mutex); > > > > > >extern int pthread_cond_timedwait (pthread_cond_t *__restrict __cond, > pthread_mutex_t *__restrict __mutex, > __const struct timespec *__restrict > __abstime); > > > > >extern int pthread_condattr_init (pthread_condattr_t *__attr) ; > > >extern int pthread_condattr_destroy (pthread_condattr_t *__attr) ; > > >extern int pthread_condattr_getpshared (__const pthread_condattr_t * > __restrict __attr, > int *__restrict __pshared) ; > > >extern int pthread_condattr_setpshared (pthread_condattr_t *__attr, > int __pshared) ; > > > > > > > >extern int pthread_rwlock_init (pthread_rwlock_t *__restrict __rwlock, > __const pthread_rwlockattr_t *__restrict > __attr) ; > > >extern int pthread_rwlock_destroy (pthread_rwlock_t *__rwlock) ; > > >extern int pthread_rwlock_rdlock (pthread_rwlock_t *__rwlock) ; > > >extern int pthread_rwlock_tryrdlock (pthread_rwlock_t *__rwlock) ; > > > >extern int pthread_rwlock_timedrdlock (pthread_rwlock_t *__restrict __rwlock, > __const struct timespec *__restrict > __abstime) ; > > > >extern int pthread_rwlock_wrlock (pthread_rwlock_t *__rwlock) ; > > >extern int pthread_rwlock_trywrlock (pthread_rwlock_t *__rwlock) ; > > > >extern int pthread_rwlock_timedwrlock (pthread_rwlock_t *__restrict __rwlock, > __const struct timespec *__restrict > __abstime) ; > > > >extern int pthread_rwlock_unlock (pthread_rwlock_t *__rwlock) ; > > > > > >extern int pthread_rwlockattr_init (pthread_rwlockattr_t *__attr) ; > > >extern int pthread_rwlockattr_destroy (pthread_rwlockattr_t *__attr) ; > > >extern int pthread_rwlockattr_getpshared (__const pthread_rwlockattr_t * > __restrict __attr, > int *__restrict __pshared) ; > > >extern int pthread_rwlockattr_setpshared (pthread_rwlockattr_t *__attr, > int __pshared) ; > > >extern int pthread_rwlockattr_getkind_np (__const pthread_rwlockattr_t *__attr, > int *__pref) ; > > >extern int pthread_rwlockattr_setkind_np (pthread_rwlockattr_t *__attr, > int __pref) ; ># 510 "/usr/include/pthread.h" 3 4 >extern int pthread_spin_init (pthread_spinlock_t *__lock, int __pshared) > ; > > >extern int pthread_spin_destroy (pthread_spinlock_t *__lock) ; > > >extern int pthread_spin_lock (pthread_spinlock_t *__lock) ; > > >extern int pthread_spin_trylock (pthread_spinlock_t *__lock) ; > > >extern int pthread_spin_unlock (pthread_spinlock_t *__lock) ; > > > > >extern int pthread_barrier_init (pthread_barrier_t *__restrict __barrier, > __const pthread_barrierattr_t *__restrict > __attr, unsigned int __count) ; > >extern int pthread_barrier_destroy (pthread_barrier_t *__barrier) ; > >extern int pthread_barrierattr_init (pthread_barrierattr_t *__attr) ; > >extern int pthread_barrierattr_destroy (pthread_barrierattr_t *__attr) ; > >extern int pthread_barrierattr_getpshared (__const pthread_barrierattr_t * > __restrict __attr, > int *__restrict __pshared) ; > >extern int pthread_barrierattr_setpshared (pthread_barrierattr_t *__attr, > int __pshared) ; > >extern int pthread_barrier_wait (pthread_barrier_t *__barrier) ; ># 557 "/usr/include/pthread.h" 3 4 >extern int pthread_key_create (pthread_key_t *__key, > void (*__destr_function) (void *)) ; > > >extern int pthread_key_delete (pthread_key_t __key) ; > > >extern int pthread_setspecific (pthread_key_t __key, > __const void *__pointer) ; > > >extern void *pthread_getspecific (pthread_key_t __key) ; ># 577 "/usr/include/pthread.h" 3 4 >extern int pthread_once (pthread_once_t *__once_control, > void (*__init_routine) (void)) ; > > > > > > >extern int pthread_setcancelstate (int __state, int *__oldstate); > > > >extern int pthread_setcanceltype (int __type, int *__oldtype); > > >extern int pthread_cancel (pthread_t __cancelthread); > > > > >extern void pthread_testcancel (void); ># 611 "/usr/include/pthread.h" 3 4 >extern void _pthread_cleanup_push (struct _pthread_cleanup_buffer *__buffer, > void (*__routine) (void *), > void *__arg) ; > > > > > > > >extern void _pthread_cleanup_pop (struct _pthread_cleanup_buffer *__buffer, > int __execute) ; ># 632 "/usr/include/pthread.h" 3 4 >extern void _pthread_cleanup_push_defer (struct _pthread_cleanup_buffer *__buffer, > void (*__routine) (void *), > void *__arg) ; ># 643 "/usr/include/pthread.h" 3 4 >extern void _pthread_cleanup_pop_restore (struct _pthread_cleanup_buffer *__buffer, > int __execute) ; > > > > > >extern int pthread_getcpuclockid (pthread_t __thread_id, > __clockid_t *__clock_id) ; > > > > ># 1 "/usr/include/bits/sigthread.h" 1 3 4 ># 31 "/usr/include/bits/sigthread.h" 3 4 >extern int pthread_sigmask (int __how, > __const __sigset_t *__restrict __newmask, > __sigset_t *__restrict __oldmask); > > >extern int pthread_kill (pthread_t __threadid, int __signo) ; ># 657 "/usr/include/pthread.h" 2 3 4 ># 672 "/usr/include/pthread.h" 3 4 >extern int pthread_atfork (void (*__prepare) (void), > void (*__parent) (void), > void (*__child) (void)) ; > > > > >extern void pthread_kill_other_threads_np (void) ; > > ># 231 "../../../../../../exports/include/X11/Xthreads.h" 2 >typedef pthread_t xthread_t; >typedef pthread_key_t xthread_key_t; >typedef pthread_cond_t xcondition_rec; >typedef pthread_mutex_t xmutex_rec; ># 287 "../../../../../../exports/include/X11/Xthreads.h" >typedef xcondition_rec *xcondition_t; >typedef xmutex_rec *xmutex_t; ># 198 "../../../../../../extras/Mesa/src/mesa/glapi/glthread.h" 2 > >typedef struct { > xthread_key_t key; > int initMagic; >} _glthread_TSD; > >typedef xthread_t _glthread_Thread; > >typedef xmutex_rec _glthread_Mutex; ># 295 "../../../../../../extras/Mesa/src/mesa/glapi/glthread.h" >extern unsigned long >_glthread_GetID(void); > > >extern void >_glthread_InitTSD(_glthread_TSD *); > > >extern void * >_glthread_GetTSD(_glthread_TSD *); > > >extern void >_glthread_SetTSD(_glthread_TSD *, void *); > > > >extern struct _glapi_table * _glapi_DispatchTSD; ># 42 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" 2 ># 1 "../../../../../../extras/Mesa/src/mesa/math/m_matrix.h" 1 ># 124 "../../../../../../extras/Mesa/src/mesa/math/m_matrix.h" >enum GLmatrixtype { > MATRIX_GENERAL, > MATRIX_IDENTITY, > MATRIX_3D_NO_ROT, > MATRIX_PERSPECTIVE, > MATRIX_2D, > MATRIX_2D_NO_ROT, > MATRIX_3D >} ; > > > > >typedef struct { > GLfloat *m; > GLfloat *inv; > GLuint flags; > > enum GLmatrixtype type; >} GLmatrix; > > > > >extern void >_math_matrix_ctr( GLmatrix *m ); > >extern void >_math_matrix_dtr( GLmatrix *m ); > >extern void >_math_matrix_alloc_inv( GLmatrix *m ); > >extern void >_math_matrix_mul_matrix( GLmatrix *dest, const GLmatrix *a, const GLmatrix *b ); > >extern void >_math_matrix_mul_floats( GLmatrix *dest, const GLfloat *b ); > >extern void >_math_matrix_loadf( GLmatrix *mat, const GLfloat *m ); > >extern void >_math_matrix_translate( GLmatrix *mat, GLfloat x, GLfloat y, GLfloat z ); > >extern void >_math_matrix_rotate( GLmatrix *m, GLfloat angle, > GLfloat x, GLfloat y, GLfloat z ); > >extern void >_math_matrix_scale( GLmatrix *mat, GLfloat x, GLfloat y, GLfloat z ); > >extern void >_math_matrix_ortho( GLmatrix *mat, > GLfloat left, GLfloat right, > GLfloat bottom, GLfloat top, > GLfloat nearval, GLfloat farval ); > >extern void >_math_matrix_frustum( GLmatrix *mat, > GLfloat left, GLfloat right, > GLfloat bottom, GLfloat top, > GLfloat nearval, GLfloat farval ); > >extern void >_math_matrix_set_identity( GLmatrix *dest ); > >extern void >_math_matrix_copy( GLmatrix *to, const GLmatrix *from ); > >extern void >_math_matrix_analyse( GLmatrix *mat ); > >extern void >_math_matrix_print( const GLmatrix *m ); ># 207 "../../../../../../extras/Mesa/src/mesa/math/m_matrix.h" >extern void >_math_transposef( GLfloat to[16], const GLfloat from[16] ); > >extern void >_math_transposed( GLdouble to[16], const GLdouble from[16] ); > >extern void >_math_transposefd( GLfloat to[16], const GLdouble from[16] ); ># 43 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" 2 > > > > > > > typedef GLubyte GLchan; ># 74 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" > typedef GLshort GLaccum; ># 86 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" > typedef GLubyte GLstencil; ># 101 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >typedef GLuint GLdepth; > > > > > >typedef int GLfixed; ># 140 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct _mesa_HashTable; >struct gl_texture_image; >struct gl_texture_object; >typedef struct __GLcontextRec GLcontext; >typedef struct __GLcontextModesRec GLvisual; >typedef struct gl_frame_buffer GLframebuffer; >struct gl_pixelstore_attrib; >struct gl_texture_format; ># 159 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >enum { > VERT_ATTRIB_POS = 0, > VERT_ATTRIB_WEIGHT = 1, > VERT_ATTRIB_NORMAL = 2, > VERT_ATTRIB_COLOR0 = 3, > VERT_ATTRIB_COLOR1 = 4, > VERT_ATTRIB_FOG = 5, > VERT_ATTRIB_SIX = 6, > VERT_ATTRIB_SEVEN = 7, > VERT_ATTRIB_TEX0 = 8, > VERT_ATTRIB_TEX1 = 9, > VERT_ATTRIB_TEX2 = 10, > VERT_ATTRIB_TEX3 = 11, > VERT_ATTRIB_TEX4 = 12, > VERT_ATTRIB_TEX5 = 13, > VERT_ATTRIB_TEX6 = 14, > VERT_ATTRIB_TEX7 = 15, > VERT_ATTRIB_MAX = 16 >} ; ># 274 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_color_table { > GLenum Format; > GLenum IntFormat; > GLuint Size; > GLvoid *Table; > GLenum Type; > GLubyte RedSize; > GLubyte GreenSize; > GLubyte BlueSize; > GLubyte AlphaSize; > GLubyte LuminanceSize; > GLubyte IntensitySize; >}; ># 356 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_shine_tab { > struct gl_shine_tab *next, *prev; > GLfloat tab[256 +1]; > GLfloat shininess; > GLuint refcount; >}; > > > > > >struct gl_light { > struct gl_light *next; > struct gl_light *prev; > > GLfloat Ambient[4]; > GLfloat Diffuse[4]; > GLfloat Specular[4]; > GLfloat EyePosition[4]; > GLfloat EyeDirection[4]; > GLfloat SpotExponent; > GLfloat SpotCutoff; > GLfloat _CosCutoff; > GLfloat ConstantAttenuation; > GLfloat LinearAttenuation; > GLfloat QuadraticAttenuation; > GLboolean Enabled; > > > > > > GLuint _Flags; > > GLfloat _Position[4]; > GLfloat _VP_inf_norm[3]; > GLfloat _h_inf_norm[3]; > GLfloat _NormDirection[4]; > GLfloat _VP_inf_spot_attenuation; > > GLfloat _SpotExpTable[512][2]; > GLfloat _MatAmbient[2][3]; > GLfloat _MatDiffuse[2][3]; > GLfloat _MatSpecular[2][3]; > GLfloat _dli; > GLfloat _sli; > >}; > > > > > >struct gl_lightmodel { > GLfloat Ambient[4]; > GLboolean LocalViewer; > GLboolean TwoSide; > GLenum ColorControl; > >}; > > > > > >struct gl_material >{ > GLfloat Attrib[12][4]; >}; > > > > > >struct gl_accum_attrib { > GLfloat ClearColor[4]; >}; > > > > > >struct gl_colorbuffer_attrib { > GLuint ClearIndex; > GLclampf ClearColor[4]; > > GLuint IndexMask; > GLubyte ColorMask[4]; > > GLenum DrawBuffer; > GLbitfield _DrawDestMask; > > > > > > GLboolean AlphaEnabled; > GLenum AlphaFunc; > GLclampf AlphaRef; > > > > > > > GLboolean BlendEnabled; > GLenum BlendSrcRGB; > GLenum BlendDstRGB; > GLenum BlendSrcA; > GLenum BlendDstA; > GLenum BlendEquationRGB; > GLenum BlendEquationA; > GLfloat BlendColor[4]; > > > > > > > GLenum LogicOp; > GLboolean IndexLogicOpEnabled; > GLboolean ColorLogicOpEnabled; > GLboolean _LogicOpEnabled; > > > GLboolean DitherFlag; >}; > > > > > >struct gl_current_attrib { > > > > > GLfloat Attrib[VERT_ATTRIB_MAX][4]; > > GLfloat Index; > GLboolean EdgeFlag; ># 506 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" > GLfloat RasterPos[4]; > GLfloat RasterDistance; > GLfloat RasterColor[4]; > GLfloat RasterSecondaryColor[4]; > GLfloat RasterIndex; > GLfloat RasterTexCoords[8][4]; > GLboolean RasterPosValid; > >}; > > > > > >struct gl_depthbuffer_attrib { > GLenum Func; > GLclampd Clear; > GLboolean Test; > GLboolean Mask; > GLboolean OcclusionTest; > GLboolean BoundsTest; > GLfloat BoundsMin, BoundsMax; >}; > > > > > >struct gl_enable_attrib { > GLboolean AlphaTest; > GLboolean AutoNormal; > GLboolean Blend; > GLuint ClipPlanes; > GLboolean ColorMaterial; > GLboolean ColorTable; > GLboolean PostColorMatrixColorTable; > GLboolean PostConvolutionColorTable; > GLboolean Convolution1D; > GLboolean Convolution2D; > GLboolean Separable2D; > GLboolean CullFace; > GLboolean DepthTest; > GLboolean Dither; > GLboolean Fog; > GLboolean Histogram; > GLboolean Light[8]; > GLboolean Lighting; > GLboolean LineSmooth; > GLboolean LineStipple; > GLboolean IndexLogicOp; > GLboolean ColorLogicOp; > GLboolean Map1Color4; > GLboolean Map1Index; > GLboolean Map1Normal; > GLboolean Map1TextureCoord1; > GLboolean Map1TextureCoord2; > GLboolean Map1TextureCoord3; > GLboolean Map1TextureCoord4; > GLboolean Map1Vertex3; > GLboolean Map1Vertex4; > GLboolean Map1Attrib[16]; > GLboolean Map2Color4; > GLboolean Map2Index; > GLboolean Map2Normal; > GLboolean Map2TextureCoord1; > GLboolean Map2TextureCoord2; > GLboolean Map2TextureCoord3; > GLboolean Map2TextureCoord4; > GLboolean Map2Vertex3; > GLboolean Map2Vertex4; > GLboolean Map2Attrib[16]; > GLboolean MinMax; > GLboolean Normalize; > GLboolean PixelTexture; > GLboolean PointSmooth; > GLboolean PolygonOffsetPoint; > GLboolean PolygonOffsetLine; > GLboolean PolygonOffsetFill; > GLboolean PolygonSmooth; > GLboolean PolygonStipple; > GLboolean RescaleNormals; > GLboolean Scissor; > GLboolean Stencil; > GLboolean MultisampleEnabled; > GLboolean SampleAlphaToCoverage; > GLboolean SampleAlphaToOne; > GLboolean SampleCoverage; > GLboolean SampleCoverageInvert; > GLboolean RasterPositionUnclipped; > GLuint Texture[8]; > GLuint TexGen[8]; > > GLboolean TextureColorTable[8]; > > GLboolean VertexProgram; > GLboolean VertexProgramPointSize; > GLboolean VertexProgramTwoSide; > > GLboolean PointSprite; >}; > > > > > >struct gl_eval_attrib { > > > > > GLboolean Map1Color4; > GLboolean Map1Index; > GLboolean Map1Normal; > GLboolean Map1TextureCoord1; > GLboolean Map1TextureCoord2; > GLboolean Map1TextureCoord3; > GLboolean Map1TextureCoord4; > GLboolean Map1Vertex3; > GLboolean Map1Vertex4; > GLboolean Map1Attrib[16]; > GLboolean Map2Color4; > GLboolean Map2Index; > GLboolean Map2Normal; > GLboolean Map2TextureCoord1; > GLboolean Map2TextureCoord2; > GLboolean Map2TextureCoord3; > GLboolean Map2TextureCoord4; > GLboolean Map2Vertex3; > GLboolean Map2Vertex4; > GLboolean Map2Attrib[16]; > GLboolean AutoNormal; > > > > > > > GLint MapGrid1un; > GLfloat MapGrid1u1, MapGrid1u2, MapGrid1du; > GLint MapGrid2un, MapGrid2vn; > GLfloat MapGrid2u1, MapGrid2u2, MapGrid2du; > GLfloat MapGrid2v1, MapGrid2v2, MapGrid2dv; > >}; > > > > > >struct gl_fog_attrib { > GLboolean Enabled; > GLfloat Color[4]; > GLfloat Density; > GLfloat Start; > GLfloat End; > GLfloat Index; > GLenum Mode; > GLboolean ColorSumEnabled; > GLenum FogCoordinateSource; >}; > > > > > > > >struct gl_hint_attrib { > GLenum PerspectiveCorrection; > GLenum PointSmooth; > GLenum LineSmooth; > GLenum PolygonSmooth; > GLenum Fog; > GLenum ClipVolumeClipping; > GLenum TextureCompression; > GLenum GenerateMipmap; >}; > > > > > >struct gl_histogram_attrib { > GLuint Width; > GLint Format; > GLuint Count[256][4]; > GLboolean Sink; > GLubyte RedSize; > GLubyte GreenSize; > GLubyte BlueSize; > GLubyte AlphaSize; > GLubyte LuminanceSize; >}; > > >struct gl_minmax_attrib { > GLenum Format; > GLboolean Sink; > GLfloat Min[4], Max[4]; >}; > > >struct gl_convolution_attrib { > GLenum Format; > GLenum InternalFormat; > GLuint Width; > GLuint Height; > GLfloat Filter[9 * 9 * 4]; >}; ># 725 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_light_attrib { > struct gl_light Light[8]; > struct gl_lightmodel Model; > > > > > > struct gl_material Material; > > > GLboolean Enabled; > GLenum ShadeModel; > GLenum ColorMaterialFace; > GLenum ColorMaterialMode; > GLuint ColorMaterialBitmask; > GLboolean ColorMaterialEnabled; > > struct gl_light EnabledList; > > > > > > GLboolean _NeedEyeCoords; > GLboolean _NeedVertices; > GLuint _Flags; > GLfloat _BaseColor[2][3]; > >}; > > > > > >struct gl_line_attrib { > GLboolean SmoothFlag; > GLboolean StippleFlag; > GLushort StipplePattern; > GLint StippleFactor; > GLfloat Width; > GLfloat _Width; >}; > > >struct gl_list_attrib { > GLuint ListBase; >}; > > >struct gl_list_instruction { > GLuint Size; > void (*Execute)( GLcontext *ctx, void *data ); > void (*Destroy)( GLcontext *ctx, void *data ); > void (*Print)( GLcontext *ctx, void *data ); >}; > > > >struct gl_list_extensions { > struct gl_list_instruction Opcode[16]; > GLuint NumOpcodes; >}; > > >struct gl_multisample_attrib { > GLboolean Enabled; > GLboolean SampleAlphaToCoverage; > GLboolean SampleAlphaToOne; > GLboolean SampleCoverage; > GLfloat SampleCoverageValue; > GLboolean SampleCoverageInvert; >}; > > > > > >struct gl_pixel_attrib { > GLenum ReadBuffer; > GLubyte _ReadSrcMask; > > > > GLfloat RedBias, RedScale; > GLfloat GreenBias, GreenScale; > GLfloat BlueBias, BlueScale; > GLfloat AlphaBias, AlphaScale; > GLfloat DepthBias, DepthScale; > GLint IndexShift, IndexOffset; > GLboolean MapColorFlag; > GLboolean MapStencilFlag; > GLfloat ZoomX, ZoomY; > > GLint MapStoSsize; > GLint MapItoIsize; > GLint MapItoRsize; > GLint MapItoGsize; > GLint MapItoBsize; > GLint MapItoAsize; > GLint MapRtoRsize; > GLint MapGtoGsize; > GLint MapBtoBsize; > GLint MapAtoAsize; > GLint MapStoS[256]; > GLint MapItoI[256]; > GLfloat MapItoR[256]; > GLfloat MapItoG[256]; > GLfloat MapItoB[256]; > GLfloat MapItoA[256]; > GLubyte MapItoR8[256]; > GLubyte MapItoG8[256]; > GLubyte MapItoB8[256]; > GLubyte MapItoA8[256]; > GLfloat MapRtoR[256]; > GLfloat MapGtoG[256]; > GLfloat MapBtoB[256]; > GLfloat MapAtoA[256]; > > GLboolean HistogramEnabled; > GLboolean MinMaxEnabled; > > GLboolean PixelTextureEnabled; > GLenum FragmentRgbSource; > GLenum FragmentAlphaSource; > > GLfloat PostColorMatrixScale[4]; > GLfloat PostColorMatrixBias[4]; > > GLfloat ColorTableScale[4]; > GLfloat ColorTableBias[4]; > GLboolean ColorTableEnabled; > GLfloat PCCTscale[4]; > GLfloat PCCTbias[4]; > GLboolean PostConvolutionColorTableEnabled; > GLfloat PCMCTscale[4]; > GLfloat PCMCTbias[4]; > GLboolean PostColorMatrixColorTableEnabled; > > GLfloat TextureColorTableScale[4]; > GLfloat TextureColorTableBias[4]; > > GLboolean Convolution1DEnabled; > GLboolean Convolution2DEnabled; > GLboolean Separable2DEnabled; > GLfloat ConvolutionBorderColor[3][4]; > GLenum ConvolutionBorderMode[3]; > GLfloat ConvolutionFilterScale[3][4]; > GLfloat ConvolutionFilterBias[3][4]; > GLfloat PostConvolutionScale[4]; > GLfloat PostConvolutionBias[4]; >}; > > > > > >struct gl_point_attrib { > GLboolean SmoothFlag; > GLfloat Size; > GLfloat _Size; > GLfloat Params[3]; > GLfloat MinSize, MaxSize; > GLfloat Threshold; > GLboolean _Attenuated; > GLboolean PointSprite; > GLboolean CoordReplace[8]; > GLenum SpriteRMode; >}; > > > > > >struct gl_polygon_attrib { > GLenum FrontFace; > GLenum FrontMode; > GLenum BackMode; > GLboolean _FrontBit; > GLboolean CullFlag; > GLboolean SmoothFlag; > GLboolean StippleFlag; > GLenum CullFaceMode; > GLfloat OffsetFactor; > GLfloat OffsetUnits; > GLboolean OffsetPoint; > GLboolean OffsetLine; > GLboolean OffsetFill; >}; > > > > > >struct gl_scissor_attrib { > GLboolean Enabled; > GLint X, Y; > GLsizei Width, Height; >}; > > > > > >struct gl_stencil_attrib { > GLboolean Enabled; > GLboolean TestTwoSide; > GLubyte ActiveFace; > GLenum Function[2]; > GLenum FailFunc[2]; > GLenum ZPassFunc[2]; > GLenum ZFailFunc[2]; > GLstencil Ref[2]; > GLstencil ValueMask[2]; > GLstencil WriteMask[2]; > GLstencil Clear; >}; ># 1016 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >typedef void (*FetchTexelFuncC)( const struct gl_texture_image *texImage, > GLint col, GLint row, GLint img, > GLchan *texelOut ); > > > > > > >typedef void (*FetchTexelFuncF)( const struct gl_texture_image *texImage, > GLint col, GLint row, GLint img, > GLfloat *texelOut ); > > > > > > > >typedef GLboolean (*StoreTexImageFunc)(GLcontext *ctx, GLuint dims, > GLenum baseInternalFormat, > const struct gl_texture_format *dstFormat, > GLvoid *dstAddr, > GLint dstXoffset, GLint dstYoffset, GLint dstZoffset, > GLint dstRowStride, GLint dstImageStride, > GLint srcWidth, GLint srcHeight, GLint srcDepth, > GLenum srcFormat, GLenum srcType, > const GLvoid *srcAddr, > const struct gl_pixelstore_attrib *srcPacking); > > > > > > >struct gl_texture_format { > GLint MesaFormat; > > GLenum BaseFormat; > > > > > GLenum DataType; > GLubyte RedBits; > GLubyte GreenBits; > GLubyte BlueBits; > GLubyte AlphaBits; > GLubyte LuminanceBits; > GLubyte IntensityBits; > GLubyte IndexBits; > GLubyte DepthBits; > > GLuint TexelBytes; > > StoreTexImageFunc StoreImage; > > > > > > FetchTexelFuncC FetchTexel1D; > FetchTexelFuncC FetchTexel2D; > FetchTexelFuncC FetchTexel3D; > FetchTexelFuncF FetchTexel1Df; > FetchTexelFuncF FetchTexel2Df; > FetchTexelFuncF FetchTexel3Df; > >}; > > > > > >struct gl_texture_image { > GLenum Format; > > > > > > GLint IntFormat; > GLuint Border; > GLuint Width; > GLuint Height; > GLuint Depth; > GLuint RowStride; > GLuint Width2; > GLuint Height2; > GLuint Depth2; > GLuint WidthLog2; > GLuint HeightLog2; > GLuint DepthLog2; > GLuint MaxLog2; > GLfloat WidthScale; > GLfloat HeightScale; > GLfloat DepthScale; > GLvoid *Data; > GLboolean IsClientData; > GLboolean _IsPowerOfTwo; > > const struct gl_texture_format *TexFormat; > > struct gl_texture_object *TexObject; > > FetchTexelFuncC FetchTexelc; > FetchTexelFuncF FetchTexelf; > > GLboolean IsCompressed; > GLuint CompressedSize; > > > > > > void *DriverData; > >}; ># 1146 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_texture_object { > _glthread_Mutex Mutex; > GLint RefCount; > GLuint Name; > GLenum Target; > GLfloat Priority; > GLfloat BorderColor[4]; > GLchan _BorderChan[4]; > > > > GLenum WrapS; > GLenum WrapT; > GLenum WrapR; > > GLenum MinFilter; > GLenum MagFilter; > GLfloat MinLod; > GLfloat MaxLod; > GLfloat LodBias; > GLint BaseLevel; > GLint MaxLevel; > GLfloat MaxAnisotropy; > GLboolean CompareFlag; > GLenum CompareOperator; > GLfloat ShadowAmbient; > GLenum CompareMode; > GLenum CompareFunc; > GLenum DepthMode; > GLint _MaxLevel; > GLfloat _MaxLambda; > GLboolean GenerateMipmap; > GLboolean _IsPowerOfTwo; > > struct gl_texture_image *Image[6][12]; > > > struct gl_color_table Palette; > > GLboolean Complete; > struct gl_texture_object *Next; > > > > > > void *DriverData; > >}; ># 1203 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_tex_env_combine_state { > GLenum ModeRGB; > GLenum ModeA; > GLenum SourceRGB[3]; > GLenum SourceA[3]; > GLenum OperandRGB[3]; > GLenum OperandA[3]; > GLuint ScaleShiftRGB; > GLuint ScaleShiftA; > GLuint _NumArgsRGB; > GLuint _NumArgsA; >}; > > > > >struct gl_texture_unit { > GLuint Enabled; > GLuint _ReallyEnabled; > > GLenum EnvMode; > GLfloat EnvColor[4]; > GLuint TexGenEnabled; > > > > GLenum GenModeS; > GLenum GenModeT; > GLenum GenModeR; > GLenum GenModeQ; > > GLuint _GenBitS; > GLuint _GenBitT; > GLuint _GenBitR; > GLuint _GenBitQ; > GLuint _GenFlags; > GLfloat ObjectPlaneS[4]; > GLfloat ObjectPlaneT[4]; > GLfloat ObjectPlaneR[4]; > GLfloat ObjectPlaneQ[4]; > GLfloat EyePlaneS[4]; > GLfloat EyePlaneT[4]; > GLfloat EyePlaneR[4]; > GLfloat EyePlaneQ[4]; > GLfloat LodBias; > > > > > struct gl_tex_env_combine_state Combine; > > > > > > struct gl_tex_env_combine_state _EnvMode; > > > > > > struct gl_tex_env_combine_state *_CurrentCombine; > > struct gl_texture_object *Current1D; > struct gl_texture_object *Current2D; > struct gl_texture_object *Current3D; > struct gl_texture_object *CurrentCubeMap; > struct gl_texture_object *CurrentRect; > > struct gl_texture_object *_Current; > > struct gl_texture_object Saved1D; > struct gl_texture_object Saved2D; > struct gl_texture_object Saved3D; > struct gl_texture_object SavedCubeMap; > struct gl_texture_object SavedRect; > > > struct gl_color_table ColorTable; > struct gl_color_table ProxyColorTable; > GLboolean ColorTableEnabled; >}; > > > > > >struct gl_texture_attrib { > > > > > GLuint CurrentUnit; > GLuint _EnabledUnits; > GLuint _EnabledCoordUnits; > GLuint _GenFlags; > GLuint _TexGenEnabled; > GLuint _TexMatEnabled; > > > struct gl_texture_unit Unit[8]; > > struct gl_texture_object *Proxy1D; > struct gl_texture_object *Proxy2D; > struct gl_texture_object *Proxy3D; > struct gl_texture_object *ProxyCubeMap; > struct gl_texture_object *ProxyRect; > > > GLboolean SharedPalette; > struct gl_color_table Palette; >}; > > > > > >struct gl_transform_attrib { > GLenum MatrixMode; > GLfloat EyeUserPlane[6][4]; > GLfloat _ClipUserPlane[6][4]; > GLuint ClipPlanesEnabled; > GLboolean Normalize; > GLboolean RescaleNormals; > GLboolean RasterPositionUnclipped; > > GLboolean CullVertexFlag; > GLfloat CullEyePos[4]; > GLfloat CullObjPos[4]; >}; > > > > > >struct gl_viewport_attrib { > GLint X, Y; > GLsizei Width, Height; > GLfloat Near, Far; > GLmatrix _WindowMap; >}; > > > > > >struct gl_attrib_node { > GLbitfield kind; > void *data; > struct gl_attrib_node *next; >}; > > > > > >struct gl_buffer_object { > GLint RefCount; > GLuint Name; > GLenum Usage; > GLenum Access; > GLvoid *Pointer; > GLuint Size; > GLubyte *Data; > GLboolean OnCard; > GLboolean DeletePending; >}; > > > > > > >struct gl_pixelstore_attrib { > GLint Alignment; > GLint RowLength; > GLint SkipPixels; > GLint SkipRows; > GLint ImageHeight; > GLint SkipImages; > GLboolean SwapBytes; > GLboolean LsbFirst; > GLboolean ClientStorage; > GLboolean Invert; > struct gl_buffer_object *BufferObj; >}; ># 1397 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_client_array { > GLint Size; > GLenum Type; > GLsizei Stride; > GLsizei StrideB; > const GLubyte *Ptr; > GLuint Enabled; > GLboolean Normalized; > > > struct gl_buffer_object *BufferObj; > GLuint _MaxElement; > > GLuint Flags; >}; > > > > > >struct gl_array_attrib { > struct gl_client_array Vertex; > struct gl_client_array Normal; > struct gl_client_array Color; > struct gl_client_array SecondaryColor; > struct gl_client_array FogCoord; > struct gl_client_array Index; > struct gl_client_array TexCoord[8]; > struct gl_client_array EdgeFlag; > > struct gl_client_array VertexAttrib[VERT_ATTRIB_MAX]; > > GLint ActiveTexture; > GLuint LockFirst; > GLuint LockCount; > > GLuint _Enabled; > GLuint NewState; > > > struct gl_buffer_object *NullBufferObj; > struct gl_buffer_object *ArrayBufferObj; > struct gl_buffer_object *ElementArrayBufferObj; > > GLuint _MaxElement; >}; > > >struct gl_feedback { > GLenum Type; > GLuint _Mask; > GLfloat *Buffer; > GLuint BufferSize; > GLuint Count; >}; > > > > > >struct gl_selection { > GLuint *Buffer; > GLuint BufferSize; > GLuint BufferCount; > GLuint Hits; > GLuint NameStackDepth; > GLuint NameStack[64]; > GLboolean HitFlag; > GLfloat HitMinZ; > GLfloat HitMaxZ; >}; > > > > > >struct gl_1d_map >{ > GLuint Order; > GLfloat u1, u2, du; > GLfloat *Points; >}; > > > > > >struct gl_2d_map >{ > GLuint Uorder; > GLuint Vorder; > GLfloat u1, u2, du; > GLfloat v1, v2, dv; > GLfloat *Points; >}; > > > > > >struct gl_evaluators >{ > > > > > struct gl_1d_map Map1Vertex3; > struct gl_1d_map Map1Vertex4; > struct gl_1d_map Map1Index; > struct gl_1d_map Map1Color4; > struct gl_1d_map Map1Normal; > struct gl_1d_map Map1Texture1; > struct gl_1d_map Map1Texture2; > struct gl_1d_map Map1Texture3; > struct gl_1d_map Map1Texture4; > struct gl_1d_map Map1Attrib[16]; > > > > > > > struct gl_2d_map Map2Vertex3; > struct gl_2d_map Map2Vertex4; > struct gl_2d_map Map2Index; > struct gl_2d_map Map2Color4; > struct gl_2d_map Map2Normal; > struct gl_2d_map Map2Texture1; > struct gl_2d_map Map2Texture2; > struct gl_2d_map Map2Texture3; > struct gl_2d_map Map2Texture4; > struct gl_2d_map Map2Attrib[16]; > >}; > > > > > >struct fp_machine >{ > GLfloat Temporaries[96][4]; > GLfloat Inputs[12][4]; > GLfloat Outputs[3][4]; > GLuint CondCodes[4]; >}; > > > > > >enum register_file >{ > PROGRAM_TEMPORARY = 10, > PROGRAM_INPUT, > PROGRAM_OUTPUT, > PROGRAM_LOCAL_PARAM, > PROGRAM_ENV_PARAM, > PROGRAM_NAMED_PARAM, > PROGRAM_STATE_VAR, > PROGRAM_WRITE_ONLY, > PROGRAM_ADDRESS >}; > > > >struct vp_instruction; >struct fp_instruction; > >struct program_parameter_list; > > > > > >struct program >{ > GLuint Id; > GLubyte *String; > GLenum Target; > GLenum Format; > GLint RefCount; > GLboolean Resident; > GLfloat LocalParams[96][4]; > GLuint NumInstructions; > GLuint NumTemporaries; > GLuint NumParameters; > GLuint NumAttributes; > GLuint NumAddressRegs; >}; > > > >struct vertex_program >{ > struct program Base; > struct vp_instruction *Instructions; > GLboolean IsNVProgram; > GLboolean IsPositionInvariant; > GLuint InputsRead; > GLuint OutputsWritten; > struct program_parameter_list *Parameters; >}; > > > >struct fragment_program >{ > struct program Base; > struct fp_instruction *Instructions; > GLuint InputsRead; > GLuint OutputsWritten; > GLuint TexturesUsed[8]; > GLuint NumAluInstructions; > GLuint NumTexInstructions; > GLuint NumTexIndirections; > GLenum FogOption; > struct program_parameter_list *Parameters; > > > > > >}; > > > > > >struct program_state { > GLint ErrorPos; > const char *ErrorString; >}; > > > > > >struct vertex_program_state >{ > GLboolean Enabled; > GLboolean _Enabled; > GLboolean PointSizeEnabled; > GLboolean TwoSideEnabled; > struct vertex_program *Current; > > GLenum TrackMatrix[96 / 4]; > GLenum TrackMatrixTransform[96 / 4]; > > GLfloat Parameters[96][4]; > > GLfloat Temporaries[12][4]; > GLfloat Inputs[16][4]; > GLfloat Outputs[15][4]; > GLint AddressReg[4]; > > > GLprogramcallbackMESA Callback; > GLvoid *CallbackData; > GLboolean CallbackEnabled; > GLuint CurrentPosition; > >}; > > > > > >struct fragment_program_state >{ > GLboolean Enabled; > GLboolean _Enabled; > struct fragment_program *Current; > struct fp_machine Machine; > GLfloat Parameters[64][4]; > > > GLprogramcallbackMESA Callback; > GLvoid *CallbackData; > GLboolean CallbackEnabled; > GLuint CurrentPosition; > >}; > > > > > >struct occlusion_state >{ > GLboolean Active; > GLuint CurrentQueryObject; > GLuint PassedCounter; > struct _mesa_HashTable *QueryObjects; >}; > > > > > >struct gl_shared_state >{ > _glthread_Mutex Mutex; > GLint RefCount; > struct _mesa_HashTable *DisplayList; > struct _mesa_HashTable *TexObjects; > struct gl_texture_object *TexObjectList; > > > > > > struct gl_texture_object *Default1D; > struct gl_texture_object *Default2D; > struct gl_texture_object *Default3D; > struct gl_texture_object *DefaultCubeMap; > struct gl_texture_object *DefaultRect; > > > > > > > struct _mesa_HashTable *Programs; > > struct program *DefaultVertexProgram; > > > struct program *DefaultFragmentProgram; > > > > > struct _mesa_HashTable *BufferObjects; > > > void *DriverData; >}; ># 1745 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct gl_frame_buffer >{ > GLvisual Visual; > > GLuint Width, Height; > > GLboolean UseSoftwareDepthBuffer; > GLboolean UseSoftwareAccumBuffer; > GLboolean UseSoftwareStencilBuffer; > GLboolean UseSoftwareAlphaBuffers; > GLboolean UseSoftwareAuxBuffers; > > > > GLvoid *DepthBuffer; > > > > > GLstencil *Stencil; > > > > > GLaccum *Accum; > > > > > GLchan *FrontLeftAlpha; > GLchan *BackLeftAlpha; > GLchan *FrontRightAlpha; > GLchan *BackRightAlpha; > > > GLchan *AuxBuffers[4]; > > > > > > > > GLint _Xmin; > GLint _Ymin; > GLint _Xmax; > GLint _Ymax; > >}; > > > > > > >struct gl_constants >{ > GLint MaxTextureLevels; > GLint Max3DTextureLevels; > GLint MaxCubeTextureLevels; > GLint MaxTextureRectSize; > GLuint MaxTextureCoordUnits; > GLuint MaxTextureImageUnits; > GLuint MaxTextureUnits; > GLfloat MaxTextureMaxAnisotropy; > GLfloat MaxTextureLodBias; > GLuint MaxArrayLockSize; > GLint SubPixelBits; > GLfloat MinPointSize, MaxPointSize; > GLfloat MinPointSizeAA, MaxPointSizeAA; > GLfloat PointSizeGranularity; > GLfloat MinLineWidth, MaxLineWidth; > GLfloat MinLineWidthAA, MaxLineWidthAA; > GLfloat LineWidthGranularity; > GLuint MaxColorTableSize; > GLuint MaxConvolutionWidth; > GLuint MaxConvolutionHeight; > GLuint MaxClipPlanes; > GLuint MaxLights; > GLfloat MaxShininess; > GLfloat MaxSpotExponent; > > GLuint MaxVertexProgramInstructions; > GLuint MaxVertexProgramAttribs; > GLuint MaxVertexProgramTemps; > GLuint MaxVertexProgramLocalParams; > GLuint MaxVertexProgramEnvParams; > GLuint MaxVertexProgramAddressRegs; > > GLuint MaxFragmentProgramInstructions; > GLuint MaxFragmentProgramAttribs; > GLuint MaxFragmentProgramTemps; > GLuint MaxFragmentProgramLocalParams; > GLuint MaxFragmentProgramEnvParams; > GLuint MaxFragmentProgramAddressRegs; > GLuint MaxFragmentProgramAluInstructions; > GLuint MaxFragmentProgramTexInstructions; > GLuint MaxFragmentProgramTexIndirections; > > GLuint MaxProgramMatrices; > GLuint MaxProgramMatrixStackDepth; > > GLboolean CheckArrayBounds; >}; > > > > > >struct gl_extensions >{ > > > > > > > GLboolean dummy; > GLboolean ARB_depth_texture; > GLboolean ARB_fragment_program; > GLboolean ARB_half_float_pixel; > GLboolean ARB_imaging; > GLboolean ARB_multisample; > GLboolean ARB_multitexture; > GLboolean ARB_occlusion_query; > GLboolean ARB_point_sprite; > GLboolean ARB_shadow; > GLboolean ARB_texture_border_clamp; > GLboolean ARB_texture_compression; > GLboolean ARB_texture_cube_map; > GLboolean ARB_texture_env_combine; > GLboolean ARB_texture_env_crossbar; > GLboolean ARB_texture_env_dot3; > GLboolean ARB_texture_float; > GLboolean ARB_texture_mirrored_repeat; > GLboolean ARB_texture_non_power_of_two; > GLboolean ARB_transpose_matrix; > GLboolean ARB_vertex_buffer_object; > GLboolean ARB_vertex_program; > GLboolean ARB_window_pos; > GLboolean EXT_abgr; > GLboolean EXT_bgra; > GLboolean EXT_blend_color; > GLboolean EXT_blend_equation_separate; > GLboolean EXT_blend_func_separate; > GLboolean EXT_blend_logic_op; > GLboolean EXT_blend_minmax; > GLboolean EXT_blend_subtract; > GLboolean EXT_clip_volume_hint; > GLboolean EXT_cull_vertex; > GLboolean EXT_convolution; > GLboolean EXT_compiled_vertex_array; > GLboolean EXT_copy_texture; > GLboolean EXT_depth_bounds_test; > GLboolean EXT_draw_range_elements; > GLboolean EXT_fog_coord; > GLboolean EXT_histogram; > GLboolean EXT_multi_draw_arrays; > GLboolean EXT_paletted_texture; > GLboolean EXT_packed_pixels; > GLboolean EXT_pixel_buffer_object; > GLboolean EXT_point_parameters; > GLboolean EXT_polygon_offset; > GLboolean EXT_rescale_normal; > GLboolean EXT_shadow_funcs; > GLboolean EXT_secondary_color; > GLboolean EXT_separate_specular_color; > GLboolean EXT_shared_texture_palette; > GLboolean EXT_stencil_wrap; > GLboolean EXT_stencil_two_side; > GLboolean EXT_subtexture; > GLboolean EXT_texture; > GLboolean EXT_texture_object; > GLboolean EXT_texture3D; > GLboolean EXT_texture_compression_s3tc; > GLboolean EXT_texture_env_add; > GLboolean EXT_texture_env_combine; > GLboolean EXT_texture_env_dot3; > GLboolean EXT_texture_filter_anisotropic; > GLboolean EXT_texture_lod_bias; > GLboolean EXT_texture_mirror_clamp; > GLboolean EXT_vertex_array; > GLboolean EXT_vertex_array_set; > > GLboolean APPLE_client_storage; > GLboolean APPLE_packed_pixels; > GLboolean ATI_texture_mirror_once; > GLboolean ATI_texture_env_combine3; > GLboolean HP_occlusion_test; > GLboolean IBM_rasterpos_clip; > GLboolean IBM_multimode_draw_arrays; > GLboolean MESA_pack_invert; > GLboolean MESA_packed_depth_stencil; > GLboolean MESA_program_debug; > GLboolean MESA_resize_buffers; > GLboolean MESA_ycbcr_texture; > GLboolean NV_blend_square; > GLboolean NV_fragment_program; > GLboolean NV_light_max_exponent; > GLboolean NV_point_sprite; > GLboolean NV_texgen_reflection; > GLboolean NV_texture_rectangle; > GLboolean NV_vertex_program; > GLboolean NV_vertex_program1_1; > GLboolean SGI_color_matrix; > GLboolean SGI_color_table; > GLboolean SGI_texture_color_table; > GLboolean SGIS_generate_mipmap; > GLboolean SGIS_pixel_texture; > GLboolean SGIS_texture_edge_clamp; > GLboolean SGIS_texture_lod; > GLboolean SGIX_depth_texture; > GLboolean SGIX_pixel_texture; > GLboolean SGIX_shadow; > GLboolean SGIX_shadow_ambient; > GLboolean TDFX_texture_compression_FXT1; > GLboolean S3_s3tc; > > > const GLubyte *String; >}; > > > > > >struct matrix_stack >{ > GLmatrix *Top; > GLmatrix *Stack; > GLuint Depth; > GLuint MaxDepth; > GLuint DirtyFlag; >}; ># 2146 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >union node; >typedef union node Node; > > > ># 1 "../../../../../../extras/Mesa/src/mesa/main/dd.h" 1 ># 36 "../../../../../../extras/Mesa/src/mesa/main/dd.h" >struct gl_pixelstore_attrib; ># 51 "../../../../../../extras/Mesa/src/mesa/main/dd.h" >struct dd_function_table { > > > > > > > const GLubyte * (*GetString)( GLcontext *ctx, GLenum name ); > > > > > > > > void (*UpdateState)( GLcontext *ctx, GLuint new_state ); > > > > > > > void (*GetBufferSize)( GLframebuffer *buffer, > GLuint *width, GLuint *height ); > > > > > > > > void (*ResizeBuffers)( GLframebuffer *buffer ); > > > > > > > void (*Error)( GLcontext *ctx ); > > > > > void (*Finish)( GLcontext *ctx ); > > > > > void (*Flush)( GLcontext *ctx ); ># 113 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*Clear)( GLcontext *ctx, GLbitfield mask, GLboolean all, > GLint x, GLint y, GLint width, GLint height ); ># 124 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*Accum)( GLcontext *ctx, GLenum op, GLfloat value, > GLint xpos, GLint ypos, GLint width, GLint height ); ># 139 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*DrawPixels)( GLcontext *ctx, > GLint x, GLint y, GLsizei width, GLsizei height, > GLenum format, GLenum type, > const struct gl_pixelstore_attrib *unpack, > const GLvoid *pixels ); > > > > > void (*ReadPixels)( GLcontext *ctx, > GLint x, GLint y, GLsizei width, GLsizei height, > GLenum format, GLenum type, > const struct gl_pixelstore_attrib *unpack, > GLvoid *dest ); > > > > > > > > void (*CopyPixels)( GLcontext *ctx, > GLint srcx, GLint srcy, > GLsizei width, GLsizei height, > GLint dstx, GLint dsty, GLenum type ); > > > > > > > void (*Bitmap)( GLcontext *ctx, > GLint x, GLint y, GLsizei width, GLsizei height, > const struct gl_pixelstore_attrib *unpack, > const GLubyte *bitmap ); ># 189 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > const struct gl_texture_format *(*ChooseTextureFormat)( GLcontext *ctx, > GLint internalFormat, GLenum srcFormat, GLenum srcType ); ># 209 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*TexImage1D)( GLcontext *ctx, GLenum target, GLint level, > GLint internalFormat, > GLint width, GLint border, > GLenum format, GLenum type, const GLvoid *pixels, > const struct gl_pixelstore_attrib *packing, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > > void (*TexImage2D)( GLcontext *ctx, GLenum target, GLint level, > GLint internalFormat, > GLint width, GLint height, GLint border, > GLenum format, GLenum type, const GLvoid *pixels, > const struct gl_pixelstore_attrib *packing, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > > void (*TexImage3D)( GLcontext *ctx, GLenum target, GLint level, > GLint internalFormat, > GLint width, GLint height, GLint depth, GLint border, > GLenum format, GLenum type, const GLvoid *pixels, > const struct gl_pixelstore_attrib *packing, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); ># 264 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*TexSubImage1D)( GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLsizei width, > GLenum format, GLenum type, > const GLvoid *pixels, > const struct gl_pixelstore_attrib *packing, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > > void (*TexSubImage2D)( GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLsizei width, GLsizei height, > GLenum format, GLenum type, > const GLvoid *pixels, > const struct gl_pixelstore_attrib *packing, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > > void (*TexSubImage3D)( GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLint yoffset, GLint zoffset, > GLsizei width, GLsizei height, GLint depth, > GLenum format, GLenum type, > const GLvoid *pixels, > const struct gl_pixelstore_attrib *packing, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > > void (*CopyTexImage1D)( GLcontext *ctx, GLenum target, GLint level, > GLenum internalFormat, GLint x, GLint y, > GLsizei width, GLint border ); > > > > > > > void (*CopyTexImage2D)( GLcontext *ctx, GLenum target, GLint level, > GLenum internalFormat, GLint x, GLint y, > GLsizei width, GLsizei height, GLint border ); > > > > > > > void (*CopyTexSubImage1D)( GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, > GLint x, GLint y, GLsizei width ); > > > > > > void (*CopyTexSubImage2D)( GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLint x, GLint y, > GLsizei width, GLsizei height ); > > > > > > void (*CopyTexSubImage3D)( GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLint yoffset, GLint zoffset, > GLint x, GLint y, > GLsizei width, GLsizei height ); > > > > > > > > GLboolean (*TestProxyTexImage)(GLcontext *ctx, GLenum target, > GLint level, GLint internalFormat, > GLenum format, GLenum type, > GLint width, GLint height, > GLint depth, GLint border); ># 379 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*CompressedTexImage1D)( GLcontext *ctx, GLenum target, > GLint level, GLint internalFormat, > GLsizei width, GLint border, > GLsizei imageSize, const GLvoid *data, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > void (*CompressedTexImage2D)( GLcontext *ctx, GLenum target, > GLint level, GLint internalFormat, > GLsizei width, GLsizei height, GLint border, > GLsizei imageSize, const GLvoid *data, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); > > > > > > void (*CompressedTexImage3D)( GLcontext *ctx, GLenum target, > GLint level, GLint internalFormat, > GLsizei width, GLsizei height, GLsizei depth, > GLint border, > GLsizei imageSize, const GLvoid *data, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage ); ># 426 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*CompressedTexSubImage1D)(GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLsizei width, > GLenum format, > GLsizei imageSize, const GLvoid *data, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage); > > > > > > void (*CompressedTexSubImage2D)(GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLint yoffset, > GLsizei width, GLint height, > GLenum format, > GLsizei imageSize, const GLvoid *data, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage); > > > > > > void (*CompressedTexSubImage3D)(GLcontext *ctx, GLenum target, GLint level, > GLint xoffset, GLint yoffset, GLint zoffset, > GLsizei width, GLint height, GLint depth, > GLenum format, > GLsizei imageSize, const GLvoid *data, > struct gl_texture_object *texObj, > struct gl_texture_image *texImage); > > > > > > GLuint (*CompressedTextureSize)( GLcontext *ctx, GLsizei width, > GLsizei height, GLsizei depth, > GLenum format ); ># 474 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*BindTexture)( GLcontext *ctx, GLenum target, > struct gl_texture_object *tObj ); > > > > > > > struct gl_texture_object * (*NewTextureObject)( GLcontext *ctx, GLuint name, > GLenum target ); > > > > > > > void (*DeleteTexture)( GLcontext *ctx, struct gl_texture_object *tObj ); > > > > > struct gl_texture_image * (*NewTextureImage)( GLcontext *ctx ); > > > > > GLboolean (*IsTextureResident)( GLcontext *ctx, > struct gl_texture_object *t ); > > > > > void (*PrioritizeTexture)( GLcontext *ctx, struct gl_texture_object *t, > GLclampf priority ); > > > > > void (*ActiveTexture)( GLcontext *ctx, GLuint texUnitNumber ); > > > > > > > > void (*UpdateTexturePalette)( GLcontext *ctx, > struct gl_texture_object *tObj ); > > > > > > > > void (*CopyColorTable)( GLcontext *ctx, > GLenum target, GLenum internalformat, > GLint x, GLint y, GLsizei width ); > > void (*CopyColorSubTable)( GLcontext *ctx, > GLenum target, GLsizei start, > GLint x, GLint y, GLsizei width ); > > void (*CopyConvolutionFilter1D)( GLcontext *ctx, GLenum target, > GLenum internalFormat, > GLint x, GLint y, GLsizei width ); > > void (*CopyConvolutionFilter2D)( GLcontext *ctx, GLenum target, > GLenum internalFormat, > GLint x, GLint y, > GLsizei width, GLsizei height ); ># 553 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*BindProgram)(GLcontext *ctx, GLenum target, struct program *prog); > > struct program * (*NewProgram)(GLcontext *ctx, GLenum target, GLuint id); > > void (*DeleteProgram)(GLcontext *ctx, struct program *prog); > > void (*ProgramStringNotify)(GLcontext *ctx, GLenum target, > struct program *prog); > > > > > GLboolean (*IsProgramNative)(GLcontext *ctx, GLenum target, > struct program *prog); ># 582 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*AlphaFunc)(GLcontext *ctx, GLenum func, GLfloat ref); > > void (*BlendColor)(GLcontext *ctx, const GLfloat color[4]); > > void (*BlendEquationSeparate)(GLcontext *ctx, GLenum modeRGB, GLenum modeA); > > void (*BlendFuncSeparate)(GLcontext *ctx, > GLenum sfactorRGB, GLenum dfactorRGB, > GLenum sfactorA, GLenum dfactorA); > > void (*ClearColor)(GLcontext *ctx, const GLfloat color[4]); > > void (*ClearDepth)(GLcontext *ctx, GLclampd d); > > void (*ClearIndex)(GLcontext *ctx, GLuint index); > > void (*ClearStencil)(GLcontext *ctx, GLint s); > > void (*ClipPlane)(GLcontext *ctx, GLenum plane, const GLfloat *equation ); > > void (*ColorMask)(GLcontext *ctx, GLboolean rmask, GLboolean gmask, > GLboolean bmask, GLboolean amask ); > > void (*ColorMaterial)(GLcontext *ctx, GLenum face, GLenum mode); > > void (*CullFace)(GLcontext *ctx, GLenum mode); > > void (*FrontFace)(GLcontext *ctx, GLenum mode); > > void (*DepthFunc)(GLcontext *ctx, GLenum func); > > void (*DepthMask)(GLcontext *ctx, GLboolean flag); > > void (*DepthRange)(GLcontext *ctx, GLclampd nearval, GLclampd farval); > > void (*DrawBuffer)( GLcontext *ctx, GLenum buffer ); > > void (*Enable)(GLcontext *ctx, GLenum cap, GLboolean state); > > void (*Fogfv)(GLcontext *ctx, GLenum pname, const GLfloat *params); > > void (*Hint)(GLcontext *ctx, GLenum target, GLenum mode); > > void (*IndexMask)(GLcontext *ctx, GLuint mask); > > void (*Lightfv)(GLcontext *ctx, GLenum light, > GLenum pname, const GLfloat *params ); > > void (*LightModelfv)(GLcontext *ctx, GLenum pname, const GLfloat *params); > > void (*LineStipple)(GLcontext *ctx, GLint factor, GLushort pattern ); > > void (*LineWidth)(GLcontext *ctx, GLfloat width); > > void (*LogicOpcode)(GLcontext *ctx, GLenum opcode); > void (*PointParameterfv)(GLcontext *ctx, GLenum pname, > const GLfloat *params); > > void (*PointSize)(GLcontext *ctx, GLfloat size); > > void (*PolygonMode)(GLcontext *ctx, GLenum face, GLenum mode); > > void (*PolygonOffset)(GLcontext *ctx, GLfloat factor, GLfloat units); > > void (*PolygonStipple)(GLcontext *ctx, const GLubyte *mask ); > > void (*ReadBuffer)( GLcontext *ctx, GLenum buffer ); > > void (*RenderMode)(GLcontext *ctx, GLenum mode ); > > void (*Scissor)(GLcontext *ctx, GLint x, GLint y, GLsizei w, GLsizei h); > > void (*ShadeModel)(GLcontext *ctx, GLenum mode); > > void (*StencilFunc)(GLcontext *ctx, GLenum func, GLint ref, GLuint mask); > > void (*StencilMask)(GLcontext *ctx, GLuint mask); > > void (*StencilOp)(GLcontext *ctx, GLenum fail, GLenum zfail, GLenum zpass); > void (*ActiveStencilFace)(GLcontext *ctx, GLuint face); > > void (*TexGen)(GLcontext *ctx, GLenum coord, GLenum pname, > const GLfloat *params); > > void (*TexEnv)(GLcontext *ctx, GLenum target, GLenum pname, > const GLfloat *param); > > void (*TexParameter)(GLcontext *ctx, GLenum target, > struct gl_texture_object *texObj, > GLenum pname, const GLfloat *params); > void (*TextureMatrix)(GLcontext *ctx, GLuint unit, const GLmatrix *mat); > > void (*Viewport)(GLcontext *ctx, GLint x, GLint y, GLsizei w, GLsizei h); ># 684 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*VertexPointer)(GLcontext *ctx, GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*NormalPointer)(GLcontext *ctx, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*ColorPointer)(GLcontext *ctx, GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*FogCoordPointer)(GLcontext *ctx, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*IndexPointer)(GLcontext *ctx, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*SecondaryColorPointer)(GLcontext *ctx, GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*TexCoordPointer)(GLcontext *ctx, GLint size, GLenum type, > GLsizei stride, const GLvoid *ptr); > void (*EdgeFlagPointer)(GLcontext *ctx, GLsizei stride, const GLvoid *ptr); > void (*VertexAttribPointer)(GLcontext *ctx, GLuint index, GLint size, > GLenum type, GLsizei stride, const GLvoid *ptr); > void (*LockArraysEXT)( GLcontext *ctx, GLint first, GLsizei count ); > void (*UnlockArraysEXT)( GLcontext *ctx ); ># 713 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > GLboolean (*GetBooleanv)(GLcontext *ctx, GLenum pname, GLboolean *result); > > GLboolean (*GetDoublev)(GLcontext *ctx, GLenum pname, GLdouble *result); > > GLboolean (*GetFloatv)(GLcontext *ctx, GLenum pname, GLfloat *result); > > GLboolean (*GetIntegerv)(GLcontext *ctx, GLenum pname, GLint *result); > > GLboolean (*GetPointerv)(GLcontext *ctx, GLenum pname, GLvoid **result); ># 730 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*BindBuffer)( GLcontext *ctx, GLenum target, > struct gl_buffer_object *obj ); > > struct gl_buffer_object * (*NewBufferObject)( GLcontext *ctx, GLuint buffer, > GLenum target ); > > void (*DeleteBuffer)( GLcontext *ctx, struct gl_buffer_object *obj ); > > void (*BufferData)( GLcontext *ctx, GLenum target, GLsizeiptrARB size, > const GLvoid *data, GLenum usage, > struct gl_buffer_object *obj ); > > void (*BufferSubData)( GLcontext *ctx, GLenum target, GLintptrARB offset, > GLsizeiptrARB size, const GLvoid *data, > struct gl_buffer_object *obj ); > > void (*GetBufferSubData)( GLcontext *ctx, GLenum target, > GLintptrARB offset, GLsizeiptrARB size, > GLvoid *data, struct gl_buffer_object *obj ); > > void * (*MapBuffer)( GLcontext *ctx, GLenum target, GLenum access, > struct gl_buffer_object *obj ); > > GLboolean (*UnmapBuffer)( GLcontext *ctx, GLenum target, > struct gl_buffer_object *obj ); ># 767 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > GLuint NeedValidate; ># 780 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*ValidateTnlModule)( GLcontext *ctx, GLuint new_state ); ># 792 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > GLuint CurrentExecPrimitive; > > > > > > > > GLuint CurrentSavePrimitive; ># 813 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > GLuint NeedFlush; > GLuint SaveNeedFlush; ># 825 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (*FlushVertices)( GLcontext *ctx, GLuint flags ); > void (*SaveFlushVertices)( GLcontext *ctx ); > > > > > > > GLboolean (*NotifySaveBegin)( GLcontext *ctx, GLenum mode ); > > > > > > void (*LightingSpaceChange)( GLcontext *ctx ); > > > > > void (*MakeCurrent)( GLcontext *ctx, GLframebuffer *drawBuffer, > GLframebuffer *readBuffer ); > > > > > > > > void (*NewList)( GLcontext *ctx, GLuint list, GLenum mode ); > > > > > > void (*EndList)( GLcontext *ctx ); > > > > > > > > void (*BeginCallList)( GLcontext *ctx, GLuint list ); > > > > > > void (*EndCallList)( GLcontext *ctx ); > >}; ># 896 "../../../../../../extras/Mesa/src/mesa/main/dd.h" >typedef struct { > > > > > void (* ArrayElement)( GLint ); > void (* Color3f)( GLfloat, GLfloat, GLfloat ); > void (* Color3fv)( const GLfloat * ); > void (* Color4f)( GLfloat, GLfloat, GLfloat, GLfloat ); > void (* Color4fv)( const GLfloat * ); > void (* EdgeFlag)( GLboolean ); > void (* EdgeFlagv)( const GLboolean * ); > void (* EvalCoord1f)( GLfloat ); > void (* EvalCoord1fv)( const GLfloat * ); > void (* EvalCoord2f)( GLfloat, GLfloat ); > void (* EvalCoord2fv)( const GLfloat * ); > void (* EvalPoint1)( GLint ); > void (* EvalPoint2)( GLint, GLint ); > void (* FogCoordfEXT)( GLfloat ); > void (* FogCoordfvEXT)( const GLfloat * ); > void (* Indexf)( GLfloat ); > void (* Indexfv)( const GLfloat * ); > void (* Materialfv)( GLenum face, GLenum pname, const GLfloat * ); > void (* MultiTexCoord1fARB)( GLenum, GLfloat ); > void (* MultiTexCoord1fvARB)( GLenum, const GLfloat * ); > void (* MultiTexCoord2fARB)( GLenum, GLfloat, GLfloat ); > void (* MultiTexCoord2fvARB)( GLenum, const GLfloat * ); > void (* MultiTexCoord3fARB)( GLenum, GLfloat, GLfloat, GLfloat ); > void (* MultiTexCoord3fvARB)( GLenum, const GLfloat * ); > void (* MultiTexCoord4fARB)( GLenum, GLfloat, GLfloat, GLfloat, GLfloat ); > void (* MultiTexCoord4fvARB)( GLenum, const GLfloat * ); > void (* Normal3f)( GLfloat, GLfloat, GLfloat ); > void (* Normal3fv)( const GLfloat * ); > void (* SecondaryColor3fEXT)( GLfloat, GLfloat, GLfloat ); > void (* SecondaryColor3fvEXT)( const GLfloat * ); > void (* TexCoord1f)( GLfloat ); > void (* TexCoord1fv)( const GLfloat * ); > void (* TexCoord2f)( GLfloat, GLfloat ); > void (* TexCoord2fv)( const GLfloat * ); > void (* TexCoord3f)( GLfloat, GLfloat, GLfloat ); > void (* TexCoord3fv)( const GLfloat * ); > void (* TexCoord4f)( GLfloat, GLfloat, GLfloat, GLfloat ); > void (* TexCoord4fv)( const GLfloat * ); > void (* Vertex2f)( GLfloat, GLfloat ); > void (* Vertex2fv)( const GLfloat * ); > void (* Vertex3f)( GLfloat, GLfloat, GLfloat ); > void (* Vertex3fv)( const GLfloat * ); > void (* Vertex4f)( GLfloat, GLfloat, GLfloat, GLfloat ); > void (* Vertex4fv)( const GLfloat * ); > void (* CallList)( GLuint ); > void (* CallLists)( GLsizei, GLenum, const GLvoid * ); > void (* Begin)( GLenum ); > void (* End)( void ); > void (* VertexAttrib1fNV)( GLuint index, GLfloat x ); > void (* VertexAttrib1fvNV)( GLuint index, const GLfloat *v ); > void (* VertexAttrib2fNV)( GLuint index, GLfloat x, GLfloat y ); > void (* VertexAttrib2fvNV)( GLuint index, const GLfloat *v ); > void (* VertexAttrib3fNV)( GLuint index, GLfloat x, GLfloat y, GLfloat z ); > void (* VertexAttrib3fvNV)( GLuint index, const GLfloat *v ); > void (* VertexAttrib4fNV)( GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w ); > void (* VertexAttrib4fvNV)( GLuint index, const GLfloat *v ); > > > > > void (* Rectf)( GLfloat, GLfloat, GLfloat, GLfloat ); > > > > > > void (* DrawArrays)( GLenum mode, GLint start, GLsizei count ); > void (* DrawElements)( GLenum mode, GLsizei count, GLenum type, > const GLvoid *indices ); > void (* DrawRangeElements)( GLenum mode, GLuint start, > GLuint end, GLsizei count, > GLenum type, const GLvoid *indices ); ># 986 "../../../../../../extras/Mesa/src/mesa/main/dd.h" > void (* EvalMesh1)( GLenum mode, GLint i1, GLint i2 ); > void (* EvalMesh2)( GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2 ); > > >} GLvertexformat; ># 2152 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" 2 > > > > > > > >struct gl_tnl_module { > > > > const GLvertexformat *Current; > > > > > > > void *Swapped[(sizeof(GLvertexformat) / sizeof(void *))][2]; > GLuint SwapCount; > >}; > >struct mesa_list_state { > GLuint CallDepth; > Node *CurrentListPtr; > GLuint CurrentListNum; > Node *CurrentBlock; > GLuint CurrentPos; > GLvertexformat ListVtxfmt; > > GLubyte ActiveAttribSize[VERT_ATTRIB_MAX]; > GLfloat CurrentAttrib[VERT_ATTRIB_MAX][4]; > > GLubyte ActiveMaterialSize[12]; > GLfloat CurrentMaterial[12][4]; > > GLubyte ActiveIndex; > GLfloat CurrentIndex; > > GLubyte ActiveEdgeFlag; > GLboolean CurrentEdgeFlag; >}; ># 2205 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >struct __GLcontextRec { > > > > > > > > __GLimports imports; > __GLexports exports; > > > > struct gl_shared_state *Shared; > > > > struct _glapi_table *Save; > struct _glapi_table *Exec; > struct _glapi_table *CurrentDispatch; > > > GLvisual Visual; > GLframebuffer *DrawBuffer; > GLframebuffer *ReadBuffer; > > > > > struct dd_function_table Driver; > > void *DriverCtx; > void *DriverMgrCtx; > > > struct gl_constants Const; > > > > struct matrix_stack ModelviewMatrixStack; > struct matrix_stack ProjectionMatrixStack; > struct matrix_stack ColorMatrixStack; > struct matrix_stack TextureMatrixStack[8]; > struct matrix_stack ProgramMatrixStack[8]; > struct matrix_stack *CurrentStack; > > > > GLmatrix _ModelProjectMatrix; > > > struct mesa_list_state ListState; > > GLboolean ExecuteFlag; > GLboolean CompileFlag; > > > struct gl_extensions Extensions; > > > > GLuint AttribStackDepth; > struct gl_attrib_node *AttribStack[16]; ># 2276 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" > struct gl_accum_attrib Accum; > struct gl_colorbuffer_attrib Color; > struct gl_current_attrib Current; > struct gl_depthbuffer_attrib Depth; > struct gl_eval_attrib Eval; > struct gl_fog_attrib Fog; > struct gl_hint_attrib Hint; > struct gl_light_attrib Light; > struct gl_line_attrib Line; > struct gl_list_attrib List; > struct gl_multisample_attrib Multisample; > struct gl_pixel_attrib Pixel; > struct gl_point_attrib Point; > struct gl_polygon_attrib Polygon; > GLuint PolygonStipple[32]; > struct gl_scissor_attrib Scissor; > struct gl_stencil_attrib Stencil; > struct gl_texture_attrib Texture; > struct gl_transform_attrib Transform; > struct gl_viewport_attrib Viewport; > > > > > struct gl_histogram_attrib Histogram; > struct gl_minmax_attrib MinMax; > struct gl_convolution_attrib Convolution1D; > struct gl_convolution_attrib Convolution2D; > struct gl_convolution_attrib Separable2D; > > > > > GLuint ClientAttribStackDepth; > struct gl_attrib_node *ClientAttribStack[16]; > > > > > struct gl_array_attrib Array; > struct gl_pixelstore_attrib Pack; > struct gl_pixelstore_attrib Unpack; > struct gl_pixelstore_attrib DefaultPacking; > > struct gl_evaluators EvalMap; > struct gl_feedback Feedback; > struct gl_selection Select; > > struct gl_color_table ColorTable; > struct gl_color_table ProxyColorTable; > struct gl_color_table PostConvolutionColorTable; > struct gl_color_table ProxyPostConvolutionColorTable; > struct gl_color_table PostColorMatrixColorTable; > struct gl_color_table ProxyPostColorMatrixColorTable; > > struct program_state Program; > struct vertex_program_state VertexProgram; > struct fragment_program_state FragmentProgram; > > struct occlusion_state Occlusion; > > GLenum ErrorValue; > GLenum RenderMode; > GLuint NewState; > > > > > GLuint _TriangleCaps; > GLuint _ImageTransferState; > GLfloat _EyeZDir[3]; > GLfloat _ModelViewInvScale; > GLuint _NeedEyeCoords; > GLuint _ForceEyeCoords; > GLboolean _RotateMode; > GLenum _CurrentProgram; > > struct gl_shine_tab *_ShineTable[2]; > struct gl_shine_tab *_ShineTabList; > > > struct gl_list_extensions ListExt; > > > GLboolean OcclusionResult; > GLboolean OcclusionResultSaved; > GLuint _Facing; > > > > > > > > GLuint DepthMax; > GLfloat DepthMaxF; > GLfloat MRD; > > > > > GLboolean ClampFragmentColors; > GLboolean ClampVertexColors; > > > > > GLboolean FirstTimeCurrent; > > > > GLboolean NoDither; > > > struct gl_tnl_module TnlModule; > > > > > > > > void *swrast_context; > void *swsetup_context; > void *swtnl_context; > void *swtnl_im; > void *acache_context; > void *aelt_context; > >}; > > > >extern const char *_mesa_prim_name[0x0009 +4]; ># 2426 "../../../../../../extras/Mesa/src/mesa/main/mtypes.h" >enum _verbose { > VERBOSE_VARRAY = 0x0001, > VERBOSE_TEXTURE = 0x0002, > VERBOSE_IMMEDIATE = 0x0004, > VERBOSE_PIPELINE = 0x0008, > VERBOSE_DRIVER = 0x0010, > VERBOSE_STATE = 0x0020, > VERBOSE_API = 0x0040, > VERBOSE_DISPLAY_LIST = 0x0100, > VERBOSE_LIGHTING = 0x0200, > VERBOSE_PRIMS = 0x0400, > VERBOSE_VERTS = 0x0800 >}; > > >enum _debug { > DEBUG_ALWAYS_FLUSH = 0x1 >}; ># 10 "gamma_texmem.c" 2 ># 1 "../../../../../../extras/Mesa/src/mesa/main/simple_list.h" 1 ># 11 "gamma_texmem.c" 2 ># 1 "../../../../../../extras/Mesa/src/mesa/main/enums.h" 1 ># 42 "../../../../../../extras/Mesa/src/mesa/main/enums.h" >extern const char *_mesa_lookup_enum_by_nr( int nr ); >extern int _mesa_lookup_enum_by_name( const char *symbol ); ># 12 "gamma_texmem.c" 2 > ># 1 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/mm.h" 1 ># 28 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/mm.h" >struct mem_block_t { > struct mem_block_t *next; > struct mem_block_t *heap; > int ofs,size; > int align; > int free:1; > int reserved:1; >}; >typedef struct mem_block_t TMemBlock; >typedef struct mem_block_t *PMemBlock; > > >typedef struct mem_block_t memHeap_t; > >static __inline__ int mmBlockSize(PMemBlock b) >{ return b->size; } > >static __inline__ int mmOffset(PMemBlock b) >{ return b->ofs; } > > > > > >memHeap_t *mmInit( int ofs, int size ); ># 64 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/mm.h" >PMemBlock mmAllocMem( memHeap_t *heap, int size, int align2, > int startSearch ); > > > > > > >int mmFreeMem( PMemBlock b ); > > > > >void mmDestroy( memHeap_t *mmInit ); > > >void mmDumpMemInfo( memHeap_t *mmInit ); ># 14 "gamma_texmem.c" 2 ># 1 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_dri.h" 1 ># 39 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_dri.h" ># 1 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" 1 ># 39 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" ># 1 "../../../../../../extras/drm/shared/drm.h" 1 ># 41 "../../../../../../extras/drm/shared/drm.h" ># 1 "/usr/include/linux/config.h" 1 3 4 > > > ># 1 "/usr/include/linux/autoconf.h" 1 3 4 ># 5 "/usr/include/linux/config.h" 2 3 4 ># 42 "../../../../../../extras/drm/shared/drm.h" 2 ># 1 "/usr/include/asm/ioctl.h" 1 3 4 ># 43 "../../../../../../extras/drm/shared/drm.h" 2 ># 104 "../../../../../../extras/drm/shared/drm.h" >typedef unsigned long drm_handle_t; >typedef unsigned int drm_context_t; >typedef unsigned int drm_drawable_t; >typedef unsigned int drm_magic_t; ># 119 "../../../../../../extras/drm/shared/drm.h" >typedef struct drm_clip_rect { > unsigned short x1; > unsigned short y1; > unsigned short x2; > unsigned short y2; >} drm_clip_rect_t; > > > > > >typedef struct drm_tex_region { > unsigned char next; > unsigned char prev; > unsigned char in_use; > unsigned char padding; > unsigned int age; >} drm_tex_region_t; ># 145 "../../../../../../extras/drm/shared/drm.h" >typedef struct drm_hw_lock { > __volatile__ unsigned int lock; > char padding[60]; >} drm_hw_lock_t; ># 172 "../../../../../../extras/drm/shared/drm.h" >typedef struct drm_version { > int version_major; > int version_minor; > int version_patchlevel; > unsigned int name_len; > char *name; > unsigned int date_len; > char *date; > unsigned int desc_len; > char *desc; >} drm_version_t; > > > > > > > >typedef struct drm_unique { > unsigned int unique_len; > char *unique; >} drm_unique_t; > > > >typedef struct drm_list { > int count; > drm_version_t *version; >} drm_list_t; > > >typedef struct drm_block { > int unused; >} drm_block_t; > > > > > > > >typedef struct drm_control { > enum { > DRM_ADD_COMMAND, > DRM_RM_COMMAND, > DRM_INST_HANDLER, > DRM_UNINST_HANDLER > } func; > int irq; >} drm_control_t; > > > > > >typedef enum drm_map_type { > _DRM_FRAME_BUFFER = 0, > _DRM_REGISTERS = 1, > _DRM_SHM = 2, > _DRM_AGP = 3, > _DRM_SCATTER_GATHER = 4 >} drm_map_type_t; > > > > > >typedef enum drm_map_flags { > _DRM_RESTRICTED = 0x01, > _DRM_READ_ONLY = 0x02, > _DRM_LOCKED = 0x04, > _DRM_KERNEL = 0x08, > _DRM_WRITE_COMBINING = 0x10, > _DRM_CONTAINS_LOCK = 0x20, > _DRM_REMOVABLE = 0x40 >} drm_map_flags_t; > > >typedef struct drm_ctx_priv_map { > unsigned int ctx_id; > void *handle; >} drm_ctx_priv_map_t; ># 262 "../../../../../../extras/drm/shared/drm.h" >typedef struct drm_map { > unsigned long offset; > unsigned long size; > drm_map_type_t type; > drm_map_flags_t flags; > void *handle; > > int mtrr; > >} drm_map_t; > > > > > >typedef struct drm_client { > int idx; > int auth; > unsigned long pid; > unsigned long uid; > unsigned long magic; > unsigned long iocs; >} drm_client_t; > > >typedef enum { > _DRM_STAT_LOCK, > _DRM_STAT_OPENS, > _DRM_STAT_CLOSES, > _DRM_STAT_IOCTLS, > _DRM_STAT_LOCKS, > _DRM_STAT_UNLOCKS, > _DRM_STAT_VALUE, > _DRM_STAT_BYTE, > _DRM_STAT_COUNT, > > _DRM_STAT_IRQ, > _DRM_STAT_PRIMARY, > _DRM_STAT_SECONDARY, > _DRM_STAT_DMA, > _DRM_STAT_SPECIAL, > _DRM_STAT_MISSED > > >} drm_stat_type_t; > > > > > >typedef struct drm_stats { > unsigned long count; > struct { > unsigned long value; > drm_stat_type_t type; > } data[15]; >} drm_stats_t; > > > > > >typedef enum drm_lock_flags { > _DRM_LOCK_READY = 0x01, > _DRM_LOCK_QUIESCENT = 0x02, > _DRM_LOCK_FLUSH = 0x04, > _DRM_LOCK_FLUSH_ALL = 0x08, > > > > _DRM_HALT_ALL_QUEUES = 0x10, > _DRM_HALT_CUR_QUEUES = 0x20 >} drm_lock_flags_t; > > > > > > > >typedef struct drm_lock { > int context; > drm_lock_flags_t flags; >} drm_lock_t; ># 356 "../../../../../../extras/drm/shared/drm.h" >typedef enum drm_dma_flags { > > _DRM_DMA_BLOCK = 0x01, ># 368 "../../../../../../extras/drm/shared/drm.h" > _DRM_DMA_WHILE_LOCKED = 0x02, > _DRM_DMA_PRIORITY = 0x04, > > > _DRM_DMA_WAIT = 0x10, > _DRM_DMA_SMALLER_OK = 0x20, > _DRM_DMA_LARGER_OK = 0x40 >} drm_dma_flags_t; > > > > > > > >typedef struct drm_buf_desc { > int count; > int size; > int low_mark; > int high_mark; > enum { > _DRM_PAGE_ALIGN = 0x01, > _DRM_AGP_BUFFER = 0x02, > _DRM_SG_BUFFER = 0x04 > } flags; > unsigned long agp_start; > > > >} drm_buf_desc_t; > > > > > >typedef struct drm_buf_info { > int count; > drm_buf_desc_t *list; >} drm_buf_info_t; > > > > > >typedef struct drm_buf_free { > int count; > int *list; >} drm_buf_free_t; > > > > > > > >typedef struct drm_buf_pub { > int idx; > int total; > int used; > void *address; >} drm_buf_pub_t; > > > > > >typedef struct drm_buf_map { > int count; > void *virtual; > drm_buf_pub_t *list; >} drm_buf_map_t; ># 448 "../../../../../../extras/drm/shared/drm.h" >typedef struct drm_dma { > int context; > int send_count; > int *send_indices; > int *send_sizes; > drm_dma_flags_t flags; > int request_count; > int request_size; > int *request_indices; > int *request_sizes; > int granted_count; >} drm_dma_t; > > >typedef enum { > _DRM_CONTEXT_PRESERVED = 0x01, > _DRM_CONTEXT_2DONLY = 0x02 >} drm_ctx_flags_t; > > > > > > > >typedef struct drm_ctx { > drm_context_t handle; > drm_ctx_flags_t flags; >} drm_ctx_t; > > > > > >typedef struct drm_ctx_res { > int count; > drm_ctx_t *contexts; >} drm_ctx_res_t; > > > > > >typedef struct drm_draw { > drm_drawable_t handle; >} drm_draw_t; > > > > > >typedef struct drm_auth { > drm_magic_t magic; >} drm_auth_t; > > > > > > > >typedef struct drm_irq_busid { > int irq; > int busnum; > int devnum; > int funcnum; >} drm_irq_busid_t; > > >typedef enum { > _DRM_VBLANK_ABSOLUTE = 0x0, > _DRM_VBLANK_RELATIVE = 0x1, > _DRM_VBLANK_SIGNAL = 0x40000000 >} drm_vblank_seq_type_t; > > > > > >struct drm_wait_vblank_request { > drm_vblank_seq_type_t type; > unsigned int sequence; > unsigned long signal; >}; > > >struct drm_wait_vblank_reply { > drm_vblank_seq_type_t type; > unsigned int sequence; > long tval_sec; > long tval_usec; >}; > > > > > > > >typedef union drm_wait_vblank { > struct drm_wait_vblank_request request; > struct drm_wait_vblank_reply reply; >} drm_wait_vblank_t; > > > > > > > >typedef struct drm_agp_mode { > unsigned long mode; >} drm_agp_mode_t; > > > > > > > >typedef struct drm_agp_buffer { > unsigned long size; > unsigned long handle; > unsigned long type; > unsigned long physical; >} drm_agp_buffer_t; > > > > > > > >typedef struct drm_agp_binding { > unsigned long handle; > unsigned long offset; >} drm_agp_binding_t; ># 594 "../../../../../../extras/drm/shared/drm.h" >typedef struct drm_agp_info { > int agp_version_major; > int agp_version_minor; > unsigned long mode; > unsigned long aperture_base; > unsigned long aperture_size; > unsigned long memory_allowed; > unsigned long memory_used; > > > unsigned short id_vendor; > unsigned short id_device; >} drm_agp_info_t; > > > > > >typedef struct drm_scatter_gather { > unsigned long size; > unsigned long handle; >} drm_scatter_gather_t; > > > > >typedef struct drm_set_version { > int drm_di_major; > int drm_di_minor; > int drm_dd_major; > int drm_dd_minor; >} drm_set_version_t; ># 40 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" 2 ># 61 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" >typedef unsigned int drmSize, *drmSizePtr; >typedef void *drmAddress, **drmAddressPtr; > > > > > > >typedef struct _drmVersion { > int version_major; > int version_minor; > int version_patchlevel; > int name_len; > char *name; > int date_len; > char *date; > int desc_len; > char *desc; >} drmVersion, *drmVersionPtr; > >typedef struct _drmStats { > unsigned long count; > struct { > unsigned long value; > const char *long_format; > const char *long_name; > const char *rate_format; > const char *rate_name; > int isvalue; > const char *mult_names; > int mult; > int verbose; > } data[15]; >} drmStatsT; > > > > > > > >typedef enum { > DRM_FRAME_BUFFER = 0, > DRM_REGISTERS = 1, > DRM_SHM = 2, > DRM_AGP = 3, > DRM_SCATTER_GATHER = 4 >} drmMapType; > >typedef enum { > DRM_RESTRICTED = 0x0001, > DRM_READ_ONLY = 0x0002, > DRM_LOCKED = 0x0004, > DRM_KERNEL = 0x0008, > DRM_WRITE_COMBINING = 0x0010, > DRM_CONTAINS_LOCK = 0x0020, > DRM_REMOVABLE = 0x0040 >} drmMapFlags; > > > > >typedef enum { > > > DRM_DMA_BLOCK = 0x01, ># 135 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" > DRM_DMA_WHILE_LOCKED = 0x02, > DRM_DMA_PRIORITY = 0x04, > > > > > DRM_DMA_WAIT = 0x10, > DRM_DMA_SMALLER_OK = 0x20, > DRM_DMA_LARGER_OK = 0x40 > >} drmDMAFlags; > >typedef enum { > DRM_PAGE_ALIGN = 0x01, > DRM_AGP_BUFFER = 0x02, > DRM_SG_BUFFER = 0x04 >} drmBufDescFlags; > >typedef enum { > DRM_LOCK_READY = 0x01, > DRM_LOCK_QUIESCENT = 0x02, > DRM_LOCK_FLUSH = 0x04, > DRM_LOCK_FLUSH_ALL = 0x08, > > > > DRM_HALT_ALL_QUEUES = 0x10, > DRM_HALT_CUR_QUEUES = 0x20 >} drmLockFlags; > >typedef enum { > DRM_CONTEXT_PRESERVED = 0x01, > > DRM_CONTEXT_2DONLY = 0x02 >} drm_context_tFlags, *drm_context_tFlagsPtr; > >typedef struct _drmBufDesc { > int count; > int size; > int low_mark; > int high_mark; >} drmBufDesc, *drmBufDescPtr; > >typedef struct _drmBufInfo { > int count; > drmBufDescPtr list; >} drmBufInfo, *drmBufInfoPtr; > >typedef struct _drmBuf { > int idx; > int total; > int used; > drmAddress address; >} drmBuf, *drmBufPtr; > > > > > > > >typedef struct _drmBufMap { > int count; > drmBufPtr list; >} drmBufMap, *drmBufMapPtr; > >typedef struct _drmLock { > volatile unsigned int lock; > char padding[60]; ># 215 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" >} drmLock, *drmLockPtr; > > > > > >typedef struct _drmDMAReq { > drm_context_t context; > int send_count; > int *send_list; > int *send_sizes; > drmDMAFlags flags; > int request_count; > int request_size; > int *request_list; > int *request_sizes; > int granted_count; >} drmDMAReq, *drmDMAReqPtr; > >typedef struct _drmRegion { > drm_handle_t handle; > unsigned int offset; > drmSize size; > drmAddress map; >} drmRegion, *drmRegionPtr; > >typedef struct _drmTextureRegion { > unsigned char next; > unsigned char prev; > unsigned char in_use; > unsigned char padding; > unsigned int age; >} drmTextureRegion, *drmTextureRegionPtr; > > >typedef enum { > DRM_VBLANK_ABSOLUTE = 0x0, > DRM_VBLANK_RELATIVE = 0x1, > DRM_VBLANK_SIGNAL = 0x40000000 >} drmVBlankSeqType; > >typedef struct _drmVBlankReq { > drmVBlankSeqType type; > unsigned int sequence; > unsigned long signal; >} drmVBlankReq, *drmVBlankReqPtr; > >typedef struct _drmVBlankReply { > drmVBlankSeqType type; > unsigned int sequence; > long tval_sec; > long tval_usec; >} drmVBlankReply, *drmVBlankReplyPtr; > >typedef union _drmVBlank { > drmVBlankReq request; > drmVBlankReply reply; >} drmVBlank, *drmVBlankPtr; > >typedef struct _drmSetVersion { > int drm_di_major; > int drm_di_minor; > int drm_dd_major; > int drm_dd_minor; >} drmSetVersion, *drmSetVersionPtr; ># 486 "../../../../../../programs/Xserver/hw/xfree86/os-support/xf86drm.h" >extern int drmAvailable(void); >extern int drmOpen(const char *name, const char *busid); >extern int drmClose(int fd); >extern drmVersionPtr drmGetVersion(int fd); >extern drmVersionPtr drmGetLibVersion(int fd); >extern void drmFreeVersion(drmVersionPtr); >extern int drmGetMagic(int fd, drm_magic_t * magic); >extern char *drmGetBusid(int fd); >extern int drmGetInterruptFromBusID(int fd, int busnum, int devnum, > int funcnum); >extern int drmGetMap(int fd, int idx, drm_handle_t *offset, > drmSize *size, drmMapType *type, > drmMapFlags *flags, drm_handle_t *handle, > int *mtrr); >extern int drmGetClient(int fd, int idx, int *auth, int *pid, > int *uid, unsigned long *magic, > unsigned long *iocs); >extern int drmGetStats(int fd, drmStatsT *stats); >extern int drmSetInterfaceVersion(int fd, drmSetVersion *version); >extern int drmCommandNone(int fd, unsigned long drmCommandIndex); >extern int drmCommandRead(int fd, unsigned long drmCommandIndex, > void *data, unsigned long size); >extern int drmCommandWrite(int fd, unsigned long drmCommandIndex, > void *data, unsigned long size); >extern int drmCommandWriteRead(int fd, unsigned long drmCommandIndex, > void *data, unsigned long size); > > >extern void drmFreeBusid(const char *busid); >extern int drmSetBusid(int fd, const char *busid); >extern int drmAuthMagic(int fd, drm_magic_t magic); >extern int drmAddMap(int fd, > drm_handle_t offset, > drmSize size, > drmMapType type, > drmMapFlags flags, > drm_handle_t * handle); >extern int drmRmMap(int fd, drm_handle_t handle); >extern int drmAddContextPrivateMapping(int fd, drm_context_t ctx_id, > drm_handle_t handle); > >extern int drmAddBufs(int fd, int count, int size, > drmBufDescFlags flags, > int agp_offset); >extern int drmMarkBufs(int fd, double low, double high); >extern int drmCreateContext(int fd, drm_context_t * handle); >extern int drmSetContextFlags(int fd, drm_context_t context, > drm_context_tFlags flags); >extern int drmGetContextFlags(int fd, drm_context_t context, > drm_context_tFlagsPtr flags); >extern int drmAddContextTag(int fd, drm_context_t context, void *tag); >extern int drmDelContextTag(int fd, drm_context_t context); >extern void *drmGetContextTag(int fd, drm_context_t context); >extern drm_context_t * drmGetReservedContextList(int fd, int *count); >extern void drmFreeReservedContextList(drm_context_t *); >extern int drmSwitchToContext(int fd, drm_context_t context); >extern int drmDestroyContext(int fd, drm_context_t handle); >extern int drmCreateDrawable(int fd, drm_drawable_t * handle); >extern int drmDestroyDrawable(int fd, drm_drawable_t handle); >extern int drmCtlInstHandler(int fd, int irq); >extern int drmCtlUninstHandler(int fd); >extern int drmInstallSIGIOHandler(int fd, > void (*f)(int fd, > void *oldctx, > void *newctx)); >extern int drmRemoveSIGIOHandler(int fd); > > >extern int drmMap(int fd, > drm_handle_t handle, > drmSize size, > drmAddressPtr address); >extern int drmUnmap(drmAddress address, drmSize size); >extern drmBufInfoPtr drmGetBufInfo(int fd); >extern drmBufMapPtr drmMapBufs(int fd); >extern int drmUnmapBufs(drmBufMapPtr bufs); >extern int drmDMA(int fd, drmDMAReqPtr request); >extern int drmFreeBufs(int fd, int count, int *list); >extern int drmGetLock(int fd, > drm_context_t context, > drmLockFlags flags); >extern int drmUnlock(int fd, drm_context_t context); >extern int drmFinish(int fd, int context, drmLockFlags flags); >extern int drmGetContextPrivateMapping(int fd, drm_context_t ctx_id, > drm_handle_t * handle); > > >extern int drmAgpAcquire(int fd); >extern int drmAgpRelease(int fd); >extern int drmAgpEnable(int fd, unsigned long mode); >extern int drmAgpAlloc(int fd, unsigned long size, > unsigned long type, unsigned long *address, > unsigned long *handle); >extern int drmAgpFree(int fd, unsigned long handle); >extern int drmAgpBind(int fd, unsigned long handle, > unsigned long offset); >extern int drmAgpUnbind(int fd, unsigned long handle); > > >extern int drmAgpVersionMajor(int fd); >extern int drmAgpVersionMinor(int fd); >extern unsigned long drmAgpGetMode(int fd); >extern unsigned long drmAgpBase(int fd); >extern unsigned long drmAgpSize(int fd); >extern unsigned long drmAgpMemoryUsed(int fd); >extern unsigned long drmAgpMemoryAvail(int fd); >extern unsigned int drmAgpVendorId(int fd); >extern unsigned int drmAgpDeviceId(int fd); > > >extern int drmScatterGatherAlloc(int fd, unsigned long size, > unsigned long *handle); >extern int drmScatterGatherFree(int fd, unsigned long handle); > >extern int drmWaitVBlank(int fd, drmVBlankPtr vbl); > > >extern int drmError(int err, const char *label); >extern void *drmMalloc(int size); >extern void drmFree(void *pt); > > >extern void *drmHashCreate(void); >extern int drmHashDestroy(void *t); >extern int drmHashLookup(void *t, unsigned long key, void **value); >extern int drmHashInsert(void *t, unsigned long key, void *value); >extern int drmHashDelete(void *t, unsigned long key); >extern int drmHashFirst(void *t, unsigned long *key, void **value); >extern int drmHashNext(void *t, unsigned long *key, void **value); > > >extern void *drmRandomCreate(unsigned long seed); >extern int drmRandomDestroy(void *state); >extern unsigned long drmRandom(void *state); >extern double drmRandomDouble(void *state); > > > >extern void *drmSLCreate(void); >extern int drmSLDestroy(void *l); >extern int drmSLLookup(void *l, unsigned long key, void **value); >extern int drmSLInsert(void *l, unsigned long key, void *value); >extern int drmSLDelete(void *l, unsigned long key); >extern int drmSLNext(void *l, unsigned long *key, void **value); >extern int drmSLFirst(void *l, unsigned long *key, void **value); >extern void drmSLDump(void *l); >extern int drmSLLookupNeighbors(void *l, unsigned long key, > unsigned long *prev_key, void **prev_value, > unsigned long *next_key, void **next_value); ># 40 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_dri.h" 2 ># 1 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_common.h" 1 ># 46 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_common.h" >typedef struct { > enum { > GAMMA_INIT_DMA = 0x01, > GAMMA_CLEANUP_DMA = 0x02 > } func; > int sarea_priv_offset; > int pcimode; > unsigned int mmio0; > unsigned int mmio1; > unsigned int mmio2; > unsigned int mmio3; > unsigned int buffers_offset; > int num_rast; >} drmGAMMAInit; > >extern int drmGAMMAInitDMA( int fd, drmGAMMAInit *info ); >extern int drmGAMMACleanupDMA( int fd ); ># 41 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_dri.h" 2 > >typedef struct { > unsigned int GDeltaMode; > unsigned int GDepthMode; > unsigned int GGeometryMode; > unsigned int GTransformMode; >} GAMMAContextRegionRec, *GAMMAContextRegionPtr; > >typedef struct { > unsigned char next, prev; > unsigned char in_use; > int age; >} GAMMATextureRegionRec, *GAMMATextureRegionPtr; > >typedef struct { > GAMMAContextRegionRec context_state; > > unsigned int dirty; ># 77 "../../../../../../programs/Xserver/hw/xfree86/drivers/glint/glint_dri.h" > GAMMATextureRegionRec texList[64 +1]; > > int texAge; > int last_enqueue; > int last_dispatch; > int last_quiescent; > int ctxOwner; > > int vertex_prim; >} GLINTSAREADRIRec, *GLINTSAREADRIPtr; > > > > > >typedef struct { > drmRegion registers0; > drmRegion registers1; > drmRegion registers2; > drmRegion registers3; > int numMultiDevices; > int pprod; > int cpp; > int frontOffset; > int frontPitch; > int backOffset; > int backPitch; > int backX; > int backY; > int depthOffset; > int depthPitch; > int textureSize; > int logTextureGranularity; >} GLINTDRIRec, *GLINTDRIPtr; ># 15 "gamma_texmem.c" 2 ># 1 "gamma_context.h" 1 ># 30 "gamma_context.h" ># 1 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" 1 ># 56 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" ># 1 "/usr/include/inttypes.h" 1 3 4 ># 28 "/usr/include/inttypes.h" 3 4 ># 1 "/usr/include/stdint.h" 1 3 4 ># 28 "/usr/include/stdint.h" 3 4 ># 1 "/usr/include/bits/wordsize.h" 1 3 4 ># 29 "/usr/include/stdint.h" 2 3 4 ># 49 "/usr/include/stdint.h" 3 4 >typedef unsigned char uint8_t; >typedef unsigned short int uint16_t; > >typedef unsigned int uint32_t; > > > > > >__extension__ >typedef unsigned long long int uint64_t; > > > > > > >typedef signed char int_least8_t; >typedef short int int_least16_t; >typedef int int_least32_t; > > > >__extension__ >typedef long long int int_least64_t; > > > >typedef unsigned char uint_least8_t; >typedef unsigned short int uint_least16_t; >typedef unsigned int uint_least32_t; > > > >__extension__ >typedef unsigned long long int uint_least64_t; > > > > > > >typedef signed char int_fast8_t; > > > > > >typedef int int_fast16_t; >typedef int int_fast32_t; >__extension__ >typedef long long int int_fast64_t; > > > >typedef unsigned char uint_fast8_t; > > > > > >typedef unsigned int uint_fast16_t; >typedef unsigned int uint_fast32_t; >__extension__ >typedef unsigned long long int uint_fast64_t; ># 126 "/usr/include/stdint.h" 3 4 >typedef int intptr_t; > > >typedef unsigned int uintptr_t; ># 138 "/usr/include/stdint.h" 3 4 >__extension__ >typedef long long int intmax_t; >__extension__ >typedef unsigned long long int uintmax_t; ># 29 "/usr/include/inttypes.h" 2 3 4 > > > > > > >typedef long int __gwchar_t; ># 274 "/usr/include/inttypes.h" 3 4 > ># 288 "/usr/include/inttypes.h" 3 4 >typedef struct > { > long long int quot; > long long int rem; > } imaxdiv_t; > > > > > >extern intmax_t imaxabs (intmax_t __n) __attribute__ ((__const__)); > > >extern imaxdiv_t imaxdiv (intmax_t __numer, intmax_t __denom) > __attribute__ ((__const__)); > > >extern intmax_t strtoimax (__const char *__restrict __nptr, > char **__restrict __endptr, int __base) ; > > >extern uintmax_t strtoumax (__const char *__restrict __nptr, > char ** __restrict __endptr, int __base) ; > > >extern intmax_t wcstoimax (__const __gwchar_t *__restrict __nptr, > __gwchar_t **__restrict __endptr, int __base) > ; > > >extern uintmax_t wcstoumax (__const __gwchar_t *__restrict __nptr, > __gwchar_t ** __restrict __endptr, int __base) > ; ># 396 "/usr/include/inttypes.h" 3 4 >extern __inline intmax_t >strtoimax (__const char *__restrict nptr, char **__restrict endptr, > int base) >{ > return __strtoll_internal (nptr, endptr, base, 0); >} ># 414 "/usr/include/inttypes.h" 3 4 >extern __inline uintmax_t >strtoumax (__const char *__restrict nptr, char **__restrict endptr, > int base) >{ > return __strtoull_internal (nptr, endptr, base, 0); >} > > > >__extension__ >extern long long int __wcstoll_internal (__const __gwchar_t * > __restrict __nptr, > __gwchar_t **__restrict __endptr, > int __base, int __group) ; > > >extern __inline intmax_t >wcstoimax (__const __gwchar_t *__restrict nptr, __gwchar_t **__restrict endptr, > int base) >{ > return __wcstoll_internal (nptr, endptr, base, 0); >} > > > > >__extension__ >extern unsigned long long int __wcstoull_internal (__const __gwchar_t * > __restrict __nptr, > __gwchar_t ** > __restrict __endptr, > int __base, > int __group) ; > > >extern __inline uintmax_t >wcstoumax (__const __gwchar_t *__restrict nptr, __gwchar_t **__restrict endptr, > int base) >{ > return __wcstoull_internal (nptr, endptr, base, 0); >} > > > > > ># 57 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" 2 > > > ># 1 "../../../../../../lib/GL/glx/glxclient.h" 1 ># 47 "../../../../../../lib/GL/glx/glxclient.h" ># 1 "../../../../../../exports/include/X11/Xproto.h" 1 ># 76 "../../../../../../exports/include/X11/Xproto.h" ># 1 "../../../../../../exports/include/X11/Xmd.h" 1 ># 132 "../../../../../../exports/include/X11/Xmd.h" >typedef long INT32; > >typedef short INT16; > > > >typedef signed char INT8; ># 147 "../../../../../../exports/include/X11/Xmd.h" >typedef unsigned long CARD32; > >typedef unsigned short CARD16; >typedef unsigned char CARD8; > >typedef CARD32 BITS32; >typedef CARD16 BITS16; > > >typedef CARD8 BYTE; >typedef CARD8 BOOL; ># 77 "../../../../../../exports/include/X11/Xproto.h" 2 ># 1 "../../../../../../exports/include/X11/Xprotostr.h" 1 ># 55 "../../../../../../exports/include/X11/Xprotostr.h" >typedef struct _xSegment { > INT16 x1 , y1 , x2 , y2 ; >} xSegment; > > > >typedef struct _xPoint { > INT16 x , y ; >} xPoint; > >typedef struct _xRectangle { > INT16 x , y ; > CARD16 width , height ; >} xRectangle; > > > >typedef struct _xArc { > INT16 x , y ; > CARD16 width , height ; > INT16 angle1 , angle2 ; >} xArc; ># 78 "../../../../../../exports/include/X11/Xproto.h" 2 ># 263 "../../../../../../exports/include/X11/Xproto.h" >typedef CARD16 KeyButMask; > > > > > > >typedef struct { > CARD8 byteOrder; > BYTE pad; > CARD16 majorVersion , minorVersion ; > CARD16 nbytesAuthProto ; > CARD16 nbytesAuthString ; > CARD16 pad2 ; >} xConnClientPrefix; > >typedef struct { > CARD8 success; > BYTE lengthReason; > CARD16 majorVersion , > minorVersion ; > CARD16 length ; >} xConnSetupPrefix; > > >typedef struct { > CARD32 release ; > CARD32 ridBase , > ridMask ; > CARD32 motionBufferSize ; > CARD16 nbytesVendor ; > CARD16 maxRequestSize ; > CARD8 numRoots; > CARD8 numFormats; > CARD8 imageByteOrder; > CARD8 bitmapBitOrder; > CARD8 bitmapScanlineUnit, > bitmapScanlinePad; > CARD8 minKeyCode, maxKeyCode; > CARD32 pad2 ; >} xConnSetup; > >typedef struct { > CARD8 depth; > CARD8 bitsPerPixel; > CARD8 scanLinePad; > CARD8 pad1; > CARD32 pad2 ; >} xPixmapFormat; > > > >typedef struct { > CARD8 depth; > CARD8 pad1; > CARD16 nVisuals ; > CARD32 pad2 ; > } xDepth; > >typedef struct { > CARD32 visualID ; > > > > CARD8 class; > > CARD8 bitsPerRGB; > CARD16 colormapEntries ; > CARD32 redMask , greenMask , blueMask ; > CARD32 pad ; > } xVisualType; > >typedef struct { > CARD32 windowId ; > CARD32 defaultColormap ; > CARD32 whitePixel , blackPixel ; > CARD32 currentInputMask ; > CARD16 pixWidth , pixHeight ; > CARD16 mmWidth , mmHeight ; > CARD16 minInstalledMaps , maxInstalledMaps ; > CARD32 rootVisualID ; > CARD8 backingStore; > BOOL saveUnders; > CARD8 rootDepth; > CARD8 nDepths; >} xWindowRoot; ># 358 "../../../../../../exports/include/X11/Xproto.h" >typedef struct { > CARD32 time ; > INT16 x , y ; >} xTimecoord; > >typedef struct { > CARD8 family; > BYTE pad; > CARD16 length ; >} xHostEntry; > >typedef struct { > INT16 leftSideBearing , > rightSideBearing , > characterWidth , > ascent , > descent ; > CARD16 attributes ; >} xCharInfo; > >typedef struct { > CARD32 name ; > CARD32 value ; >} xFontProp; > > > > >typedef struct { > CARD8 len; > > INT8 delta; >} xTextElt; > > >typedef struct { > CARD32 pixel ; > CARD16 red , green , blue ; > CARD8 flags; > CARD8 pad; >} xColorItem; > > >typedef struct { > CARD16 red , green , blue , pad ; >} xrgb; > >typedef CARD8 KEYCODE; ># 416 "../../../../../../exports/include/X11/Xproto.h" >typedef struct { > BYTE type; > BYTE data1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 data00 ; > CARD32 data01 ; > CARD32 data02 ; > CARD32 data03 ; > CARD32 data04 ; > CARD32 data05 ; > } xGenericReply; > > > >typedef struct { > BYTE type; > CARD8 backingStore; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 visualID ; > > > > CARD16 class ; > > CARD8 bitGravity; > CARD8 winGravity; > CARD32 backingBitPlanes ; > CARD32 backingPixel ; > BOOL saveUnder; > BOOL mapInstalled; > CARD8 mapState; > BOOL override; > CARD32 colormap ; > CARD32 allEventMasks ; > CARD32 yourEventMask ; > CARD16 doNotPropagateMask ; > CARD16 pad ; > } xGetWindowAttributesReply; > >typedef struct { > BYTE type; > CARD8 depth; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 root ; > INT16 x , y ; > CARD16 width , height ; > CARD16 borderWidth ; > CARD16 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > } xGetGeometryReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 root , parent ; > CARD16 nChildren ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > } xQueryTreeReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 atom ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > } xInternAtomReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nameLength ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xGetAtomNameReply; > >typedef struct { > BYTE type; > CARD8 format; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 propertyType ; > CARD32 bytesAfter ; > CARD32 nItems ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > } xGetPropertyReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nProperties ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xListPropertiesReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 owner ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > } xGetSelectionOwnerReply; > >typedef struct { > BYTE type; > BYTE status; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > } xGrabPointerReply; > >typedef xGrabPointerReply xGrabKeyboardReply; > >typedef struct { > BYTE type; > BOOL sameScreen; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 root , child ; > INT16 rootX , rootY , winX , winY ; > CARD16 mask ; > CARD16 pad1 ; > CARD32 pad ; > } xQueryPointerReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 nEvents ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > } xGetMotionEventsReply; > >typedef struct { > BYTE type; > BOOL sameScreen; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 child ; > INT16 dstX , dstY ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > } xTranslateCoordsReply; > >typedef struct { > BYTE type; > CARD8 revertTo; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 focus ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > } xGetInputFocusReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > BYTE map[32]; > } xQueryKeymapReply; > > >typedef struct _xQueryFontReply { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > xCharInfo minBounds; > > CARD32 walign1 ; > > xCharInfo maxBounds; > > CARD32 walign2 ; > > CARD16 minCharOrByte2 , maxCharOrByte2 ; > CARD16 defaultChar ; > CARD16 nFontProps ; > CARD8 drawDirection; > CARD8 minByte1, maxByte1; > BOOL allCharsExist; > INT16 fontAscent , fontDescent ; > CARD32 nCharInfos ; >} xQueryFontReply; > >typedef struct { > BYTE type; > CARD8 drawDirection; > CARD16 sequenceNumber ; > CARD32 length ; > INT16 fontAscent , fontDescent ; > INT16 overallAscent , overallDescent ; > INT32 overallWidth , overallLeft , overallRight ; > CARD32 pad ; > } xQueryTextExtentsReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nFonts ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xListFontsReply; > > >typedef struct { > BYTE type; > CARD8 nameLength; > CARD16 sequenceNumber ; > CARD32 length ; > xCharInfo minBounds; > > CARD32 walign1 ; > > xCharInfo maxBounds; > > CARD32 walign2 ; > > CARD16 minCharOrByte2 , maxCharOrByte2 ; > CARD16 defaultChar ; > CARD16 nFontProps ; > CARD8 drawDirection; > CARD8 minByte1, maxByte1; > BOOL allCharsExist; > INT16 fontAscent , fontDescent ; > CARD32 nReplies ; >} xListFontsWithInfoReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nPaths ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xGetFontPathReply; > >typedef struct { > BYTE type; > CARD8 depth; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 visual ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xGetImageReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nColormaps ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xListInstalledColormapsReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 red , green , blue ; > CARD16 pad2 ; > CARD32 pixel ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > } xAllocColorReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pixel ; > CARD16 exactRed , exactGreen , exactBlue ; > CARD16 screenRed , screenGreen , screenBlue ; > CARD32 pad2 ; > CARD32 pad3 ; > } xAllocNamedColorReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nPixels , nMasks ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xAllocColorCellsReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nPixels ; > CARD16 pad2 ; > CARD32 redMask , greenMask , blueMask ; > CARD32 pad3 ; > CARD32 pad4 ; > } xAllocColorPlanesReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nColors ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xQueryColorsReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 exactRed , exactGreen , exactBlue ; > CARD16 screenRed , screenGreen , screenBlue ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > } xLookupColorReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 width , height ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xQueryBestSizeReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > BOOL present; > CARD8 major_opcode; > CARD8 first_event; > CARD8 first_error; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xQueryExtensionReply; > >typedef struct { > BYTE type; > CARD8 nExtensions; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xListExtensionsReply; > > >typedef struct { > BYTE type; > CARD8 success; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xSetMappingReply; >typedef xSetMappingReply xSetPointerMappingReply; >typedef xSetMappingReply xSetModifierMappingReply; > >typedef struct { > BYTE type; > CARD8 nElts; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xGetPointerMappingReply; > >typedef struct { > BYTE type; > CARD8 keySymsPerKeyCode; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; >} xGetKeyboardMappingReply; > >typedef struct { > BYTE type; > CARD8 numKeyPerModifier; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGetModifierMappingReply; > >typedef struct { > BYTE type; > BOOL globalAutoRepeat; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 ledMask ; > CARD8 keyClickPercent, bellPercent; > CARD16 bellPitch , bellDuration ; > CARD16 pad ; > BYTE map[32]; > } xGetKeyboardControlReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 accelNumerator , accelDenominator ; > CARD16 threshold ; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > } xGetPointerControlReply; > >typedef struct { > BYTE type; > BYTE pad1; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 timeout , interval ; > BOOL preferBlanking; > BOOL allowExposures; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > } xGetScreenSaverReply; > >typedef struct { > BYTE type; > BOOL enabled; > CARD16 sequenceNumber ; > CARD32 length ; > CARD16 nHosts ; > CARD16 pad1 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; > } xListHostsReply; ># 975 "../../../../../../exports/include/X11/Xproto.h" >typedef struct { > BYTE type; > BYTE errorCode; > CARD16 sequenceNumber ; > CARD32 resourceID ; > CARD16 minorCode ; > CARD8 majorCode; > BYTE pad1; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; >} xError; > > > > > > >typedef struct _xEvent { > union { > struct { > BYTE type; > BYTE detail; > CARD16 sequenceNumber ; > } u; > struct { > CARD32 pad00 ; > CARD32 time ; > CARD32 root , event , child ; > INT16 rootX , rootY , eventX , eventY ; > KeyButMask state ; > BOOL sameScreen; > BYTE pad1; > } keyButtonPointer; > struct { > CARD32 pad00 ; > CARD32 time ; > CARD32 root , event , child ; > INT16 rootX , rootY , eventX , eventY ; > KeyButMask state ; > BYTE mode; > BYTE flags; > > > } enterLeave; > struct { > CARD32 pad00 ; > CARD32 window ; > BYTE mode; > BYTE pad1, pad2, pad3; > } focus; > struct { > CARD32 pad00 ; > CARD32 window ; > CARD16 x , y , width , height ; > CARD16 count ; > CARD16 pad2 ; > } expose; > struct { > CARD32 pad00 ; > CARD32 drawable ; > CARD16 x , y , width , height ; > CARD16 minorEvent ; > CARD16 count ; > BYTE majorEvent; > BYTE pad1, pad2, pad3; > } graphicsExposure; > struct { > CARD32 pad00 ; > CARD32 drawable ; > CARD16 minorEvent ; > BYTE majorEvent; > BYTE bpad; > } noExposure; > struct { > CARD32 pad00 ; > CARD32 window ; > CARD8 state; > BYTE pad1, pad2, pad3; > } visibility; > struct { > CARD32 pad00 ; > CARD32 parent , window ; > INT16 x , y ; > CARD16 width , height , borderWidth ; > BOOL override; > BYTE bpad; > } createNotify; ># 1073 "../../../../../../exports/include/X11/Xproto.h" > struct { > CARD32 pad00 ; > CARD32 event , window ; > } destroyNotify; > struct { > CARD32 pad00 ; > CARD32 event , window ; > BOOL fromConfigure; > BYTE pad1, pad2, pad3; > } unmapNotify; > struct { > CARD32 pad00 ; > CARD32 event , window ; > BOOL override; > BYTE pad1, pad2, pad3; > } mapNotify; > struct { > CARD32 pad00 ; > CARD32 parent , window ; > } mapRequest; > struct { > CARD32 pad00 ; > CARD32 event , window , parent ; > INT16 x , y ; > BOOL override; > BYTE pad1, pad2, pad3; > } reparent; > struct { > CARD32 pad00 ; > CARD32 event , window , aboveSibling ; > INT16 x , y ; > CARD16 width , height , borderWidth ; > BOOL override; > BYTE bpad; > } configureNotify; > struct { > CARD32 pad00 ; > CARD32 parent , window , sibling ; > INT16 x , y ; > CARD16 width , height , borderWidth ; > CARD16 valueMask ; > CARD32 pad1 ; > } configureRequest; > struct { > CARD32 pad00 ; > CARD32 event , window ; > INT16 x , y ; > CARD32 pad1 , pad2 , pad3 , pad4 ; > } gravity; > struct { > CARD32 pad00 ; > CARD32 window ; > CARD16 width , height ; > } resizeRequest; > struct { > > > CARD32 pad00 ; > CARD32 event , window , parent ; > BYTE place; > BYTE pad1, pad2, pad3; > } circulate; > struct { > CARD32 pad00 ; > CARD32 window ; > CARD32 atom ; > CARD32 time ; > BYTE state; > BYTE pad1; > CARD16 pad2 ; > } property; > struct { > CARD32 pad00 ; > CARD32 time ; > CARD32 window ; > CARD32 atom ; > } selectionClear; > struct { > CARD32 pad00 ; > CARD32 time ; > CARD32 owner , requestor ; > CARD32 selection , target , property ; > } selectionRequest; > struct { > CARD32 pad00 ; > CARD32 time ; > CARD32 requestor ; > CARD32 selection , target , property ; > } selectionNotify; > struct { > CARD32 pad00 ; > CARD32 window ; > CARD32 colormap ; > > > > BOOL new; > > BYTE state; > BYTE pad1, pad2; > } colormap; > struct { > CARD32 pad00 ; > CARD8 request; > CARD8 firstKeyCode; > CARD8 count; > BYTE pad1; > } mappingNotify; > struct { > CARD32 pad00 ; > CARD32 window ; > union { > struct { > CARD32 type ; > INT32 longs0 ; > INT32 longs1 ; > INT32 longs2 ; > INT32 longs3 ; > INT32 longs4 ; > } l; > struct { > CARD32 type ; > INT16 shorts0 ; > INT16 shorts1 ; > INT16 shorts2 ; > INT16 shorts3 ; > INT16 shorts4 ; > INT16 shorts5 ; > INT16 shorts6 ; > INT16 shorts7 ; > INT16 shorts8 ; > INT16 shorts9 ; > } s; > struct { > CARD32 type ; > INT8 bytes[20]; > } b; > } u; > } clientMessage; > } u; >} xEvent; > > > > > >typedef struct { > BYTE type; > BYTE map[31]; > } xKeymapEvent; ># 1231 "../../../../../../exports/include/X11/Xproto.h" >typedef union { > xGenericReply generic; > xGetGeometryReply geom; > xQueryTreeReply tree; > xInternAtomReply atom; > xGetAtomNameReply atomName; > xGetPropertyReply property; > xListPropertiesReply listProperties; > xGetSelectionOwnerReply selection; > xGrabPointerReply grabPointer; > xGrabKeyboardReply grabKeyboard; > xQueryPointerReply pointer; > xGetMotionEventsReply motionEvents; > xTranslateCoordsReply coords; > xGetInputFocusReply inputFocus; > xQueryTextExtentsReply textExtents; > xListFontsReply fonts; > xGetFontPathReply fontPath; > xGetImageReply image; > xListInstalledColormapsReply colormaps; > xAllocColorReply allocColor; > xAllocNamedColorReply allocNamedColor; > xAllocColorCellsReply colorCells; > xAllocColorPlanesReply colorPlanes; > xQueryColorsReply colors; > xLookupColorReply lookupColor; > xQueryBestSizeReply bestSize; > xQueryExtensionReply extension; > xListExtensionsReply extensions; > xSetModifierMappingReply setModifierMapping; > xGetModifierMappingReply getModifierMapping; > xSetPointerMappingReply setPointerMapping; > xGetKeyboardMappingReply getKeyboardMapping; > xGetPointerMappingReply getPointerMapping; > xGetPointerControlReply pointerControl; > xGetScreenSaverReply screenSaver; > xListHostsReply hosts; > xError error; > xEvent event; >} xReply; ># 1281 "../../../../../../exports/include/X11/Xproto.h" >typedef struct _xReq { > CARD8 reqType; > CARD8 data; > CARD16 length ; > >} xReq; ># 1295 "../../../../../../exports/include/X11/Xproto.h" >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 id ; > } xResourceReq; > >typedef struct { > CARD8 reqType; > CARD8 depth; > CARD16 length ; > CARD32 wid , parent ; > INT16 x , y ; > CARD16 width , height , borderWidth ; > > > > CARD16 class ; > > CARD32 visual ; > CARD32 mask ; >} xCreateWindowReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 window ; > CARD32 valueMask ; >} xChangeWindowAttributesReq; > >typedef struct { > CARD8 reqType; > BYTE mode; > CARD16 length ; > CARD32 window ; >} xChangeSaveSetReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 window , parent ; > INT16 x , y ; >} xReparentWindowReq; > >typedef struct { > CARD8 reqType; > CARD8 pad; > CARD16 length ; > CARD32 window ; > CARD16 mask ; > CARD16 pad2 ; >} xConfigureWindowReq; > >typedef struct { > CARD8 reqType; > CARD8 direction; > CARD16 length ; > CARD32 window ; >} xCirculateWindowReq; > >typedef struct { > CARD8 reqType; > BOOL onlyIfExists; > CARD16 length ; > CARD16 nbytes ; > CARD16 pad ; >} xInternAtomReq; > >typedef struct { > CARD8 reqType; > CARD8 mode; > CARD16 length ; > CARD32 window ; > CARD32 property , type ; > CARD8 format; > BYTE pad[3]; > CARD32 nUnits ; >} xChangePropertyReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 window ; > CARD32 property ; >} xDeletePropertyReq; > >typedef struct { > CARD8 reqType; > > > > BOOL delete; > > CARD16 length ; > CARD32 window ; > CARD32 property , type ; > CARD32 longOffset ; > CARD32 longLength ; >} xGetPropertyReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 window ; > CARD32 selection ; > CARD32 time ; >} xSetSelectionOwnerReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 requestor ; > CARD32 selection , target , property ; > CARD32 time ; > } xConvertSelectionReq; > >typedef struct { > CARD8 reqType; > BOOL propagate; > CARD16 length ; > CARD32 destination ; > CARD32 eventMask ; > > > > > xEvent event; > >} xSendEventReq; > >typedef struct { > CARD8 reqType; > BOOL ownerEvents; > CARD16 length ; > CARD32 grabWindow ; > CARD16 eventMask ; > BYTE pointerMode, keyboardMode; > CARD32 confineTo ; > CARD32 cursor ; > CARD32 time ; >} xGrabPointerReq; > >typedef struct { > CARD8 reqType; > BOOL ownerEvents; > CARD16 length ; > CARD32 grabWindow ; > CARD16 eventMask ; > BYTE pointerMode, keyboardMode; > CARD32 confineTo ; > CARD32 cursor ; > CARD8 button; > BYTE pad; > CARD16 modifiers ; >} xGrabButtonReq; > >typedef struct { > CARD8 reqType; > CARD8 button; > CARD16 length ; > CARD32 grabWindow ; > CARD16 modifiers ; > CARD16 pad ; >} xUngrabButtonReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cursor ; > CARD32 time ; > CARD16 eventMask ; > CARD16 pad2 ; >} xChangeActivePointerGrabReq; > >typedef struct { > CARD8 reqType; > BOOL ownerEvents; > CARD16 length ; > CARD32 grabWindow ; > CARD32 time ; > BYTE pointerMode, keyboardMode; > CARD16 pad ; >} xGrabKeyboardReq; > >typedef struct { > CARD8 reqType; > BOOL ownerEvents; > CARD16 length ; > CARD32 grabWindow ; > CARD16 modifiers ; > CARD8 key; > BYTE pointerMode, keyboardMode; > BYTE pad1, pad2, pad3; >} xGrabKeyReq; > >typedef struct { > CARD8 reqType; > CARD8 key; > CARD16 length ; > CARD32 grabWindow ; > CARD16 modifiers ; > CARD16 pad ; >} xUngrabKeyReq; > >typedef struct { > CARD8 reqType; > CARD8 mode; > CARD16 length ; > CARD32 time ; >} xAllowEventsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 window ; > CARD32 start , stop ; >} xGetMotionEventsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 srcWid , dstWid ; > INT16 srcX , srcY ; >} xTranslateCoordsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 srcWid , dstWid ; > INT16 srcX , srcY ; > CARD16 srcWidth , srcHeight ; > INT16 dstX , dstY ; >} xWarpPointerReq; > >typedef struct { > CARD8 reqType; > CARD8 revertTo; > CARD16 length ; > CARD32 focus ; > CARD32 time ; >} xSetInputFocusReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 fid ; > CARD16 nbytes ; > BYTE pad1, pad2; >} xOpenFontReq; > >typedef struct { > CARD8 reqType; > BOOL oddLength; > CARD16 length ; > CARD32 fid ; > } xQueryTextExtentsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD16 maxNames ; > CARD16 nbytes ; >} xListFontsReq; > >typedef xListFontsReq xListFontsWithInfoReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD16 nFonts ; > BYTE pad1, pad2; >} xSetFontPathReq; > >typedef struct { > CARD8 reqType; > CARD8 depth; > CARD16 length ; > CARD32 pid ; > CARD32 drawable ; > CARD16 width , height ; >} xCreatePixmapReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 gc ; > CARD32 drawable ; > CARD32 mask ; >} xCreateGCReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 gc ; > CARD32 mask ; >} xChangeGCReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 srcGC , dstGC ; > CARD32 mask ; >} xCopyGCReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 gc ; > CARD16 dashOffset ; > CARD16 nDashes ; >} xSetDashesReq; > >typedef struct { > CARD8 reqType; > BYTE ordering; > CARD16 length ; > CARD32 gc ; > INT16 xOrigin , yOrigin ; >} xSetClipRectanglesReq; > >typedef struct { > CARD8 reqType; > BOOL exposures; > CARD16 length ; > CARD32 window ; > INT16 x , y ; > CARD16 width , height ; >} xClearAreaReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 srcDrawable , dstDrawable ; > CARD32 gc ; > INT16 srcX , srcY , dstX , dstY ; > CARD16 width , height ; >} xCopyAreaReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 srcDrawable , dstDrawable ; > CARD32 gc ; > INT16 srcX , srcY , dstX , dstY ; > CARD16 width , height ; > CARD32 bitPlane ; >} xCopyPlaneReq; > >typedef struct { > CARD8 reqType; > BYTE coordMode; > CARD16 length ; > CARD32 drawable ; > CARD32 gc ; >} xPolyPointReq; > >typedef xPolyPointReq xPolyLineReq; > > > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 drawable ; > CARD32 gc ; >} xPolySegmentReq; > >typedef xPolySegmentReq xPolyArcReq; >typedef xPolySegmentReq xPolyRectangleReq; >typedef xPolySegmentReq xPolyFillRectangleReq; >typedef xPolySegmentReq xPolyFillArcReq; > >typedef struct _FillPolyReq { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 drawable ; > CARD32 gc ; > BYTE shape; > BYTE coordMode; > CARD16 pad1 ; >} xFillPolyReq; > > >typedef struct _PutImageReq { > CARD8 reqType; > CARD8 format; > CARD16 length ; > CARD32 drawable ; > CARD32 gc ; > CARD16 width , height ; > INT16 dstX , dstY ; > CARD8 leftPad; > CARD8 depth; > CARD16 pad ; >} xPutImageReq; > >typedef struct { > CARD8 reqType; > CARD8 format; > CARD16 length ; > CARD32 drawable ; > INT16 x , y ; > CARD16 width , height ; > CARD32 planeMask ; >} xGetImageReq; > > > >typedef struct { > CARD8 reqType; > CARD8 pad; > CARD16 length ; > CARD32 drawable ; > CARD32 gc ; > INT16 x , y ; >} xPolyTextReq; > >typedef xPolyTextReq xPolyText8Req; >typedef xPolyTextReq xPolyText16Req; > >typedef struct { > CARD8 reqType; > BYTE nChars; > CARD16 length ; > CARD32 drawable ; > CARD32 gc ; > INT16 x , y ; >} xImageTextReq; > >typedef xImageTextReq xImageText8Req; >typedef xImageTextReq xImageText16Req; > >typedef struct { > CARD8 reqType; > BYTE alloc; > CARD16 length ; > CARD32 mid ; > CARD32 window ; > CARD32 visual ; >} xCreateColormapReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 mid ; > CARD32 srcCmap ; >} xCopyColormapAndFreeReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cmap ; > CARD16 red , green , blue ; > CARD16 pad2 ; >} xAllocColorReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cmap ; > CARD16 nbytes ; > BYTE pad1, pad2; >} xAllocNamedColorReq; > >typedef struct { > CARD8 reqType; > BOOL contiguous; > CARD16 length ; > CARD32 cmap ; > CARD16 colors , planes ; >} xAllocColorCellsReq; > >typedef struct { > CARD8 reqType; > BOOL contiguous; > CARD16 length ; > CARD32 cmap ; > CARD16 colors , red , green , blue ; >} xAllocColorPlanesReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cmap ; > CARD32 planeMask ; >} xFreeColorsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cmap ; >} xStoreColorsReq; > >typedef struct { > CARD8 reqType; > CARD8 flags; > CARD16 length ; > CARD32 cmap ; > CARD32 pixel ; > CARD16 nbytes ; > BYTE pad1, pad2; > } xStoreNamedColorReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cmap ; >} xQueryColorsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cmap ; > CARD16 nbytes ; > BYTE pad1, pad2; >} xLookupColorReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cid ; > CARD32 source , mask ; > CARD16 foreRed , foreGreen , foreBlue ; > CARD16 backRed , backGreen , backBlue ; > CARD16 x , y ; >} xCreateCursorReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cid ; > CARD32 source , mask ; > CARD16 sourceChar , maskChar ; > CARD16 foreRed , foreGreen , foreBlue ; > CARD16 backRed , backGreen , backBlue ; >} xCreateGlyphCursorReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 cursor ; > CARD16 foreRed , foreGreen , foreBlue ; > CARD16 backRed , backGreen , backBlue ; >} xRecolorCursorReq; > >typedef struct { > CARD8 reqType; > > > > CARD8 class; > > CARD16 length ; > CARD32 drawable ; > CARD16 width , height ; >} xQueryBestSizeReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD16 nbytes ; > BYTE pad1, pad2; >} xQueryExtensionReq; > >typedef struct { > CARD8 reqType; > CARD8 numKeyPerModifier; > CARD16 length ; >} xSetModifierMappingReq; > >typedef struct { > CARD8 reqType; > CARD8 nElts; > CARD16 length ; >} xSetPointerMappingReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD8 firstKeyCode; > CARD8 count; > CARD16 pad1 ; >} xGetKeyboardMappingReq; > >typedef struct { > CARD8 reqType; > CARD8 keyCodes; > CARD16 length ; > CARD8 firstKeyCode; > CARD8 keySymsPerKeyCode; > CARD16 pad1 ; >} xChangeKeyboardMappingReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 mask ; >} xChangeKeyboardControlReq; > >typedef struct { > CARD8 reqType; > INT8 percent; > CARD16 length ; >} xBellReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > INT16 accelNum , accelDenum ; > INT16 threshold ; > BOOL doAccel, doThresh; >} xChangePointerControlReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > INT16 timeout , interval ; > BYTE preferBlank, allowExpose; > CARD16 pad2 ; >} xSetScreenSaverReq; > >typedef struct { > CARD8 reqType; > BYTE mode; > CARD16 length ; > CARD8 hostFamily; > BYTE pad; > CARD16 hostLength ; >} xChangeHostsReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > } xListHostsReq; > >typedef struct { > CARD8 reqType; > BYTE mode; > CARD16 length ; > } xChangeModeReq; > >typedef xChangeModeReq xSetAccessControlReq; >typedef xChangeModeReq xSetCloseDownModeReq; >typedef xChangeModeReq xForceScreenSaverReq; > >typedef struct { > CARD8 reqType; > BYTE pad; > CARD16 length ; > CARD32 window ; > CARD16 nAtoms ; > INT16 nPositions ; > } xRotatePropertiesReq; ># 48 "../../../../../../lib/GL/glx/glxclient.h" 2 ># 1 "../../../../../../exports/include/X11/Xlibint.h" 1 ># 43 "../../../../../../exports/include/X11/Xlibint.h" ># 1 "../../../../../../exports/include/X11/Xlib.h" 1 ># 60 "../../../../../../exports/include/X11/Xlib.h" ># 1 "../../../../../../exports/include/X11/X.h" 1 ># 71 "../../../../../../exports/include/X11/X.h" >typedef unsigned long XID; > > > >typedef unsigned long Mask; > > > >typedef unsigned long Atom; > >typedef unsigned long VisualID; >typedef unsigned long Time; ># 101 "../../../../../../exports/include/X11/X.h" >typedef XID Window; >typedef XID Drawable; > > >typedef XID Font; > >typedef XID Pixmap; >typedef XID Cursor; >typedef XID Colormap; >typedef XID GContext; >typedef XID KeySym; > >typedef unsigned char KeyCode; ># 61 "../../../../../../exports/include/X11/Xlib.h" 2 > > ># 1 "../../../../../../exports/include/X11/Xfuncproto.h" 1 ># 64 "../../../../../../exports/include/X11/Xlib.h" 2 ># 1 "../../../../../../exports/include/X11/Xosdefs.h" 1 ># 65 "../../../../../../exports/include/X11/Xlib.h" 2 ># 77 "../../../../../../exports/include/X11/Xlib.h" ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 78 "../../../../../../exports/include/X11/Xlib.h" 2 ># 95 "../../../../../../exports/include/X11/Xlib.h" >extern int >_Xmblen( > > > > > char *str, > int len > > ); > > > > > >typedef char *XPointer; ># 182 "../../../../../../exports/include/X11/Xlib.h" >typedef struct _XExtData { > int number; > struct _XExtData *next; > int (*free_private)( > struct _XExtData *extension > ); > XPointer private_data; >} XExtData; > > > > >typedef struct { > int extension; > int major_opcode; > int first_event; > int first_error; >} XExtCodes; > > > > > >typedef struct { > int depth; > int bits_per_pixel; > int scanline_pad; >} XPixmapFormatValues; > > > > > >typedef struct { > int function; > unsigned long plane_mask; > unsigned long foreground; > unsigned long background; > int line_width; > int line_style; > int cap_style; > > int join_style; > int fill_style; > > int fill_rule; > int arc_mode; > Pixmap tile; > Pixmap stipple; > int ts_x_origin; > int ts_y_origin; > Font font; > int subwindow_mode; > int graphics_exposures; > int clip_x_origin; > int clip_y_origin; > Pixmap clip_mask; > int dash_offset; > char dashes; >} XGCValues; > > > > > > >typedef struct _XGC > > > > > > > >*GC; > > > > >typedef struct { > XExtData *ext_data; > VisualID visualid; > > > > int class; > > unsigned long red_mask, green_mask, blue_mask; > int bits_per_rgb; > int map_entries; >} Visual; > > > > >typedef struct { > int depth; > int nvisuals; > Visual *visuals; >} Depth; > > > > > > > >struct _XDisplay; > >typedef struct { > XExtData *ext_data; > struct _XDisplay *display; > Window root; > int width, height; > int mwidth, mheight; > int ndepths; > Depth *depths; > int root_depth; > Visual *root_visual; > GC default_gc; > Colormap cmap; > unsigned long white_pixel; > unsigned long black_pixel; > int max_maps, min_maps; > int backing_store; > int save_unders; > long root_input_mask; >} Screen; > > > > >typedef struct { > XExtData *ext_data; > int depth; > int bits_per_pixel; > int scanline_pad; >} ScreenFormat; > > > > >typedef struct { > Pixmap background_pixmap; > unsigned long background_pixel; > Pixmap border_pixmap; > unsigned long border_pixel; > int bit_gravity; > int win_gravity; > int backing_store; > unsigned long backing_planes; > unsigned long backing_pixel; > int save_under; > long event_mask; > long do_not_propagate_mask; > int override_redirect; > Colormap colormap; > Cursor cursor; >} XSetWindowAttributes; > >typedef struct { > int x, y; > int width, height; > int border_width; > int depth; > Visual *visual; > Window root; > > > > int class; > > int bit_gravity; > int win_gravity; > int backing_store; > unsigned long backing_planes; > unsigned long backing_pixel; > int save_under; > Colormap colormap; > int map_installed; > int map_state; > long all_event_masks; > long your_event_mask; > long do_not_propagate_mask; > int override_redirect; > Screen *screen; >} XWindowAttributes; > > > > > > >typedef struct { > int family; > int length; > char *address; >} XHostAddress; > > > > >typedef struct { > int typelength; > int valuelength; > char *type; > char *value; >} XServerInterpretedAddress; > > > > >typedef struct _XImage { > int width, height; > int xoffset; > int format; > char *data; > int byte_order; > int bitmap_unit; > int bitmap_bit_order; > int bitmap_pad; > int depth; > int bytes_per_line; > int bits_per_pixel; > unsigned long red_mask; > unsigned long green_mask; > unsigned long blue_mask; > XPointer obdata; > struct funcs { > struct _XImage *(*create_image)( > struct _XDisplay* , > Visual* , > unsigned int , > int , > int , > char* , > unsigned int , > unsigned int , > int , > int ); > int (*destroy_image) (struct _XImage *); > unsigned long (*get_pixel) (struct _XImage *, int, int); > int (*put_pixel) (struct _XImage *, int, int, unsigned long); > struct _XImage *(*sub_image)(struct _XImage *, int, int, unsigned int, unsigned int); > int (*add_pixel) (struct _XImage *, long); > } f; >} XImage; > > > > >typedef struct { > int x, y; > int width, height; > int border_width; > Window sibling; > int stack_mode; >} XWindowChanges; > > > > >typedef struct { > unsigned long pixel; > unsigned short red, green, blue; > char flags; > char pad; >} XColor; > > > > > > >typedef struct { > short x1, y1, x2, y2; >} XSegment; > >typedef struct { > short x, y; >} XPoint; > >typedef struct { > short x, y; > unsigned short width, height; >} XRectangle; > >typedef struct { > short x, y; > unsigned short width, height; > short angle1, angle2; >} XArc; > > > > >typedef struct { > int key_click_percent; > int bell_percent; > int bell_pitch; > int bell_duration; > int led; > int led_mode; > int key; > int auto_repeat_mode; >} XKeyboardControl; > > > >typedef struct { > int key_click_percent; > int bell_percent; > unsigned int bell_pitch, bell_duration; > unsigned long led_mask; > int global_auto_repeat; > char auto_repeats[32]; >} XKeyboardState; > > > >typedef struct { > Time time; > short x, y; >} XTimeCoord; > > > >typedef struct { > int max_keypermod; > KeyCode *modifiermap; >} XModifierKeymap; ># 521 "../../../../../../exports/include/X11/Xlib.h" >typedef struct _XDisplay Display; > > >struct _XPrivate; >struct _XrmHashBucketRec; > >typedef struct > > > >{ > XExtData *ext_data; > struct _XPrivate *private1; > int fd; > int private2; > int proto_major_version; > int proto_minor_version; > char *vendor; > XID private3; > XID private4; > XID private5; > int private6; > XID (*resource_alloc)( > struct _XDisplay* > ); > int byte_order; > int bitmap_unit; > int bitmap_pad; > int bitmap_bit_order; > int nformats; > ScreenFormat *pixmap_format; > int private8; > int release; > struct _XPrivate *private9, *private10; > int qlen; > unsigned long last_request_read; > unsigned long request; > XPointer private11; > XPointer private12; > XPointer private13; > XPointer private14; > unsigned max_request_size; > struct _XrmHashBucketRec *db; > int (*private15)( > struct _XDisplay* > ); > char *display_name; > int default_screen; > int nscreens; > Screen *screens; > unsigned long motion_buffer; > unsigned long private16; > int min_keycode; > int max_keycode; > XPointer private17; > XPointer private18; > int private19; > char *xdefaults; > >} > > > >*_XPrivDisplay; > > > > > > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Window root; > Window subwindow; > Time time; > int x, y; > int x_root, y_root; > unsigned int state; > unsigned int keycode; > int same_screen; >} XKeyEvent; >typedef XKeyEvent XKeyPressedEvent; >typedef XKeyEvent XKeyReleasedEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Window root; > Window subwindow; > Time time; > int x, y; > int x_root, y_root; > unsigned int state; > unsigned int button; > int same_screen; >} XButtonEvent; >typedef XButtonEvent XButtonPressedEvent; >typedef XButtonEvent XButtonReleasedEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Window root; > Window subwindow; > Time time; > int x, y; > int x_root, y_root; > unsigned int state; > char is_hint; > int same_screen; >} XMotionEvent; >typedef XMotionEvent XPointerMovedEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Window root; > Window subwindow; > Time time; > int x, y; > int x_root, y_root; > int mode; > int detail; > > > > > int same_screen; > int focus; > unsigned int state; >} XCrossingEvent; >typedef XCrossingEvent XEnterWindowEvent; >typedef XCrossingEvent XLeaveWindowEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > int mode; > int detail; > > > > > >} XFocusChangeEvent; >typedef XFocusChangeEvent XFocusInEvent; >typedef XFocusChangeEvent XFocusOutEvent; > > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > char key_vector[32]; >} XKeymapEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > int x, y; > int width, height; > int count; >} XExposeEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Drawable drawable; > int x, y; > int width, height; > int count; > int major_code; > int minor_code; >} XGraphicsExposeEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Drawable drawable; > int major_code; > int minor_code; >} XNoExposeEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > int state; >} XVisibilityEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window parent; > Window window; > int x, y; > int width, height; > int border_width; > int override_redirect; >} XCreateWindowEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; >} XDestroyWindowEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; > int from_configure; >} XUnmapEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; > int override_redirect; >} XMapEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window parent; > Window window; >} XMapRequestEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; > Window parent; > int x, y; > int override_redirect; >} XReparentEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; > int x, y; > int width, height; > int border_width; > Window above; > int override_redirect; >} XConfigureEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; > int x, y; >} XGravityEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > int width, height; >} XResizeRequestEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window parent; > Window window; > int x, y; > int width, height; > int border_width; > Window above; > int detail; > unsigned long value_mask; >} XConfigureRequestEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window event; > Window window; > int place; >} XCirculateEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window parent; > Window window; > int place; >} XCirculateRequestEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Atom atom; > Time time; > int state; >} XPropertyEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Atom selection; > Time time; >} XSelectionClearEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window owner; > Window requestor; > Atom selection; > Atom target; > Atom property; > Time time; >} XSelectionRequestEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window requestor; > Atom selection; > Atom target; > Atom property; > Time time; >} XSelectionEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Colormap colormap; > > > > int new; > > int state; >} XColormapEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > Atom message_type; > int format; > union { > char b[20]; > short s[10]; > long l[5]; > } data; >} XClientMessageEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; > int request; > > int first_keycode; > int count; >} XMappingEvent; > >typedef struct { > int type; > Display *display; > XID resourceid; > unsigned long serial; > unsigned char error_code; > unsigned char request_code; > unsigned char minor_code; >} XErrorEvent; > >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > Window window; >} XAnyEvent; > > > > > >typedef union _XEvent { > int type; > XAnyEvent xany; > XKeyEvent xkey; > XButtonEvent xbutton; > XMotionEvent xmotion; > XCrossingEvent xcrossing; > XFocusChangeEvent xfocus; > XExposeEvent xexpose; > XGraphicsExposeEvent xgraphicsexpose; > XNoExposeEvent xnoexpose; > XVisibilityEvent xvisibility; > XCreateWindowEvent xcreatewindow; > XDestroyWindowEvent xdestroywindow; > XUnmapEvent xunmap; > XMapEvent xmap; > XMapRequestEvent xmaprequest; > XReparentEvent xreparent; > XConfigureEvent xconfigure; > XGravityEvent xgravity; > XResizeRequestEvent xresizerequest; > XConfigureRequestEvent xconfigurerequest; > XCirculateEvent xcirculate; > XCirculateRequestEvent xcirculaterequest; > XPropertyEvent xproperty; > XSelectionClearEvent xselectionclear; > XSelectionRequestEvent xselectionrequest; > XSelectionEvent xselection; > XColormapEvent xcolormap; > XClientMessageEvent xclient; > XMappingEvent xmapping; > XErrorEvent xerror; > XKeymapEvent xkeymap; > long pad[24]; >} XEvent; > > > > > > > >typedef struct { > short lbearing; > short rbearing; > short width; > short ascent; > short descent; > unsigned short attributes; >} XCharStruct; > > > > > >typedef struct { > Atom name; > unsigned long card32; >} XFontProp; > >typedef struct { > XExtData *ext_data; > Font fid; > unsigned direction; > unsigned min_char_or_byte2; > unsigned max_char_or_byte2; > unsigned min_byte1; > unsigned max_byte1; > int all_chars_exist; > unsigned default_char; > int n_properties; > XFontProp *properties; > XCharStruct min_bounds; > XCharStruct max_bounds; > XCharStruct *per_char; > int ascent; > int descent; >} XFontStruct; > > > > >typedef struct { > char *chars; > int nchars; > int delta; > Font font; >} XTextItem; > >typedef struct { > unsigned char byte1; > unsigned char byte2; >} XChar2b; > >typedef struct { > XChar2b *chars; > int nchars; > int delta; > Font font; >} XTextItem16; > > >typedef union { Display *display; > GC gc; > Visual *visual; > Screen *screen; > ScreenFormat *pixmap_format; > XFontStruct *font; } XEDataObject; > >typedef struct { > XRectangle max_ink_extent; > XRectangle max_logical_extent; >} XFontSetExtents; > > > > > >typedef struct _XOM *XOM; >typedef struct _XOC *XOC, *XFontSet; > >typedef struct { > char *chars; > int nchars; > int delta; > XFontSet font_set; >} XmbTextItem; > >typedef struct { > wchar_t *chars; > int nchars; > int delta; > XFontSet font_set; >} XwcTextItem; ># 1125 "../../../../../../exports/include/X11/Xlib.h" >typedef struct { > int charset_count; > char **charset_list; >} XOMCharSetList; > >typedef enum { > XOMOrientation_LTR_TTB, > XOMOrientation_RTL_TTB, > XOMOrientation_TTB_LTR, > XOMOrientation_TTB_RTL, > XOMOrientation_Context >} XOrientation; > >typedef struct { > int num_orientation; > XOrientation *orientation; >} XOMOrientation; > >typedef struct { > int num_font; > XFontStruct **font_struct_list; > char **font_name_list; >} XOMFontInfo; > >typedef struct _XIM *XIM; >typedef struct _XIC *XIC; > >typedef void (*XIMProc)( > XIM, > XPointer, > XPointer >); > >typedef int (*XICProc)( > XIC, > XPointer, > XPointer >); > >typedef void (*XIDProc)( > Display*, > XPointer, > XPointer >); > >typedef unsigned long XIMStyle; > >typedef struct { > unsigned short count_styles; > XIMStyle *supported_styles; >} XIMStyles; ># 1237 "../../../../../../exports/include/X11/Xlib.h" >typedef void *XVaNestedList; > >typedef struct { > XPointer client_data; > XIMProc callback; >} XIMCallback; > >typedef struct { > XPointer client_data; > XICProc callback; >} XICCallback; > >typedef unsigned long XIMFeedback; ># 1261 "../../../../../../exports/include/X11/Xlib.h" >typedef struct _XIMText { > unsigned short length; > XIMFeedback *feedback; > int encoding_is_wchar; > union { > char *multi_byte; > wchar_t *wide_char; > } string; >} XIMText; > >typedef unsigned long XIMPreeditState; > > > > > >typedef struct _XIMPreeditStateNotifyCallbackStruct { > XIMPreeditState state; >} XIMPreeditStateNotifyCallbackStruct; > >typedef unsigned long XIMResetState; > > > > >typedef unsigned long XIMStringConversionFeedback; ># 1295 "../../../../../../exports/include/X11/Xlib.h" >typedef struct _XIMStringConversionText { > unsigned short length; > XIMStringConversionFeedback *feedback; > int encoding_is_wchar; > union { > char *mbs; > wchar_t *wcs; > } string; >} XIMStringConversionText; > >typedef unsigned short XIMStringConversionPosition; > >typedef unsigned short XIMStringConversionType; > > > > > > >typedef unsigned short XIMStringConversionOperation; > > > > >typedef enum { > XIMForwardChar, XIMBackwardChar, > XIMForwardWord, XIMBackwardWord, > XIMCaretUp, XIMCaretDown, > XIMNextLine, XIMPreviousLine, > XIMLineStart, XIMLineEnd, > XIMAbsolutePosition, > XIMDontChange >} XIMCaretDirection; > >typedef struct _XIMStringConversionCallbackStruct { > XIMStringConversionPosition position; > XIMCaretDirection direction; > XIMStringConversionOperation operation; > unsigned short factor; > XIMStringConversionText *text; >} XIMStringConversionCallbackStruct; > >typedef struct _XIMPreeditDrawCallbackStruct { > int caret; > int chg_first; > int chg_length; > XIMText *text; >} XIMPreeditDrawCallbackStruct; > >typedef enum { > XIMIsInvisible, > XIMIsPrimary, > XIMIsSecondary >} XIMCaretStyle; > >typedef struct _XIMPreeditCaretCallbackStruct { > int position; > XIMCaretDirection direction; > XIMCaretStyle style; >} XIMPreeditCaretCallbackStruct; > >typedef enum { > XIMTextType, > XIMBitmapType >} XIMStatusDataType; > >typedef struct _XIMStatusDrawCallbackStruct { > XIMStatusDataType type; > union { > XIMText *text; > Pixmap bitmap; > } data; >} XIMStatusDrawCallbackStruct; > >typedef struct _XIMHotKeyTrigger { > KeySym keysym; > int modifier; > int modifier_mask; >} XIMHotKeyTrigger; > >typedef struct _XIMHotKeyTriggers { > int num_hot_key; > XIMHotKeyTrigger *key; >} XIMHotKeyTriggers; > >typedef unsigned long XIMHotKeyState; > > > > >typedef struct { > unsigned short count_values; > char **supported_values; >} XIMValuesList; > > > > > > > >extern int _Xdebug; > >extern XFontStruct *XLoadQueryFont( > Display* , > const char* >); > >extern XFontStruct *XQueryFont( > Display* , > XID >); > > >extern XTimeCoord *XGetMotionEvents( > Display* , > Window , > Time , > Time , > int* >); > >extern XModifierKeymap *XDeleteModifiermapEntry( > XModifierKeymap* , > > > > KeyCode , > > int >); > >extern XModifierKeymap *XGetModifierMapping( > Display* >); > >extern XModifierKeymap *XInsertModifiermapEntry( > XModifierKeymap* , > > > > KeyCode , > > int >); > >extern XModifierKeymap *XNewModifiermap( > int >); > >extern XImage *XCreateImage( > Display* , > Visual* , > unsigned int , > int , > int , > char* , > unsigned int , > unsigned int , > int , > int >); >extern int XInitImage( > XImage* >); >extern XImage *XGetImage( > Display* , > Drawable , > int , > int , > unsigned int , > unsigned int , > unsigned long , > int >); >extern XImage *XGetSubImage( > Display* , > Drawable , > int , > int , > unsigned int , > unsigned int , > unsigned long , > int , > XImage* , > int , > int >); > > > > >extern Display *XOpenDisplay( > const char* >); > >extern void XrmInitialize( > void >); > >extern char *XFetchBytes( > Display* , > int* >); >extern char *XFetchBuffer( > Display* , > int* , > int >); >extern char *XGetAtomName( > Display* , > Atom >); >extern int XGetAtomNames( > Display* , > Atom* , > int , > char** >); >extern char *XGetDefault( > Display* , > const char* , > const char* >); >extern char *XDisplayName( > const char* >); >extern char *XKeysymToString( > KeySym >); > >extern int (*XSynchronize( > Display* , > int >))( > Display* >); >extern int (*XSetAfterFunction( > Display* , > int (*) ( > Display* > ) >))( > Display* >); >extern Atom XInternAtom( > Display* , > const char* , > int >); >extern int XInternAtoms( > Display* , > char** , > int , > int , > Atom* >); >extern Colormap XCopyColormapAndFree( > Display* , > Colormap >); >extern Colormap XCreateColormap( > Display* , > Window , > Visual* , > int >); >extern Cursor XCreatePixmapCursor( > Display* , > Pixmap , > Pixmap , > XColor* , > XColor* , > unsigned int , > unsigned int >); >extern Cursor XCreateGlyphCursor( > Display* , > Font , > Font , > unsigned int , > unsigned int , > XColor const * , > XColor const * >); >extern Cursor XCreateFontCursor( > Display* , > unsigned int >); >extern Font XLoadFont( > Display* , > const char* >); >extern GC XCreateGC( > Display* , > Drawable , > unsigned long , > XGCValues* >); >extern GContext XGContextFromGC( > GC >); >extern void XFlushGC( > Display* , > GC >); >extern Pixmap XCreatePixmap( > Display* , > Drawable , > unsigned int , > unsigned int , > unsigned int >); >extern Pixmap XCreateBitmapFromData( > Display* , > Drawable , > const char* , > unsigned int , > unsigned int >); >extern Pixmap XCreatePixmapFromBitmapData( > Display* , > Drawable , > char* , > unsigned int , > unsigned int , > unsigned long , > unsigned long , > unsigned int >); >extern Window XCreateSimpleWindow( > Display* , > Window , > int , > int , > unsigned int , > unsigned int , > unsigned int , > unsigned long , > unsigned long >); >extern Window XGetSelectionOwner( > Display* , > Atom >); >extern Window XCreateWindow( > Display* , > Window , > int , > int , > unsigned int , > unsigned int , > unsigned int , > int , > unsigned int , > Visual* , > unsigned long , > XSetWindowAttributes* >); >extern Colormap *XListInstalledColormaps( > Display* , > Window , > int* >); >extern char **XListFonts( > Display* , > const char* , > int , > int* >); >extern char **XListFontsWithInfo( > Display* , > const char* , > int , > int* , > XFontStruct** >); >extern char **XGetFontPath( > Display* , > int* >); >extern char **XListExtensions( > Display* , > int* >); >extern Atom *XListProperties( > Display* , > Window , > int* >); >extern XHostAddress *XListHosts( > Display* , > int* , > int* >); >extern KeySym XKeycodeToKeysym( > Display* , > > > > KeyCode , > > int >); >extern KeySym XLookupKeysym( > XKeyEvent* , > int >); >extern KeySym *XGetKeyboardMapping( > Display* , > > > > KeyCode , > > int , > int* >); >extern KeySym XStringToKeysym( > const char* >); >extern long XMaxRequestSize( > Display* >); >extern long XExtendedMaxRequestSize( > Display* >); >extern char *XResourceManagerString( > Display* >); >extern char *XScreenResourceString( > Screen* >); >extern unsigned long XDisplayMotionBufferSize( > Display* >); >extern VisualID XVisualIDFromVisual( > Visual* >); > > > >extern int XInitThreads( > void >); > >extern void XLockDisplay( > Display* >); > >extern void XUnlockDisplay( > Display* >); > > > >extern XExtCodes *XInitExtension( > Display* , > const char* >); > >extern XExtCodes *XAddExtension( > Display* >); >extern XExtData *XFindOnExtensionList( > XExtData** , > int >); >extern XExtData **XEHeadOfExtensionList( > XEDataObject >); > > >extern Window XRootWindow( > Display* , > int >); >extern Window XDefaultRootWindow( > Display* >); >extern Window XRootWindowOfScreen( > Screen* >); >extern Visual *XDefaultVisual( > Display* , > int >); >extern Visual *XDefaultVisualOfScreen( > Screen* >); >extern GC XDefaultGC( > Display* , > int >); >extern GC XDefaultGCOfScreen( > Screen* >); >extern unsigned long XBlackPixel( > Display* , > int >); >extern unsigned long XWhitePixel( > Display* , > int >); >extern unsigned long XAllPlanes( > void >); >extern unsigned long XBlackPixelOfScreen( > Screen* >); >extern unsigned long XWhitePixelOfScreen( > Screen* >); >extern unsigned long XNextRequest( > Display* >); >extern unsigned long XLastKnownRequestProcessed( > Display* >); >extern char *XServerVendor( > Display* >); >extern char *XDisplayString( > Display* >); >extern Colormap XDefaultColormap( > Display* , > int >); >extern Colormap XDefaultColormapOfScreen( > Screen* >); >extern Display *XDisplayOfScreen( > Screen* >); >extern Screen *XScreenOfDisplay( > Display* , > int >); >extern Screen *XDefaultScreenOfDisplay( > Display* >); >extern long XEventMaskOfScreen( > Screen* >); > >extern int XScreenNumberOfScreen( > Screen* >); > >typedef int (*XErrorHandler) ( > Display* , > XErrorEvent* >); > >extern XErrorHandler XSetErrorHandler ( > XErrorHandler >); > > >typedef int (*XIOErrorHandler) ( > Display* >); > >extern XIOErrorHandler XSetIOErrorHandler ( > XIOErrorHandler >); > > >extern XPixmapFormatValues *XListPixmapFormats( > Display* , > int* >); >extern int *XListDepths( > Display* , > int , > int* >); > > > >extern int XReconfigureWMWindow( > Display* , > Window , > int , > unsigned int , > XWindowChanges* >); > >extern int XGetWMProtocols( > Display* , > Window , > Atom** , > int* >); >extern int XSetWMProtocols( > Display* , > Window , > Atom* , > int >); >extern int XIconifyWindow( > Display* , > Window , > int >); >extern int XWithdrawWindow( > Display* , > Window , > int >); >extern int XGetCommand( > Display* , > Window , > char*** , > int* >); >extern int XGetWMColormapWindows( > Display* , > Window , > Window** , > int* >); >extern int XSetWMColormapWindows( > Display* , > Window , > Window* , > int >); >extern void XFreeStringList( > char** >); >extern int XSetTransientForHint( > Display* , > Window , > Window >); > > > >extern int XActivateScreenSaver( > Display* >); > >extern int XAddHost( > Display* , > XHostAddress* >); > >extern int XAddHosts( > Display* , > XHostAddress* , > int >); > >extern int XAddToExtensionList( > struct _XExtData** , > XExtData* >); > >extern int XAddToSaveSet( > Display* , > Window >); > >extern int XAllocColor( > Display* , > Colormap , > XColor* >); > >extern int XAllocColorCells( > Display* , > Colormap , > int , > unsigned long* , > unsigned int , > unsigned long* , > unsigned int >); > >extern int XAllocColorPlanes( > Display* , > Colormap , > int , > unsigned long* , > int , > int , > int , > int , > unsigned long* , > unsigned long* , > unsigned long* >); > >extern int XAllocNamedColor( > Display* , > Colormap , > const char* , > XColor* , > XColor* >); > >extern int XAllowEvents( > Display* , > int , > Time >); > >extern int XAutoRepeatOff( > Display* >); > >extern int XAutoRepeatOn( > Display* >); > >extern int XBell( > Display* , > int >); > >extern int XBitmapBitOrder( > Display* >); > >extern int XBitmapPad( > Display* >); > >extern int XBitmapUnit( > Display* >); > >extern int XCellsOfScreen( > Screen* >); > >extern int XChangeActivePointerGrab( > Display* , > unsigned int , > Cursor , > Time >); > >extern int XChangeGC( > Display* , > GC , > unsigned long , > XGCValues* >); > >extern int XChangeKeyboardControl( > Display* , > unsigned long , > XKeyboardControl* >); > >extern int XChangeKeyboardMapping( > Display* , > int , > int , > KeySym* , > int >); > >extern int XChangePointerControl( > Display* , > int , > int , > int , > int , > int >); > >extern int XChangeProperty( > Display* , > Window , > Atom , > Atom , > int , > int , > const unsigned char* , > int >); > >extern int XChangeSaveSet( > Display* , > Window , > int >); > >extern int XChangeWindowAttributes( > Display* , > Window , > unsigned long , > XSetWindowAttributes* >); > >extern int XCheckIfEvent( > Display* , > XEvent* , > int (*) ( > Display* , > XEvent* , > XPointer > ) , > XPointer >); > >extern int XCheckMaskEvent( > Display* , > long , > XEvent* >); > >extern int XCheckTypedEvent( > Display* , > int , > XEvent* >); > >extern int XCheckTypedWindowEvent( > Display* , > Window , > int , > XEvent* >); > >extern int XCheckWindowEvent( > Display* , > Window , > long , > XEvent* >); > >extern int XCirculateSubwindows( > Display* , > Window , > int >); > >extern int XCirculateSubwindowsDown( > Display* , > Window >); > >extern int XCirculateSubwindowsUp( > Display* , > Window >); > >extern int XClearArea( > Display* , > Window , > int , > int , > unsigned int , > unsigned int , > int >); > >extern int XClearWindow( > Display* , > Window >); > >extern int XCloseDisplay( > Display* >); > >extern int XConfigureWindow( > Display* , > Window , > unsigned int , > XWindowChanges* >); > >extern int XConnectionNumber( > Display* >); > >extern int XConvertSelection( > Display* , > Atom , > Atom , > Atom , > Window , > Time >); > >extern int XCopyArea( > Display* , > Drawable , > Drawable , > GC , > int , > int , > unsigned int , > unsigned int , > int , > int >); > >extern int XCopyGC( > Display* , > GC , > unsigned long , > GC >); > >extern int XCopyPlane( > Display* , > Drawable , > Drawable , > GC , > int , > int , > unsigned int , > unsigned int , > int , > int , > unsigned long >); > >extern int XDefaultDepth( > Display* , > int >); > >extern int XDefaultDepthOfScreen( > Screen* >); > >extern int XDefaultScreen( > Display* >); > >extern int XDefineCursor( > Display* , > Window , > Cursor >); > >extern int XDeleteProperty( > Display* , > Window , > Atom >); > >extern int XDestroyWindow( > Display* , > Window >); > >extern int XDestroySubwindows( > Display* , > Window >); > >extern int XDoesBackingStore( > Screen* >); > >extern int XDoesSaveUnders( > Screen* >); > >extern int XDisableAccessControl( > Display* >); > > >extern int XDisplayCells( > Display* , > int >); > >extern int XDisplayHeight( > Display* , > int >); > >extern int XDisplayHeightMM( > Display* , > int >); > >extern int XDisplayKeycodes( > Display* , > int* , > int* >); > >extern int XDisplayPlanes( > Display* , > int >); > >extern int XDisplayWidth( > Display* , > int >); > >extern int XDisplayWidthMM( > Display* , > int >); > >extern int XDrawArc( > Display* , > Drawable , > GC , > int , > int , > unsigned int , > unsigned int , > int , > int >); > >extern int XDrawArcs( > Display* , > Drawable , > GC , > XArc* , > int >); > >extern int XDrawImageString( > Display* , > Drawable , > GC , > int , > int , > const char* , > int >); > >extern int XDrawImageString16( > Display* , > Drawable , > GC , > int , > int , > const XChar2b* , > int >); > >extern int XDrawLine( > Display* , > Drawable , > GC , > int , > int , > int , > int >); > >extern int XDrawLines( > Display* , > Drawable , > GC , > XPoint* , > int , > int >); > >extern int XDrawPoint( > Display* , > Drawable , > GC , > int , > int >); > >extern int XDrawPoints( > Display* , > Drawable , > GC , > XPoint* , > int , > int >); > >extern int XDrawRectangle( > Display* , > Drawable , > GC , > int , > int , > unsigned int , > unsigned int >); > >extern int XDrawRectangles( > Display* , > Drawable , > GC , > XRectangle* , > int >); > >extern int XDrawSegments( > Display* , > Drawable , > GC , > XSegment* , > int >); > >extern int XDrawString( > Display* , > Drawable , > GC , > int , > int , > const char* , > int >); > >extern int XDrawString16( > Display* , > Drawable , > GC , > int , > int , > const XChar2b* , > int >); > >extern int XDrawText( > Display* , > Drawable , > GC , > int , > int , > XTextItem* , > int >); > >extern int XDrawText16( > Display* , > Drawable , > GC , > int , > int , > XTextItem16* , > int >); > >extern int XEnableAccessControl( > Display* >); > >extern int XEventsQueued( > Display* , > int >); > >extern int XFetchName( > Display* , > Window , > char** >); > >extern int XFillArc( > Display* , > Drawable , > GC , > int , > int , > unsigned int , > unsigned int , > int , > int >); > >extern int XFillArcs( > Display* , > Drawable , > GC , > XArc* , > int >); > >extern int XFillPolygon( > Display* , > Drawable , > GC , > XPoint* , > int , > int , > int >); > >extern int XFillRectangle( > Display* , > Drawable , > GC , > int , > int , > unsigned int , > unsigned int >); > >extern int XFillRectangles( > Display* , > Drawable , > GC , > XRectangle* , > int >); > >extern int XFlush( > Display* >); > >extern int XForceScreenSaver( > Display* , > int >); > >extern int XFree( > void* >); > >extern int XFreeColormap( > Display* , > Colormap >); > >extern int XFreeColors( > Display* , > Colormap , > unsigned long* , > int , > unsigned long >); > >extern int XFreeCursor( > Display* , > Cursor >); > >extern int XFreeExtensionList( > char** >); > >extern int XFreeFont( > Display* , > XFontStruct* >); > >extern int XFreeFontInfo( > char** , > XFontStruct* , > int >); > >extern int XFreeFontNames( > char** >); > >extern int XFreeFontPath( > char** >); > >extern int XFreeGC( > Display* , > GC >); > >extern int XFreeModifiermap( > XModifierKeymap* >); > >extern int XFreePixmap( > Display* , > Pixmap >); > >extern int XGeometry( > Display* , > int , > const char* , > const char* , > unsigned int , > unsigned int , > unsigned int , > int , > int , > int* , > int* , > int* , > int* >); > >extern int XGetErrorDatabaseText( > Display* , > const char* , > const char* , > const char* , > char* , > int >); > >extern int XGetErrorText( > Display* , > int , > char* , > int >); > >extern int XGetFontProperty( > XFontStruct* , > Atom , > unsigned long* >); > >extern int XGetGCValues( > Display* , > GC , > unsigned long , > XGCValues* >); > >extern int XGetGeometry( > Display* , > Drawable , > Window* , > int* , > int* , > unsigned int* , > unsigned int* , > unsigned int* , > unsigned int* >); > >extern int XGetIconName( > Display* , > Window , > char** >); > >extern int XGetInputFocus( > Display* , > Window* , > int* >); > >extern int XGetKeyboardControl( > Display* , > XKeyboardState* >); > >extern int XGetPointerControl( > Display* , > int* , > int* , > int* >); > >extern int XGetPointerMapping( > Display* , > unsigned char* , > int >); > >extern int XGetScreenSaver( > Display* , > int* , > int* , > int* , > int* >); > >extern int XGetTransientForHint( > Display* , > Window , > Window* >); > >extern int XGetWindowProperty( > Display* , > Window , > Atom , > long , > long , > int , > Atom , > Atom* , > int* , > unsigned long* , > unsigned long* , > unsigned char** >); > >extern int XGetWindowAttributes( > Display* , > Window , > XWindowAttributes* >); > >extern int XGrabButton( > Display* , > unsigned int , > unsigned int , > Window , > int , > unsigned int , > int , > int , > Window , > Cursor >); > >extern int XGrabKey( > Display* , > int , > unsigned int , > Window , > int , > int , > int >); > >extern int XGrabKeyboard( > Display* , > Window , > int , > int , > int , > Time >); > >extern int XGrabPointer( > Display* , > Window , > int , > unsigned int , > int , > int , > Window , > Cursor , > Time >); > >extern int XGrabServer( > Display* >); > >extern int XHeightMMOfScreen( > Screen* >); > >extern int XHeightOfScreen( > Screen* >); > >extern int XIfEvent( > Display* , > XEvent* , > int (*) ( > Display* , > XEvent* , > XPointer > ) , > XPointer >); > >extern int XImageByteOrder( > Display* >); > >extern int XInstallColormap( > Display* , > Colormap >); > >extern KeyCode XKeysymToKeycode( > Display* , > KeySym >); > >extern int XKillClient( > Display* , > XID >); > >extern int XLookupColor( > Display* , > Colormap , > const char* , > XColor* , > XColor* >); > >extern int XLowerWindow( > Display* , > Window >); > >extern int XMapRaised( > Display* , > Window >); > >extern int XMapSubwindows( > Display* , > Window >); > >extern int XMapWindow( > Display* , > Window >); > >extern int XMaskEvent( > Display* , > long , > XEvent* >); > >extern int XMaxCmapsOfScreen( > Screen* >); > >extern int XMinCmapsOfScreen( > Screen* >); > >extern int XMoveResizeWindow( > Display* , > Window , > int , > int , > unsigned int , > unsigned int >); > >extern int XMoveWindow( > Display* , > Window , > int , > int >); > >extern int XNextEvent( > Display* , > XEvent* >); > >extern int XNoOp( > Display* >); > >extern int XParseColor( > Display* , > Colormap , > const char* , > XColor* >); > >extern int XParseGeometry( > const char* , > int* , > int* , > unsigned int* , > unsigned int* >); > >extern int XPeekEvent( > Display* , > XEvent* >); > >extern int XPeekIfEvent( > Display* , > XEvent* , > int (*) ( > Display* , > XEvent* , > XPointer > ) , > XPointer >); > >extern int XPending( > Display* >); > >extern int XPlanesOfScreen( > Screen* >); > >extern int XProtocolRevision( > Display* >); > >extern int XProtocolVersion( > Display* >); > > >extern int XPutBackEvent( > Display* , > XEvent* >); > >extern int XPutImage( > Display* , > Drawable , > GC , > XImage* , > int , > int , > int , > int , > unsigned int , > unsigned int >); > >extern int XQLength( > Display* >); > >extern int XQueryBestCursor( > Display* , > Drawable , > unsigned int , > unsigned int , > unsigned int* , > unsigned int* >); > >extern int XQueryBestSize( > Display* , > int , > Drawable , > unsigned int , > unsigned int , > unsigned int* , > unsigned int* >); > >extern int XQueryBestStipple( > Display* , > Drawable , > unsigned int , > unsigned int , > unsigned int* , > unsigned int* >); > >extern int XQueryBestTile( > Display* , > Drawable , > unsigned int , > unsigned int , > unsigned int* , > unsigned int* >); > >extern int XQueryColor( > Display* , > Colormap , > XColor* >); > >extern int XQueryColors( > Display* , > Colormap , > XColor* , > int >); > >extern int XQueryExtension( > Display* , > const char* , > int* , > int* , > int* >); > >extern int XQueryKeymap( > Display* , > char [32] >); > >extern int XQueryPointer( > Display* , > Window , > Window* , > Window* , > int* , > int* , > int* , > int* , > unsigned int* >); > >extern int XQueryTextExtents( > Display* , > XID , > const char* , > int , > int* , > int* , > int* , > XCharStruct* >); > >extern int XQueryTextExtents16( > Display* , > XID , > const XChar2b* , > int , > int* , > int* , > int* , > XCharStruct* >); > >extern int XQueryTree( > Display* , > Window , > Window* , > Window* , > Window** , > unsigned int* >); > >extern int XRaiseWindow( > Display* , > Window >); > >extern int XReadBitmapFile( > Display* , > Drawable , > const char* , > unsigned int* , > unsigned int* , > Pixmap* , > int* , > int* >); > >extern int XReadBitmapFileData( > const char* , > unsigned int* , > unsigned int* , > unsigned char** , > int* , > int* >); > >extern int XRebindKeysym( > Display* , > KeySym , > KeySym* , > int , > const unsigned char* , > int >); > >extern int XRecolorCursor( > Display* , > Cursor , > XColor* , > XColor* >); > >extern int XRefreshKeyboardMapping( > XMappingEvent* >); > >extern int XRemoveFromSaveSet( > Display* , > Window >); > >extern int XRemoveHost( > Display* , > XHostAddress* >); > >extern int XRemoveHosts( > Display* , > XHostAddress* , > int >); > >extern int XReparentWindow( > Display* , > Window , > Window , > int , > int >); > >extern int XResetScreenSaver( > Display* >); > >extern int XResizeWindow( > Display* , > Window , > unsigned int , > unsigned int >); > >extern int XRestackWindows( > Display* , > Window* , > int >); > >extern int XRotateBuffers( > Display* , > int >); > >extern int XRotateWindowProperties( > Display* , > Window , > Atom* , > int , > int >); > >extern int XScreenCount( > Display* >); > >extern int XSelectInput( > Display* , > Window , > long >); > >extern int XSendEvent( > Display* , > Window , > int , > long , > XEvent* >); > >extern int XSetAccessControl( > Display* , > int >); > >extern int XSetArcMode( > Display* , > GC , > int >); > >extern int XSetBackground( > Display* , > GC , > unsigned long >); > >extern int XSetClipMask( > Display* , > GC , > Pixmap >); > >extern int XSetClipOrigin( > Display* , > GC , > int , > int >); > >extern int XSetClipRectangles( > Display* , > GC , > int , > int , > XRectangle* , > int , > int >); > >extern int XSetCloseDownMode( > Display* , > int >); > >extern int XSetCommand( > Display* , > Window , > char** , > int >); > >extern int XSetDashes( > Display* , > GC , > int , > const char* , > int >); > >extern int XSetFillRule( > Display* , > GC , > int >); > >extern int XSetFillStyle( > Display* , > GC , > int >); > >extern int XSetFont( > Display* , > GC , > Font >); > >extern int XSetFontPath( > Display* , > char** , > int >); > >extern int XSetForeground( > Display* , > GC , > unsigned long >); > >extern int XSetFunction( > Display* , > GC , > int >); > >extern int XSetGraphicsExposures( > Display* , > GC , > int >); > >extern int XSetIconName( > Display* , > Window , > const char* >); > >extern int XSetInputFocus( > Display* , > Window , > int , > Time >); > >extern int XSetLineAttributes( > Display* , > GC , > unsigned int , > int , > int , > int >); > >extern int XSetModifierMapping( > Display* , > XModifierKeymap* >); > >extern int XSetPlaneMask( > Display* , > GC , > unsigned long >); > >extern int XSetPointerMapping( > Display* , > const unsigned char* , > int >); > >extern int XSetScreenSaver( > Display* , > int , > int , > int , > int >); > >extern int XSetSelectionOwner( > Display* , > Atom , > Window , > Time >); > >extern int XSetState( > Display* , > GC , > unsigned long , > unsigned long , > int , > unsigned long >); > >extern int XSetStipple( > Display* , > GC , > Pixmap >); > >extern int XSetSubwindowMode( > Display* , > GC , > int >); > >extern int XSetTSOrigin( > Display* , > GC , > int , > int >); > >extern int XSetTile( > Display* , > GC , > Pixmap >); > >extern int XSetWindowBackground( > Display* , > Window , > unsigned long >); > >extern int XSetWindowBackgroundPixmap( > Display* , > Window , > Pixmap >); > >extern int XSetWindowBorder( > Display* , > Window , > unsigned long >); > >extern int XSetWindowBorderPixmap( > Display* , > Window , > Pixmap >); > >extern int XSetWindowBorderWidth( > Display* , > Window , > unsigned int >); > >extern int XSetWindowColormap( > Display* , > Window , > Colormap >); > >extern int XStoreBuffer( > Display* , > const char* , > int , > int >); > >extern int XStoreBytes( > Display* , > const char* , > int >); > >extern int XStoreColor( > Display* , > Colormap , > XColor* >); > >extern int XStoreColors( > Display* , > Colormap , > XColor* , > int >); > >extern int XStoreName( > Display* , > Window , > const char* >); > >extern int XStoreNamedColor( > Display* , > Colormap , > const char* , > unsigned long , > int >); > >extern int XSync( > Display* , > int >); > >extern int XTextExtents( > XFontStruct* , > const char* , > int , > int* , > int* , > int* , > XCharStruct* >); > >extern int XTextExtents16( > XFontStruct* , > const XChar2b* , > int , > int* , > int* , > int* , > XCharStruct* >); > >extern int XTextWidth( > XFontStruct* , > const char* , > int >); > >extern int XTextWidth16( > XFontStruct* , > const XChar2b* , > int >); > >extern int XTranslateCoordinates( > Display* , > Window , > Window , > int , > int , > int* , > int* , > Window* >); > >extern int XUndefineCursor( > Display* , > Window >); > >extern int XUngrabButton( > Display* , > unsigned int , > unsigned int , > Window >); > >extern int XUngrabKey( > Display* , > int , > unsigned int , > Window >); > >extern int XUngrabKeyboard( > Display* , > Time >); > >extern int XUngrabPointer( > Display* , > Time >); > >extern int XUngrabServer( > Display* >); > >extern int XUninstallColormap( > Display* , > Colormap >); > >extern int XUnloadFont( > Display* , > Font >); > >extern int XUnmapSubwindows( > Display* , > Window >); > >extern int XUnmapWindow( > Display* , > Window >); > >extern int XVendorRelease( > Display* >); > >extern int XWarpPointer( > Display* , > Window , > Window , > int , > int , > unsigned int , > unsigned int , > int , > int >); > >extern int XWidthMMOfScreen( > Screen* >); > >extern int XWidthOfScreen( > Screen* >); > >extern int XWindowEvent( > Display* , > Window , > long , > XEvent* >); > >extern int XWriteBitmapFile( > Display* , > const char* , > Pixmap , > unsigned int , > unsigned int , > int , > int >); > >extern int XSupportsLocale (void); > >extern char *XSetLocaleModifiers( > const char* >); > >extern XOM XOpenOM( > Display* , > struct _XrmHashBucketRec* , > const char* , > const char* >); > >extern int XCloseOM( > XOM >); > >extern char *XSetOMValues( > XOM , > ... >); > >extern char *XGetOMValues( > XOM , > ... >); > >extern Display *XDisplayOfOM( > XOM >); > >extern char *XLocaleOfOM( > XOM >); > >extern XOC XCreateOC( > XOM , > ... >); > >extern void XDestroyOC( > XOC >); > >extern XOM XOMOfOC( > XOC >); > >extern char *XSetOCValues( > XOC , > ... >); > >extern char *XGetOCValues( > XOC , > ... >); > >extern XFontSet XCreateFontSet( > Display* , > const char* , > char*** , > int* , > char** >); > >extern void XFreeFontSet( > Display* , > XFontSet >); > >extern int XFontsOfFontSet( > XFontSet , > XFontStruct*** , > char*** >); > >extern char *XBaseFontNameListOfFontSet( > XFontSet >); > >extern char *XLocaleOfFontSet( > XFontSet >); > >extern int XContextDependentDrawing( > XFontSet >); > >extern int XDirectionalDependentDrawing( > XFontSet >); > >extern int XContextualDrawing( > XFontSet >); > >extern XFontSetExtents *XExtentsOfFontSet( > XFontSet >); > >extern int XmbTextEscapement( > XFontSet , > const char* , > int >); > >extern int XwcTextEscapement( > XFontSet , > const wchar_t* , > int >); > >extern int Xutf8TextEscapement( > XFontSet , > const char* , > int >); > >extern int XmbTextExtents( > XFontSet , > const char* , > int , > XRectangle* , > XRectangle* >); > >extern int XwcTextExtents( > XFontSet , > const wchar_t* , > int , > XRectangle* , > XRectangle* >); > >extern int Xutf8TextExtents( > XFontSet , > const char* , > int , > XRectangle* , > XRectangle* >); > >extern int XmbTextPerCharExtents( > XFontSet , > const char* , > int , > XRectangle* , > XRectangle* , > int , > int* , > XRectangle* , > XRectangle* >); > >extern int XwcTextPerCharExtents( > XFontSet , > const wchar_t* , > int , > XRectangle* , > XRectangle* , > int , > int* , > XRectangle* , > XRectangle* >); > >extern int Xutf8TextPerCharExtents( > XFontSet , > const char* , > int , > XRectangle* , > XRectangle* , > int , > int* , > XRectangle* , > XRectangle* >); > >extern void XmbDrawText( > Display* , > Drawable , > GC , > int , > int , > XmbTextItem* , > int >); > >extern void XwcDrawText( > Display* , > Drawable , > GC , > int , > int , > XwcTextItem* , > int >); > >extern void Xutf8DrawText( > Display* , > Drawable , > GC , > int , > int , > XmbTextItem* , > int >); > >extern void XmbDrawString( > Display* , > Drawable , > XFontSet , > GC , > int , > int , > const char* , > int >); > >extern void XwcDrawString( > Display* , > Drawable , > XFontSet , > GC , > int , > int , > const wchar_t* , > int >); > >extern void Xutf8DrawString( > Display* , > Drawable , > XFontSet , > GC , > int , > int , > const char* , > int >); > >extern void XmbDrawImageString( > Display* , > Drawable , > XFontSet , > GC , > int , > int , > const char* , > int >); > >extern void XwcDrawImageString( > Display* , > Drawable , > XFontSet , > GC , > int , > int , > const wchar_t* , > int >); > >extern void Xutf8DrawImageString( > Display* , > Drawable , > XFontSet , > GC , > int , > int , > const char* , > int >); > >extern XIM XOpenIM( > Display* , > struct _XrmHashBucketRec* , > char* , > char* >); > >extern int XCloseIM( > XIM >); > >extern char *XGetIMValues( > XIM , ... >); > >extern char *XSetIMValues( > XIM , ... >); > >extern Display *XDisplayOfIM( > XIM >); > >extern char *XLocaleOfIM( > XIM >); > >extern XIC XCreateIC( > XIM , ... >); > >extern void XDestroyIC( > XIC >); > >extern void XSetICFocus( > XIC >); > >extern void XUnsetICFocus( > XIC >); > >extern wchar_t *XwcResetIC( > XIC >); > >extern char *XmbResetIC( > XIC >); > >extern char *Xutf8ResetIC( > XIC >); > >extern char *XSetICValues( > XIC , ... >); > >extern char *XGetICValues( > XIC , ... >); > >extern XIM XIMOfIC( > XIC >); > >extern int XFilterEvent( > XEvent* , > Window >); > >extern int XmbLookupString( > XIC , > XKeyPressedEvent* , > char* , > int , > KeySym* , > int* >); > >extern int XwcLookupString( > XIC , > XKeyPressedEvent* , > wchar_t* , > int , > KeySym* , > int* >); > >extern int Xutf8LookupString( > XIC , > XKeyPressedEvent* , > char* , > int , > KeySym* , > int* >); > >extern XVaNestedList XVaCreateNestedList( > int , ... >); > > > >extern int XRegisterIMInstantiateCallback( > Display* , > struct _XrmHashBucketRec* , > char* , > char* , > XIDProc , > XPointer >); > >extern int XUnregisterIMInstantiateCallback( > Display* , > struct _XrmHashBucketRec* , > char* , > char* , > XIDProc , > XPointer >); > >typedef void (*XConnectionWatchProc)( > Display* , > XPointer , > int , > int , > XPointer* >); > > >extern int XInternalConnectionNumbers( > Display* , > int** , > int* >); > >extern void XProcessInternalConnection( > Display* , > int >); > >extern int XAddConnectionWatch( > Display* , > XConnectionWatchProc , > XPointer >); > >extern void XRemoveConnectionWatch( > Display* , > XConnectionWatchProc , > XPointer >); > >extern void XSetAuthorization( > char * , > int , > char * , > int >); > >extern int _Xmbtowc( > wchar_t * , > > > > > char * , > int > >); > >extern int _Xwctomb( > char * , > wchar_t >); > > ># 44 "../../../../../../exports/include/X11/Xlibint.h" 2 ># 58 "../../../../../../exports/include/X11/Xlibint.h" >struct _XGC >{ > XExtData *ext_data; > GContext gid; > int rects; > int dashes; > unsigned long dirty; > XGCValues values; >}; > >struct _XDisplay >{ > XExtData *ext_data; > struct _XFreeFuncs *free_funcs; > int fd; > int conn_checker; > int proto_major_version; > int proto_minor_version; > char *vendor; > XID resource_base; > XID resource_mask; > XID resource_id; > int resource_shift; > XID (*resource_alloc)( > struct _XDisplay* > ); > int byte_order; > int bitmap_unit; > int bitmap_pad; > int bitmap_bit_order; > int nformats; > ScreenFormat *pixmap_format; > int vnumber; > int release; > struct _XSQEvent *head, *tail; > int qlen; > unsigned long last_request_read; > unsigned long request; > char *last_req; > char *buffer; > char *bufptr; > char *bufmax; > unsigned max_request_size; > struct _XrmHashBucketRec *db; > int (*synchandler)( > struct _XDisplay* > ); > char *display_name; > int default_screen; > int nscreens; > Screen *screens; > unsigned long motion_buffer; > unsigned long flags; > int min_keycode; > int max_keycode; > KeySym *keysyms; > XModifierKeymap *modifiermap; > int keysyms_per_keycode; > char *xdefaults; > char *scratch_buffer; > unsigned long scratch_length; > int ext_number; > struct _XExten *ext_procs; ># 129 "../../../../../../exports/include/X11/Xlibint.h" > int (*event_vec[128])( > Display * , > XEvent * , > xEvent * > ); > int (*wire_vec[128])( > Display * , > XEvent * , > xEvent * > ); > KeySym lock_meaning; > struct _XLockInfo *lock; > struct _XInternalAsync *async_handlers; > unsigned long bigreq_size; > struct _XLockPtrs *lock_fns; > void (*idlist_alloc)( > Display * , > XID * , > int > ); > > struct _XKeytrans *key_bindings; > Font cursor_font; > struct _XDisplayAtoms *atoms; > unsigned int mode_switch; > unsigned int num_lock; > struct _XContextDB *context_db; > int (**error_vec)( > Display * , > XErrorEvent * , > xError * > ); > > > > struct { > XPointer defaultCCCs; > XPointer clientCmaps; > XPointer perVisualIntensityMaps; > > } cms; > struct _XIMFilter *im_filters; > struct _XSQEvent *qfree; > unsigned long next_event_serial_num; > struct _XExten *flushes; > struct _XConnectionInfo *im_fd_info; > int im_fd_length; > struct _XConnWatchInfo *conn_watchers; > int watcher_count; > XPointer filedes; > int (*savedsynchandler)( > Display * > ); > XID resource_max; > int xcmisc_opcode; > struct _XkbInfoRec *xkb_info; > struct _XtransConnInfo *trans_conn; >}; ># 201 "../../../../../../exports/include/X11/Xlibint.h" >typedef struct _XSQEvent >{ > struct _XSQEvent *next; > XEvent event; > unsigned long qserial_num; >} _XQEvent; ># 219 "../../../../../../exports/include/X11/Xlibint.h" ># 1 "/usr/include/errno.h" 1 3 4 ># 32 "/usr/include/errno.h" 3 4 > > > > ># 1 "/usr/include/bits/errno.h" 1 3 4 ># 25 "/usr/include/bits/errno.h" 3 4 ># 1 "/usr/include/linux/errno.h" 1 3 4 > > > ># 1 "/usr/include/asm/errno.h" 1 3 4 ># 5 "/usr/include/linux/errno.h" 2 3 4 ># 26 "/usr/include/bits/errno.h" 2 3 4 ># 38 "/usr/include/bits/errno.h" 3 4 >extern int *__errno_location (void) __attribute__ ((__const__)); ># 37 "/usr/include/errno.h" 2 3 4 ># 55 "/usr/include/errno.h" 3 4 >extern char *program_invocation_name, *program_invocation_short_name; > > > > ># 69 "/usr/include/errno.h" 3 4 >typedef int error_t; ># 220 "../../../../../../exports/include/X11/Xlibint.h" 2 > ># 1 "../../../../../../exports/include/X11/Xfuncs.h" 1 ># 222 "../../../../../../exports/include/X11/Xlibint.h" 2 ># 234 "../../../../../../exports/include/X11/Xlibint.h" > ># 246 "../../../../../../exports/include/X11/Xlibint.h" >typedef struct _LockInfoRec *LockInfoPtr; > > >struct _XLockPtrs { > > void (*lock_display)( > Display *dpy > > > > > ); > void (*unlock_display)( > Display *dpy > > > > > ); >}; ># 276 "../../../../../../exports/include/X11/Xlibint.h" >extern void (*_XCreateMutex_fn)( > LockInfoPtr >); >extern void (*_XFreeMutex_fn)( > LockInfoPtr >); >extern void (*_XLockMutex_fn)( > LockInfoPtr > > > > >); >extern void (*_XUnlockMutex_fn)( > LockInfoPtr > > > > >); > >extern LockInfoPtr _Xglobal_lock; ># 345 "../../../../../../exports/include/X11/Xlibint.h" ># 1 "/usr/lib/gcc-lib/i686-pc-linux-gnu/3.3.4/include/stddef.h" 1 3 4 ># 346 "../../../../../../exports/include/X11/Xlibint.h" 2 ># 581 "../../../../../../exports/include/X11/Xlibint.h" >extern void _XFlushGCCache(Display *dpy, GC gc); ># 730 "../../../../../../exports/include/X11/Xlibint.h" >typedef struct _XInternalAsync { > struct _XInternalAsync *next; ># 741 "../../../../../../exports/include/X11/Xlibint.h" > int (*handler)( > Display* , > xReply* , > char* , > int , > XPointer > ); > XPointer data; >} _XAsyncHandler; > >typedef struct _XAsyncEState { > unsigned long min_sequence_number; > unsigned long max_sequence_number; > unsigned char error_code; > unsigned char major_opcode; > unsigned short minor_opcode; > unsigned char last_error_received; > int error_count; >} _XAsyncErrorState; > >extern void _XDeqAsyncHandler(Display *dpy, _XAsyncHandler *handler); > > > > > > > >typedef void (*FreeFuncType) ( > Display* >); > >typedef int (*FreeModmapType) ( > XModifierKeymap* >); > > > > >typedef struct _XFreeFuncs { > FreeFuncType atoms; > FreeModmapType modifiermap; > FreeFuncType key_bindings; > FreeFuncType context_db; > FreeFuncType defaultCCCs; > FreeFuncType clientCmaps; > FreeFuncType intensityMaps; > FreeFuncType im_filters; > FreeFuncType xkb; >} _XFreeFuncRec; > > >typedef int (*CreateGCType) ( > Display* , > GC , > XExtCodes* >); > >typedef int (*CopyGCType)( > Display* , > GC , > XExtCodes* >); > >typedef int (*FlushGCType) ( > Display* , > GC , > XExtCodes* >); > >typedef int (*FreeGCType) ( > Display* , > GC , > XExtCodes* >); > >typedef int (*CreateFontType) ( > Display* , > XFontStruct* , > XExtCodes* >); > >typedef int (*FreeFontType) ( > Display* , > XFontStruct* , > XExtCodes* >); > >typedef int (*CloseDisplayType) ( > Display* , > XExtCodes* >); > >typedef int (*ErrorType) ( > Display* , > xError* , > XExtCodes* , > int* >); > >typedef char* (*ErrorStringType) ( > Display* , > int , > XExtCodes* , > char* , > int >); > >typedef void (*PrintErrorType)( > Display* , > XErrorEvent* , > void* >); > >typedef void (*BeforeFlushType)( > Display* , > XExtCodes* , > const char* , > long >); > > > > >typedef struct _XExten { > struct _XExten *next; > XExtCodes codes; > CreateGCType create_GC; > CopyGCType copy_GC; > FlushGCType flush_GC; > FreeGCType free_GC; > CreateFontType create_Font; > FreeFontType free_Font; > CloseDisplayType close_display; > ErrorType error; > ErrorStringType error_string; > char *name; > PrintErrorType error_values; > BeforeFlushType before_flush; > struct _XExten *next_flush; >} _XExtension; > > > > > > >extern int _XError( > Display* , > xError* >); >extern int _XIOError( > Display* >); >extern int (*_XIOErrorFunction)( > Display* >); >extern int (*_XErrorFunction)( > Display* , > XErrorEvent* >); >extern void _XEatData( > Display* , > unsigned long >); >extern char *_XAllocScratch( > Display* , > unsigned long >); >extern char *_XAllocTemp( > Display* , > unsigned long >); >extern void _XFreeTemp( > Display* , > char* , > unsigned long >); >extern Visual *_XVIDtoVisual( > Display* , > VisualID >); >extern unsigned long _XSetLastRequestRead( > Display* , > xGenericReply* >); >extern int _XGetHostname( > char* , > int >); >extern Screen *_XScreenOfWindow( > Display* , > Window >); >extern int _XAsyncErrorHandler( > Display* , > xReply* , > char* , > int , > XPointer >); >extern char *_XGetAsyncReply( > Display* , > char* , > xReply* , > char* , > int , > int , > int >); >extern void _XGetAsyncData( > Display* , > char * , > char * , > int , > int , > int , > int >); >extern void _XFlush( > Display* >); >extern int _XEventsQueued( > Display* , > int >); >extern void _XReadEvents( > Display* >); >extern int _XRead( > Display* , > char* , > long >); >extern void _XReadPad( > Display* , > char* , > long >); >extern void _XSend( > Display* , > const char* , > long >); >extern int _XReply( > Display* , > xReply* , > int , > int >); >extern void _XEnq( > Display* , > xEvent* >); >extern void _XDeq( > Display* , > _XQEvent* , > _XQEvent* >); > >extern int _XUnknownWireEvent( > Display* , > XEvent* , > xEvent* >); >extern int _XUnknownNativeEvent( > Display* , > XEvent* , > xEvent* >); > >extern int _XWireToEvent(Display *dpy, XEvent *re, xEvent *event); >extern int _XDefaultWireError(Display *display, XErrorEvent *he, xError *we); >extern int _XPollfdCacheInit(Display *dpy); >extern void _XPollfdCacheAdd(Display *dpy, int fd); >extern void _XPollfdCacheDel(Display *dpy, int fd); >extern XID _XAllocID(Display *dpy); >extern void _XAllocIDs(Display *dpy, XID *ids, int count); > >extern int _XFreeExtData( > XExtData* >); > >extern int (*XESetCreateGC( > Display* , > int , > int (*) ( > Display* , > GC , > XExtCodes* > ) >))( > Display*, GC, XExtCodes* >); > >extern int (*XESetCopyGC( > Display* , > int , > int (*) ( > Display* , > GC , > XExtCodes* > ) >))( > Display*, GC, XExtCodes* >); > >extern int (*XESetFlushGC( > Display* , > int , > int (*) ( > Display* , > GC , > XExtCodes* > ) >))( > Display*, GC, XExtCodes* >); > >extern int (*XESetFreeGC( > Display* , > int , > int (*) ( > Display* , > GC , > XExtCodes* > ) >))( > Display*, GC, XExtCodes* >); > >extern int (*XESetCreateFont( > Display* , > int , > int (*) ( > Display* , > XFontStruct* , > XExtCodes* > ) >))( > Display*, XFontStruct*, XExtCodes* >); > >extern int (*XESetFreeFont( > Display* , > int , > int (*) ( > Display* , > XFontStruct* , > XExtCodes* > ) >))( > Display*, XFontStruct*, XExtCodes* >); > >extern int (*XESetCloseDisplay( > Display* , > int , > int (*) ( > Display* , > XExtCodes* > ) >))( > Display*, XExtCodes* >); > >extern int (*XESetError( > Display* , > int , > int (*) ( > Display* , > xError* , > XExtCodes* , > int* > ) >))( > Display*, xError*, XExtCodes*, int* >); > >extern char* (*XESetErrorString( > Display* , > int , > char* (*) ( > Display* , > int , > XExtCodes* , > char* , > int > ) >))( > Display*, int, XExtCodes*, char*, int >); > >extern void (*XESetPrintErrorValues ( > Display* , > int , > void (*)( > Display* , > XErrorEvent* , > void* > ) >))( > Display*, XErrorEvent*, void* >); > >extern int (*XESetWireToEvent( > Display* , > int , > int (*) ( > Display* , > XEvent* , > xEvent* > ) >))( > Display*, XEvent*, xEvent* >); > >extern int (*XESetEventToWire( > Display* , > int , > int (*) ( > Display* , > XEvent* , > xEvent* > ) >))( > Display*, XEvent*, xEvent* >); > >extern int (*XESetWireToError( > Display* , > int , > int (*) ( > Display* , > XErrorEvent* , > xError* > ) >))( > Display*, XErrorEvent*, xError* >); > >extern void (*XESetBeforeFlush( > Display* , > int , > void (*) ( > Display* , > XExtCodes* , > const char* , > long > ) >))( > Display*, XExtCodes*, const char*, long >); > > > >typedef void (*_XInternalConnectionProc)( > Display* , > int , > XPointer >); > > >extern int _XRegisterInternalConnection( > Display* , > int , > _XInternalConnectionProc , > XPointer >); > >extern void _XUnregisterInternalConnection( > Display* , > int >); > > > >struct _XConnectionInfo { > int fd; > _XInternalConnectionProc read_callback; > XPointer call_data; > XPointer *watch_data; > struct _XConnectionInfo *next; >}; > >struct _XConnWatchInfo { > XConnectionWatchProc fn; > XPointer client_data; > struct _XConnWatchInfo *next; >}; > > > > > > > >extern int _XTextHeight( > XFontStruct* , > const char* , > int >); > >extern int _XTextHeight16( > XFontStruct* , > const XChar2b* , > int >); ># 1271 "../../../../../../exports/include/X11/Xlibint.h" >extern int _XEventToWire(Display *dpy, XEvent *re, xEvent *event); > >extern int _XF86LoadQueryLocaleFont( > Display* , > const char* , > XFontStruct** , > Font* >); > >extern void _XProcessWindowAttributes ( > register Display *dpy, > xChangeWindowAttributesReq *req, > register unsigned long valuemask, > register XSetWindowAttributes *attributes); > >extern int _XDefaultError( > Display *dpy, > XErrorEvent *event); > >extern int _XDefaultIOError( > Display *dpy); > >extern void _XSetClipRectangles ( > register Display *dpy, > GC gc, > int clip_x_origin, int clip_y_origin, > XRectangle *rectangles, > int n, > int ordering); > >int _XGetWindowAttributes( > register Display *dpy, > Window w, > XWindowAttributes *attr); > >int _XPutBackEvent ( > register Display *dpy, > register XEvent *event); > > ># 49 "../../../../../../lib/GL/glx/glxclient.h" 2 > ># 1 "../../../../../../extras/Mesa/include/GL/glx.h" 1 ># 39 "../../../../../../extras/Mesa/include/GL/glx.h" ># 1 "../../../../../../exports/include/X11/Xutil.h" 1 ># 74 "../../../../../../exports/include/X11/Xutil.h" >typedef struct { > long flags; > int x, y; > int width, height; > int min_width, min_height; > int max_width, max_height; > int width_inc, height_inc; > struct { > int x; > int y; > } min_aspect, max_aspect; > int base_width, base_height; > int win_gravity; >} XSizeHints; ># 112 "../../../../../../exports/include/X11/Xutil.h" >typedef struct { > long flags; > int input; > > int initial_state; > Pixmap icon_pixmap; > Window icon_window; > int icon_x, icon_y; > Pixmap icon_mask; > XID window_group; > >} XWMHints; ># 156 "../../../../../../exports/include/X11/Xutil.h" >typedef struct { > unsigned char *value; > Atom encoding; > int format; > unsigned long nitems; >} XTextProperty; > > > > > >typedef enum { > XStringStyle, > XCompoundTextStyle, > XTextStyle, > XStdICCTextStyle, > > XUTF8StringStyle >} XICCEncodingStyle; > >typedef struct { > int min_width, min_height; > int max_width, max_height; > int width_inc, height_inc; >} XIconSize; > >typedef struct { > char *res_name; > char *res_class; >} XClassHint; ># 224 "../../../../../../exports/include/X11/Xutil.h" >typedef struct _XComposeStatus { > XPointer compose_ptr; > int chars_matched; >} XComposeStatus; ># 266 "../../../../../../exports/include/X11/Xutil.h" >typedef struct _XRegion *Region; ># 280 "../../../../../../exports/include/X11/Xutil.h" >typedef struct { > Visual *visual; > VisualID visualid; > int screen; > int depth; > > > > int class; > > unsigned long red_mask; > unsigned long green_mask; > unsigned long blue_mask; > int colormap_size; > int bits_per_rgb; >} XVisualInfo; ># 313 "../../../../../../exports/include/X11/Xutil.h" >typedef struct { > Colormap colormap; > unsigned long red_max; > unsigned long red_mult; > unsigned long green_max; > unsigned long green_mult; > unsigned long blue_max; > unsigned long blue_mult; > unsigned long base_pixel; > VisualID visualid; > XID killid; >} XStandardColormap; ># 350 "../../../../../../exports/include/X11/Xutil.h" >typedef int XContext; > > > > > > > > >extern XClassHint *XAllocClassHint ( > void >); > >extern XIconSize *XAllocIconSize ( > void >); > >extern XSizeHints *XAllocSizeHints ( > void >); > >extern XStandardColormap *XAllocStandardColormap ( > void >); > >extern XWMHints *XAllocWMHints ( > void >); > >extern int XClipBox( > Region , > XRectangle* >); > >extern Region XCreateRegion( > void >); > >extern const char *XDefaultString (void); > >extern int XDeleteContext( > Display* , > XID , > XContext >); > >extern int XDestroyRegion( > Region >); > >extern int XEmptyRegion( > Region >); > >extern int XEqualRegion( > Region , > Region >); > >extern int XFindContext( > Display* , > XID , > XContext , > XPointer* >); > >extern int XGetClassHint( > Display* , > Window , > XClassHint* >); > >extern int XGetIconSizes( > Display* , > Window , > XIconSize** , > int* >); > >extern int XGetNormalHints( > Display* , > Window , > XSizeHints* >); > >extern int XGetRGBColormaps( > Display* , > Window , > XStandardColormap** , > int* , > Atom >); > >extern int XGetSizeHints( > Display* , > Window , > XSizeHints* , > Atom >); > >extern int XGetStandardColormap( > Display* , > Window , > XStandardColormap* , > Atom >); > >extern int XGetTextProperty( > Display* , > Window , > XTextProperty* , > Atom >); > >extern XVisualInfo *XGetVisualInfo( > Display* , > long , > XVisualInfo* , > int* >); > >extern int XGetWMClientMachine( > Display* , > Window , > XTextProperty* >); > >extern XWMHints *XGetWMHints( > Display* , > Window >); > >extern int XGetWMIconName( > Display* , > Window , > XTextProperty* >); > >extern int XGetWMName( > Display* , > Window , > XTextProperty* >); > >extern int XGetWMNormalHints( > Display* , > Window , > XSizeHints* , > long* >); > >extern int XGetWMSizeHints( > Display* , > Window , > XSizeHints* , > long* , > Atom >); > >extern int XGetZoomHints( > Display* , > Window , > XSizeHints* >); > >extern int XIntersectRegion( > Region , > Region , > Region >); > >extern void XConvertCase( > KeySym , > KeySym* , > KeySym* >); > >extern int XLookupString( > XKeyEvent* , > char* , > int , > KeySym* , > XComposeStatus* >); > >extern int XMatchVisualInfo( > Display* , > int , > int , > int , > XVisualInfo* >); > >extern int XOffsetRegion( > Region , > int , > int >); > >extern int XPointInRegion( > Region , > int , > int >); > >extern Region XPolygonRegion( > XPoint* , > int , > int >); > >extern int XRectInRegion( > Region , > int , > int , > unsigned int , > unsigned int >); > >extern int XSaveContext( > Display* , > XID , > XContext , > const char* >); > >extern int XSetClassHint( > Display* , > Window , > XClassHint* >); > >extern int XSetIconSizes( > Display* , > Window , > XIconSize* , > int >); > >extern int XSetNormalHints( > Display* , > Window , > XSizeHints* >); > >extern void XSetRGBColormaps( > Display* , > Window , > XStandardColormap* , > int , > Atom >); > >extern int XSetSizeHints( > Display* , > Window , > XSizeHints* , > Atom >); > >extern int XSetStandardProperties( > Display* , > Window , > const char* , > const char* , > Pixmap , > char** , > int , > XSizeHints* >); > >extern void XSetTextProperty( > Display* , > Window , > XTextProperty* , > Atom >); > >extern void XSetWMClientMachine( > Display* , > Window , > XTextProperty* >); > >extern int XSetWMHints( > Display* , > Window , > XWMHints* >); > >extern void XSetWMIconName( > Display* , > Window , > XTextProperty* >); > >extern void XSetWMName( > Display* , > Window , > XTextProperty* >); > >extern void XSetWMNormalHints( > Display* , > Window , > XSizeHints* >); > >extern void XSetWMProperties( > Display* , > Window , > XTextProperty* , > XTextProperty* , > char** , > int , > XSizeHints* , > XWMHints* , > XClassHint* >); > >extern void XmbSetWMProperties( > Display* , > Window , > const char* , > const char* , > char** , > int , > XSizeHints* , > XWMHints* , > XClassHint* >); > >extern void Xutf8SetWMProperties( > Display* , > Window , > const char* , > const char* , > char** , > int , > XSizeHints* , > XWMHints* , > XClassHint* >); > >extern void XSetWMSizeHints( > Display* , > Window , > XSizeHints* , > Atom >); > >extern int XSetRegion( > Display* , > GC , > Region >); > >extern void XSetStandardColormap( > Display* , > Window , > XStandardColormap* , > Atom >); > >extern int XSetZoomHints( > Display* , > Window , > XSizeHints* >); > >extern int XShrinkRegion( > Region , > int , > int >); > >extern int XStringListToTextProperty( > char** , > int , > XTextProperty* >); > >extern int XSubtractRegion( > Region , > Region , > Region >); > >extern int XmbTextListToTextProperty( > Display* display, > char** list, > int count, > XICCEncodingStyle style, > XTextProperty* text_prop_return >); > >extern int XwcTextListToTextProperty( > Display* display, > wchar_t** list, > int count, > XICCEncodingStyle style, > XTextProperty* text_prop_return >); > >extern int Xutf8TextListToTextProperty( > Display* display, > char** list, > int count, > XICCEncodingStyle style, > XTextProperty* text_prop_return >); > >extern void XwcFreeStringList( > wchar_t** list >); > >extern int XTextPropertyToStringList( > XTextProperty* , > char*** , > int* >); > >extern int XmbTextPropertyToTextList( > Display* display, > const XTextProperty* text_prop, > char*** list_return, > int* count_return >); > >extern int XwcTextPropertyToTextList( > Display* display, > const XTextProperty* text_prop, > wchar_t*** list_return, > int* count_return >); > >extern int Xutf8TextPropertyToTextList( > Display* display, > const XTextProperty* text_prop, > char*** list_return, > int* count_return >); > >extern int XUnionRectWithRegion( > XRectangle* , > Region , > Region >); > >extern int XUnionRegion( > Region , > Region , > Region >); > >extern int XWMGeometry( > Display* , > int , > const char* , > const char* , > unsigned int , > XSizeHints* , > int* , > int* , > int* , > int* , > int* >); > >extern int XXorRegion( > Region , > Region , > Region >); > > ># 40 "../../../../../../extras/Mesa/include/GL/glx.h" 2 ># 178 "../../../../../../extras/Mesa/include/GL/glx.h" >typedef struct __GLXcontextRec *GLXContext; >typedef XID GLXPixmap; >typedef XID GLXDrawable; > >typedef struct __GLXFBConfigRec *GLXFBConfig; >typedef XID GLXFBConfigID; >typedef XID GLXContextID; >typedef XID GLXWindow; >typedef XID GLXPbuffer; > > > >extern XVisualInfo* glXChooseVisual( Display *dpy, int screen, > int *attribList ); > >extern GLXContext glXCreateContext( Display *dpy, XVisualInfo *vis, > GLXContext shareList, int direct ); > >extern void glXDestroyContext( Display *dpy, GLXContext ctx ); > >extern int glXMakeCurrent( Display *dpy, GLXDrawable drawable, > GLXContext ctx); > >extern void glXCopyContext( Display *dpy, GLXContext src, GLXContext dst, > unsigned long mask ); > >extern void glXSwapBuffers( Display *dpy, GLXDrawable drawable ); > >extern GLXPixmap glXCreateGLXPixmap( Display *dpy, XVisualInfo *visual, > Pixmap pixmap ); > >extern void glXDestroyGLXPixmap( Display *dpy, GLXPixmap pixmap ); > >extern int glXQueryExtension( Display *dpy, int *errorb, int *event ); > >extern int glXQueryVersion( Display *dpy, int *maj, int *min ); > >extern int glXIsDirect( Display *dpy, GLXContext ctx ); > >extern int glXGetConfig( Display *dpy, XVisualInfo *visual, > int attrib, int *value ); > >extern GLXContext glXGetCurrentContext( void ); > >extern GLXDrawable glXGetCurrentDrawable( void ); > >extern void glXWaitGL( void ); > >extern void glXWaitX( void ); > >extern void glXUseXFont( Font font, int first, int count, int list ); > > > > >extern const char *glXQueryExtensionsString( Display *dpy, int screen ); > >extern const char *glXQueryServerString( Display *dpy, int screen, int name ); > >extern const char *glXGetClientString( Display *dpy, int name ); > > > >extern Display *glXGetCurrentDisplay( void ); > > > >extern GLXFBConfig *glXChooseFBConfig( Display *dpy, int screen, > const int *attribList, int *nitems ); > >extern int glXGetFBConfigAttrib( Display *dpy, GLXFBConfig config, > int attribute, int *value ); > >extern GLXFBConfig *glXGetFBConfigs( Display *dpy, int screen, > int *nelements ); > >extern XVisualInfo *glXGetVisualFromFBConfig( Display *dpy, > GLXFBConfig config ); > >extern GLXWindow glXCreateWindow( Display *dpy, GLXFBConfig config, > Window win, const int *attribList ); > >extern void glXDestroyWindow( Display *dpy, GLXWindow window ); > >extern GLXPixmap glXCreatePixmap( Display *dpy, GLXFBConfig config, > Pixmap pixmap, const int *attribList ); > >extern void glXDestroyPixmap( Display *dpy, GLXPixmap pixmap ); > >extern GLXPbuffer glXCreatePbuffer( Display *dpy, GLXFBConfig config, > const int *attribList ); > >extern void glXDestroyPbuffer( Display *dpy, GLXPbuffer pbuf ); > >extern void glXQueryDrawable( Display *dpy, GLXDrawable draw, int attribute, > unsigned int *value ); > >extern GLXContext glXCreateNewContext( Display *dpy, GLXFBConfig config, > int renderType, GLXContext shareList, > int direct ); > >extern int glXMakeContextCurrent( Display *dpy, GLXDrawable draw, > GLXDrawable read, GLXContext ctx ); > >extern GLXDrawable glXGetCurrentReadDrawable( void ); > >extern int glXQueryContext( Display *dpy, GLXContext ctx, int attribute, > int *value ); > >extern void glXSelectEvent( Display *dpy, GLXDrawable drawable, > unsigned long mask ); > >extern void glXGetSelectedEvent( Display *dpy, GLXDrawable drawable, > unsigned long *mask ); > > > >extern void (*glXGetProcAddress(const GLubyte *procname))( void ); > > > > ># 1 "../../../../../../extras/Mesa/include/GL/glxext.h" 1 ># 305 "../../../../../../extras/Mesa/include/GL/glxext.h" >typedef void (*__GLXextFuncPtr)(void); > > > >typedef XID GLXVideoSourceSGIX; > > > >typedef XID GLXFBConfigIDSGIX; >typedef struct __GLXFBConfigRec *GLXFBConfigSGIX; > > > >typedef XID GLXPbufferSGIX; >typedef struct { > int type; > unsigned long serial; > int send_event; > Display *display; > GLXDrawable drawable; > int event_type; > int draw_type; > unsigned int mask; > int x, y; > int width, height; > int count; >} GLXBufferClobberEventSGIX; ># 387 "../../../../../../extras/Mesa/include/GL/glxext.h" >extern __GLXextFuncPtr glXGetProcAddressARB (const GLubyte *); > >typedef __GLXextFuncPtr ( * PFNGLXGETPROCADDRESSARBPROC) (const GLubyte *procName); ># 407 "../../../../../../extras/Mesa/include/GL/glxext.h" >extern int glXSwapIntervalSGI (int); > >typedef int ( * PFNGLXSWAPINTERVALSGIPROC) (int interval); > > > > > >extern int glXGetVideoSyncSGI (unsigned int *); >extern int glXWaitVideoSyncSGI (int, int, unsigned int *); > >typedef int ( * PFNGLXGETVIDEOSYNCSGIPROC) (unsigned int *count); >typedef int ( * PFNGLXWAITVIDEOSYNCSGIPROC) (int divisor, int remainder, unsigned int *count); > > > > > >extern int glXMakeCurrentReadSGI (Display *, GLXDrawable, GLXDrawable, GLXContext); >extern GLXDrawable glXGetCurrentReadDrawableSGI (void); > >typedef int ( * PFNGLXMAKECURRENTREADSGIPROC) (Display *dpy, GLXDrawable draw, GLXDrawable read, GLXContext ctx); >typedef GLXDrawable ( * PFNGLXGETCURRENTREADDRAWABLESGIPROC) (void); ># 451 "../../../../../../extras/Mesa/include/GL/glxext.h" >extern Display * glXGetCurrentDisplayEXT (void); >extern int glXQueryContextInfoEXT (Display *, GLXContext, int, int *); >extern GLXContextID glXGetContextIDEXT (const GLXContext); >extern GLXContext glXImportContextEXT (Display *, GLXContextID); >extern void glXFreeContextEXT (Display *, GLXContext); > >typedef Display * ( * PFNGLXGETCURRENTDISPLAYEXTPROC) (void); >typedef int ( * PFNGLXQUERYCONTEXTINFOEXTPROC) (Display *dpy, GLXContext context, int attribute, int *value); >typedef GLXContextID ( * PFNGLXGETCONTEXTIDEXTPROC) (const GLXContext context); >typedef GLXContext ( * PFNGLXIMPORTCONTEXTEXTPROC) (Display *dpy, GLXContextID contextID); >typedef void ( * PFNGLXFREECONTEXTEXTPROC) (Display *dpy, GLXContext context); > > > > > >extern int glXGetFBConfigAttribSGIX (Display *, GLXFBConfigSGIX, int, int *); >extern GLXFBConfigSGIX * glXChooseFBConfigSGIX (Display *, int, int *, int *); >extern GLXPixmap glXCreateGLXPixmapWithConfigSGIX (Display *, GLXFBConfigSGIX, Pixmap); >extern GLXContext glXCreateContextWithConfigSGIX (Display *, GLXFBConfigSGIX, int, GLXContext, int); >extern XVisualInfo * glXGetVisualFromFBConfigSGIX (Display *, GLXFBConfigSGIX); >extern GLXFBConfigSGIX glXGetFBConfigFromVisualSGIX (Display *, XVisualInfo *); > >typedef int ( * PFNGLXGETFBCONFIGATTRIBSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, int attribute, int *value); >typedef GLXFBConfigSGIX * ( * PFNGLXCHOOSEFBCONFIGSGIXPROC) (Display *dpy, int screen, int *attrib_list, int *nelements); >typedef GLXPixmap ( * PFNGLXCREATEGLXPIXMAPWITHCONFIGSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, Pixmap pixmap); >typedef GLXContext ( * PFNGLXCREATECONTEXTWITHCONFIGSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, int render_type, GLXContext share_list, int direct); >typedef XVisualInfo * ( * PFNGLXGETVISUALFROMFBCONFIGSGIXPROC) (Display *dpy, GLXFBConfigSGIX config); >typedef GLXFBConfigSGIX ( * PFNGLXGETFBCONFIGFROMVISUALSGIXPROC) (Display *dpy, XVisualInfo *vis); > > > > > >extern GLXPbufferSGIX glXCreateGLXPbufferSGIX (Display *, GLXFBConfigSGIX, unsigned int, unsigned int, int *); >extern void glXDestroyGLXPbufferSGIX (Display *, GLXPbufferSGIX); >extern int glXQueryGLXPbufferSGIX (Display *, GLXPbufferSGIX, int, unsigned int *); >extern void glXSelectEventSGIX (Display *, GLXDrawable, unsigned long); >extern void glXGetSelectedEventSGIX (Display *, GLXDrawable, unsigned long *); > >typedef GLXPbufferSGIX ( * PFNGLXCREATEGLXPBUFFERSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, unsigned int width, unsigned int height, int *attrib_list); >typedef void ( * PFNGLXDESTROYGLXPBUFFERSGIXPROC) (Display *dpy, GLXPbufferSGIX pbuf); >typedef int ( * PFNGLXQUERYGLXPBUFFERSGIXPROC) (Display *dpy, GLXPbufferSGIX pbuf, int attribute, unsigned int *value); >typedef void ( * PFNGLXSELECTEVENTSGIXPROC) (Display *dpy, GLXDrawable drawable, unsigned long mask); >typedef void ( * PFNGLXGETSELECTEDEVENTSGIXPROC) (Display *dpy, GLXDrawable drawable, unsigned long *mask); > > > > > >extern void glXCushionSGI (Display *, Window, float); > >typedef void ( * PFNGLXCUSHIONSGIPROC) (Display *dpy, Window window, float cushion); > > > > > >extern int glXBindChannelToWindowSGIX (Display *, int, int, Window); >extern int glXChannelRectSGIX (Display *, int, int, int, int, int, int); >extern int glXQueryChannelRectSGIX (Display *, int, int, int *, int *, int *, int *); >extern int glXQueryChannelDeltasSGIX (Display *, int, int, int *, int *, int *, int *); >extern int glXChannelRectSyncSGIX (Display *, int, int, GLenum); > >typedef int ( * PFNGLXBINDCHANNELTOWINDOWSGIXPROC) (Display *display, int screen, int channel, Window window); >typedef int ( * PFNGLXCHANNELRECTSGIXPROC) (Display *display, int screen, int channel, int x, int y, int w, int h); >typedef int ( * PFNGLXQUERYCHANNELRECTSGIXPROC) (Display *display, int screen, int channel, int *dx, int *dy, int *dw, int *dh); >typedef int ( * PFNGLXQUERYCHANNELDELTASSGIXPROC) (Display *display, int screen, int channel, int *x, int *y, int *w, int *h); >typedef int ( * PFNGLXCHANNELRECTSYNCSGIXPROC) (Display *display, int screen, int channel, GLenum synctype); ># 535 "../../../../../../extras/Mesa/include/GL/glxext.h" >extern void glXJoinSwapGroupSGIX (Display *, GLXDrawable, GLXDrawable); > >typedef void ( * PFNGLXJOINSWAPGROUPSGIXPROC) (Display *dpy, GLXDrawable drawable, GLXDrawable member); > > > > > >extern void glXBindSwapBarrierSGIX (Display *, GLXDrawable, int); >extern int glXQueryMaxSwapBarriersSGIX (Display *, int, int *); > >typedef void ( * PFNGLXBINDSWAPBARRIERSGIXPROC) (Display *dpy, GLXDrawable drawable, int barrier); >typedef int ( * PFNGLXQUERYMAXSWAPBARRIERSSGIXPROC) (Display *dpy, int screen, int *max); > > > > > >extern int glXGetTransparentIndexSUN (Display *, Window, Window, long *); > >typedef int ( * PFNGLXGETTRANSPARENTINDEXSUNPROC) (Display *dpy, Window overlay, Window underlay, long *pTransparentIndex); > > > > > >extern void glXCopySubBufferMESA (Display *, GLXDrawable, int, int, int, int); > >typedef void ( * PFNGLXCOPYSUBBUFFERMESAPROC) (Display *dpy, GLXDrawable drawable, int x, int y, int width, int height); > > > > > >extern GLXPixmap glXCreateGLXPixmapMESA (Display *, XVisualInfo *, Pixmap, Colormap); > >typedef GLXPixmap ( * PFNGLXCREATEGLXPIXMAPMESAPROC) (Display *dpy, XVisualInfo *visual, Pixmap pixmap, Colormap cmap); > > > > > >extern int glXReleaseBuffersMESA (Display *, GLXDrawable); > >typedef int ( * PFNGLXRELEASEBUFFERSMESAPROC) (Display *dpy, GLXDrawable drawable); > > > > > >extern int glXSet3DfxModeMESA (int); > >typedef int ( * PFNGLXSET3DFXMODEMESAPROC) (int mode); ># 624 "../../../../../../extras/Mesa/include/GL/glxext.h" >typedef struct { > char pipeName[80]; > int networkId; >} GLXHyperpipeNetworkSGIX; > >typedef struct { > char pipeName[80]; > int channel; > unsigned int > participationType; > int timeSlice; >} GLXHyperpipeConfigSGIX; > >typedef struct { > char pipeName[80]; > int srcXOrigin, srcYOrigin, srcWidth, srcHeight; > int destXOrigin, destYOrigin, destWidth, destHeight; >} GLXPipeRect; > >typedef struct { > char pipeName[80]; > int XOrigin, YOrigin, maxHeight, maxWidth; >} GLXPipeRectLimits; > > >extern GLXHyperpipeNetworkSGIX * glXQueryHyperpipeNetworkSGIX (Display *, int *); >extern int glXHyperpipeConfigSGIX (Display *, int, int, GLXHyperpipeConfigSGIX *, int *); >extern GLXHyperpipeConfigSGIX * glXQueryHyperpipeConfigSGIX (Display *, int, int *); >extern int glXDestroyHyperpipeConfigSGIX (Display *, int); >extern int glXBindHyperpipeSGIX (Display *, int); >extern int glXQueryHyperpipeBestAttribSGIX (Display *, int, int, int, void *, void *); >extern int glXHyperpipeAttribSGIX (Display *, int, int, int, void *); >extern int glXQueryHyperpipeAttribSGIX (Display *, int, int, int, void *); > >typedef GLXHyperpipeNetworkSGIX * ( * PFNGLXQUERYHYPERPIPENETWORKSGIXPROC) (Display *dpy, int *npipes); >typedef int ( * PFNGLXHYPERPIPECONFIGSGIXPROC) (Display *dpy, int networkId, int npipes, GLXHyperpipeConfigSGIX *cfg, int *hpId); >typedef GLXHyperpipeConfigSGIX * ( * PFNGLXQUERYHYPERPIPECONFIGSGIXPROC) (Display *dpy, int hpId, int *npipes); >typedef int ( * PFNGLXDESTROYHYPERPIPECONFIGSGIXPROC) (Display *dpy, int hpId); >typedef int ( * PFNGLXBINDHYPERPIPESGIXPROC) (Display *dpy, int hpId); >typedef int ( * PFNGLXQUERYHYPERPIPEBESTATTRIBSGIXPROC) (Display *dpy, int timeSlice, int attrib, int size, void *attribList, void *returnAttribList); >typedef int ( * PFNGLXHYPERPIPEATTRIBSGIXPROC) (Display *dpy, int timeSlice, int attrib, int size, void *attribList); >typedef int ( * PFNGLXQUERYHYPERPIPEATTRIBSGIXPROC) (Display *dpy, int timeSlice, int attrib, int size, void *returnAttribList); > > > > > >extern unsigned int glXGetAGPOffsetMESA (const void *); > >typedef unsigned int ( * PFNGLXGETAGPOFFSETMESAPROC) (const void *pointer); ># 301 "../../../../../../extras/Mesa/include/GL/glx.h" 2 ># 464 "../../../../../../extras/Mesa/include/GL/glx.h" >extern void *glXAllocateMemoryNV(GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority); >extern void glXFreeMemoryNV(GLvoid *pointer); >typedef void * ( * PFNGLXALLOCATEMEMORYNVPROC) (GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority); >typedef void ( * PFNGLXFREEMEMORYNVPROC) (GLvoid *pointer); ># 491 "../../../../../../extras/Mesa/include/GL/glx.h" >extern int glXBindTexImageARB(Display *dpy, GLXPbuffer pbuffer, int buffer); >extern int glXReleaseTexImageARB(Display *dpy, GLXPbuffer pbuffer, int buffer); >extern int glXDrawableAttribARB(Display *dpy, GLXDrawable draw, const int *attribList); ># 51 "../../../../../../lib/GL/glx/glxclient.h" 2 > > > > ># 1 "../../../../../../exports/include/GL/glxint.h" 1 ># 27 "../../../../../../exports/include/GL/glxint.h" ># 1 "../../../../../../exports/include/X11/Xdefs.h" 1 ># 55 "../../../../../../exports/include/X11/Xdefs.h" >typedef void *pointer; > > > >typedef struct _Client *ClientPtr; ># 83 "../../../../../../exports/include/X11/Xdefs.h" >typedef struct _Font *FontPtr; ># 93 "../../../../../../exports/include/X11/Xdefs.h" >typedef unsigned long FSID; > > > > > >typedef FSID AccContext; > > > >typedef struct timeval **OSTimePtr; > > >typedef void (* BlockHandlerProcPtr)(pointer , > OSTimePtr , > pointer ); ># 28 "../../../../../../exports/include/GL/glxint.h" 2 > > >typedef struct __GLXvisualConfigRec __GLXvisualConfig; >typedef struct __GLXFBConfigRec __GLXFBConfig; > >struct __GLXvisualConfigRec { > VisualID vid; > int class; > int rgba; > int redSize, greenSize, blueSize, alphaSize; > unsigned long redMask, greenMask, blueMask, alphaMask; > int accumRedSize, accumGreenSize, accumBlueSize, accumAlphaSize; > int doubleBuffer; > int stereo; > int bufferSize; > int depthSize; > int stencilSize; > int auxBuffers; > int level; > > int visualRating; > int transparentPixel; > > int transparentRed, transparentGreen, transparentBlue, transparentAlpha; > int transparentIndex; > int multiSampleSize; > int nMultiSampleBuffers; > int visualSelectGroup; >}; ># 73 "../../../../../../exports/include/GL/glxint.h" >struct __GLXFBConfigRec { > int visualType; > int transparentType; > > int transparentRed, transparentGreen, transparentBlue, transparentAlpha; > int transparentIndex; > > int visualCaveat; > > int associatedVisualId; > int screen; > > int drawableType; > int renderType; > > int maxPbufferWidth, maxPbufferHeight, maxPbufferPixels; > int optimalPbufferWidth, optimalPbufferHeight; > > int visualSelectGroup; > > unsigned int id; > > GLboolean rgbMode; > GLboolean colorIndexMode; > GLboolean doubleBufferMode; > GLboolean stereoMode; > GLboolean haveAccumBuffer; > GLboolean haveDepthBuffer; > GLboolean haveStencilBuffer; > > > GLint accumRedBits, accumGreenBits, accumBlueBits, accumAlphaBits; > GLint depthBits; > GLint stencilBits; > GLint indexBits; > GLint redBits, greenBits, blueBits, alphaBits; > GLuint redMask, greenMask, blueMask, alphaMask; > > GLuint multiSampleSize; > > GLuint nMultiSampleBuffers; > GLint maxAuxBuffers; > > > GLint level; > > > GLboolean extendedRange; > GLdouble minRed, maxRed; > GLdouble minGreen, maxGreen; > GLdouble minBlue, maxBlue; > GLdouble minAlpha, maxAlpha; >}; ># 56 "../../../../../../lib/GL/glx/glxclient.h" 2 ># 1 "../../../../../../exports/include/GL/glxproto.h" 1 ># 39 "../../../../../../exports/include/GL/glxproto.h" ># 1 "../../../../../../exports/include/GL/glxmd.h" 1 ># 46 "../../../../../../exports/include/GL/glxmd.h" >typedef float FLOAT32; >typedef double FLOAT64; ># 40 "../../../../../../exports/include/GL/glxproto.h" 2 ># 106 "../../../../../../exports/include/GL/glxproto.h" >typedef CARD32 GLXContextTag; ># 130 "../../../../../../exports/include/GL/glxproto.h" >typedef struct GLXRender { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; >} xGLXRenderReq; ># 150 "../../../../../../exports/include/GL/glxproto.h" >typedef struct GLXRenderLarge { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; > CARD16 requestNumber ; > CARD16 requestTotal ; > CARD32 dataBytes ; >} xGLXRenderLargeReq; > > > > > > > >typedef struct GLXSingle { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; >} xGLXSingleReq; > > > > > >typedef struct GLXQueryVersion { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 majorVersion ; > CARD32 minorVersion ; >} xGLXQueryVersionReq; > > > > > >typedef struct GLXIsDirect { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 context ; >} xGLXIsDirectReq; > > > > > >typedef struct GLXCreateContext { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 context ; > CARD32 visual ; > CARD32 screen ; > CARD32 shareList ; > BOOL isDirect; > CARD8 reserved1; > CARD16 reserved2 ; >} xGLXCreateContextReq; > > > > > >typedef struct GLXDestroyContext { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 context ; >} xGLXDestroyContextReq; > > > > > >typedef struct GLXMakeCurrent { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 drawable ; > CARD32 context ; > GLXContextTag oldContextTag ; >} xGLXMakeCurrentReq; > > > > > >typedef struct GLXWaitGL { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; >} xGLXWaitGLReq; > > > > > >typedef struct GLXWaitX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; >} xGLXWaitXReq; > > > > > >typedef struct GLXCopyContext { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 source ; > CARD32 dest ; > CARD32 mask ; > GLXContextTag contextTag ; >} xGLXCopyContextReq; > > > > > >typedef struct GLXSwapBuffers { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; > CARD32 drawable ; >} xGLXSwapBuffersReq; > > > > > >typedef struct GLXUseXFont { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag contextTag ; > CARD32 font ; > CARD32 first ; > CARD32 count ; > CARD32 listBase ; >} xGLXUseXFontReq; > > > > > >typedef struct GLXCreateGLXPixmap { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; > CARD32 visual ; > CARD32 pixmap ; > CARD32 glxpixmap ; >} xGLXCreateGLXPixmapReq; > > > > > >typedef struct GLXDestroyGLXPixmap { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 glxpixmap ; >} xGLXDestroyGLXPixmapReq; > > > > > >typedef struct GLXGetVisualConfigs { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; >} xGLXGetVisualConfigsReq; > > > > > >typedef struct GLXVendorPrivate { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > GLXContextTag contextTag ; > > > >} xGLXVendorPrivateReq; > > > > > >typedef struct GLXVendorPrivateWithReply { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > GLXContextTag contextTag ; > > > >} xGLXVendorPrivateWithReplyReq; > > > > > >typedef struct GLXQueryExtensionsString { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; >} xGLXQueryExtensionsStringReq; > > > > > >typedef struct GLXQueryServerString { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; > CARD32 name ; >} xGLXQueryServerStringReq; > > > > > >typedef struct GLXClientInfo { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 major ; > CARD32 minor ; > CARD32 numbytes ; >} xGLXClientInfoReq; > > > > > > > >typedef struct GLXGetFBConfigs { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; >} xGLXGetFBConfigsReq; > > > > > >typedef struct GLXCreatePixmap { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; > CARD32 fbconfig ; > CARD32 pixmap ; > CARD32 glxpixmap ; > CARD32 numAttribs ; > >} xGLXCreatePixmapReq; > > > > > >typedef struct GLXDestroyPixmap { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 glxpixmap ; >} xGLXDestroyPixmapReq; > > > > > >typedef struct GLXCreateNewContext { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 context ; > CARD32 fbconfig ; > CARD32 screen ; > CARD32 renderType; > CARD32 shareList ; > BOOL isDirect; > CARD8 reserved1; > CARD16 reserved2 ; >} xGLXCreateNewContextReq; > > > > > >typedef struct GLXQueryContext { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 context ; >} xGLXQueryContextReq; > > > > > >typedef struct GLXMakeContextCurrent { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > GLXContextTag oldContextTag ; > CARD32 drawable ; > CARD32 readdrawable ; > CARD32 context ; >} xGLXMakeContextCurrentReq; > > > > > >typedef struct GLXCreatePbuffer { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; > CARD32 fbconfig ; > CARD32 pbuffer ; > CARD32 numAttribs ; > >} xGLXCreatePbufferReq; > > > > > >typedef struct GLXDestroyPbuffer { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 pbuffer ; >} xGLXDestroyPbufferReq; > > > > > >typedef struct GLXGetDrawableAttributes { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 drawable ; >} xGLXGetDrawableAttributesReq; > > > > > >typedef struct GLXChangeDrawableAttributes { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 drawable ; > CARD32 numAttribs ; > >} xGLXChangeDrawableAttributesReq; > > > > > >typedef struct GLXCreateWindow { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 screen ; > CARD32 fbconfig ; > CARD32 window ; > CARD32 glxwindow ; > CARD32 numAttribs ; > >} xGLXCreateWindowReq; > > > > > >typedef struct GLXDestroyWindow { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 glxwindow ; >} xGLXDestroyWindowReq; > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 error ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetErrorReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > GLXContextTag contextTag ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXMakeCurrentReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXReadPixelsReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 width ; > CARD32 height ; > CARD32 depth ; > CARD32 pad6 ; >} xGLXGetTexImageReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 width ; > CARD32 height ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetSeparableFilterReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 width ; > CARD32 height ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetConvolutionFilterReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 width ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetHistogramReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetMinmaxReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 retval ; > CARD32 size ; > CARD32 newMode ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXRenderModeReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 majorVersion ; > CARD32 minorVersion ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXQueryVersionReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 numVisuals ; > CARD32 numProps ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetVisualConfigsReply; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > BOOL isDirect; > CARD8 pad1; > CARD16 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; > CARD32 pad7 ; >} xGLXIsDirectReply; > > > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 retval ; > CARD32 size ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXSingleReply; ># 760 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 retval ; > CARD32 size ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXVendorPrivReply; > > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 n ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXQueryExtensionsStringReply; > > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 n ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXQueryServerStringReply; > > > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 numFBConfigs ; > CARD32 numAttribs ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetFBConfigsReply; > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 n ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXQueryContextReply; > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > GLXContextTag contextTag ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXMakeContextCurrentReply; > > > > > > > >typedef struct { > BYTE type; > CARD8 success; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXCreateGLXPbufferReply; > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 numAttribs ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetDrawableAttributesReply; > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 pad1 ; > CARD32 pad2 ; > CARD32 width ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXGetColorTableReply; ># 923 "../../../../../../exports/include/GL/glxproto.h" >typedef struct GLXQueryContextInfoEXT { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 pad1 ; > CARD32 context ; >} xGLXQueryContextInfoEXTReq; > > > > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 n ; > CARD32 pad2 ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXQueryContextInfoEXTReply; > > > > > >typedef struct GLXMakeCurrentReadSGI { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > GLXContextTag oldContextTag ; > CARD32 drawable ; > CARD32 readable ; > CARD32 context ; >} xGLXMakeCurrentReadSGIReq; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > GLXContextTag contextTag ; > CARD32 writeVid ; > CARD32 writeType ; > CARD32 readVid ; > CARD32 readType ; > CARD32 pad6 ; >} xGLXMakeCurrentReadSGIReply; > > > > > >typedef struct GLXGetFBConfigsSGIX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 pad1 ; > CARD32 screen ; >} xGLXGetFBConfigsSGIXReq; > > > > > > >typedef struct GLXCreateContextWithConfigSGIX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 pad1 ; > CARD32 context ; > CARD32 fbconfig ; > CARD32 screen ; > CARD32 renderType; > CARD32 shareList ; > BOOL isDirect; > CARD8 reserved1; > CARD16 reserved2 ; >} xGLXCreateContextWithConfigSGIXReq; > > > > > > >typedef struct GLXCreateGLXPixmapWithConfigSGIX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 pad1 ; > CARD32 screen ; > CARD32 fbconfig ; > CARD32 pixmap ; > CARD32 glxpixmap ; >} xGLXCreateGLXPixmapWithConfigSGIXReq; > > > > > >typedef struct GLXJoinSwapGroupSGIX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 unused ; > CARD32 drawable ; > CARD32 member ; >} xGLXJoinSwapGroupSGIXReq; > > > > > >typedef struct GLXBindSwapBarrierSGIX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 unused ; > CARD32 drawable ; > CARD32 barrier ; >} xGLXBindSwapBarrierSGIXReq; > > > > > >typedef struct GLXQueryMaxSwapBarriersSGIX { > CARD8 reqType; > CARD8 glxCode; > CARD16 length ; > CARD32 vendorCode ; > CARD32 unused ; > CARD32 screen ; >} xGLXQueryMaxSwapBarriersSGIXReq; > > >typedef struct { > BYTE type; > CARD8 unused; > CARD16 sequenceNumber ; > CARD32 length ; > CARD32 max ; > CARD32 size ; > CARD32 pad3 ; > CARD32 pad4 ; > CARD32 pad5 ; > CARD32 pad6 ; >} xGLXQueryMaxSwapBarriersSGIXReply; ># 1091 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > BYTE type; > BYTE pad; > CARD16 sequenceNumber ; > CARD16 event_type ; > CARD16 draw_type ; > CARD32 drawable ; > CARD32 buffer_mask ; > CARD16 aux_buffer ; > CARD16 x ; > CARD16 y ; > CARD16 width ; > CARD16 height ; > CARD16 count ; > CARD32 unused2 ; >} xGLXPbufferClobberEvent; ># 1122 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; >} __GLXrenderHeader; > > > > > > > >typedef struct { > CARD32 length ; CARD32 opcode ; >} __GLXrenderLargeHeader; ># 1154 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; >} __GLXpixelHeader; ># 1194 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 width ; CARD32 height ; FLOAT32 xorig ; FLOAT32 yorig ; FLOAT32 xmove ; FLOAT32 ymove ; >} __GLXbitmapHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 width ; CARD32 height ; FLOAT32 xorig ; FLOAT32 yorig ; FLOAT32 xmove ; FLOAT32 ymove ; >} __GLXbitmapLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 width ; CARD32 height ; FLOAT32 xorig ; FLOAT32 yorig ; FLOAT32 xmove ; FLOAT32 ymove ; >} __GLXdispatchBitmapHeader; ># 1219 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; >} __GLXpolygonStippleHeader; ># 1253 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 components ; CARD32 width ; CARD32 height ; CARD32 border ; CARD32 format ; CARD32 type ; >} __GLXtexImageHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 components ; CARD32 width ; CARD32 height ; CARD32 border ; CARD32 format ; CARD32 type ; >} __GLXtexImageLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 components ; CARD32 width ; CARD32 height ; CARD32 border ; CARD32 format ; CARD32 type ; >} __GLXdispatchTexImageHeader; ># 1303 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 imageHeight ; CARD32 imageDepth ; CARD32 skipRows ; CARD32 skipImages ; CARD32 skipVolumes ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 internalformat ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 size4d ; CARD32 border ; CARD32 format ; CARD32 type ; CARD32 nullimage ; >} __GLXtexImage3DHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 imageHeight ; CARD32 imageDepth ; CARD32 skipRows ; CARD32 skipImages ; CARD32 skipVolumes ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 internalformat ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 size4d ; CARD32 border ; CARD32 format ; CARD32 type ; CARD32 nullimage ; >} __GLXtexImage3DLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 imageHeight ; CARD32 imageDepth ; CARD32 skipRows ; CARD32 skipImages ; CARD32 skipVolumes ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 internalformat ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 size4d ; CARD32 border ; CARD32 format ; CARD32 type ; CARD32 nullimage ; >} __GLXdispatchTexImage3DHeader; ># 1348 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; CARD32 nullImage; >} __GLXtexSubImageHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; CARD32 nullImage; >} __GLXtexSubImageLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; CARD32 nullImage; >} __GLXdispatchTexSubImageHeader; ># 1398 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 imageHeight ; CARD32 imageDepth ; CARD32 skipRows ; CARD32 skipImages ; CARD32 skipVolumes ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 zoffset ; CARD32 woffset ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 size4d ; CARD32 format ; CARD32 type ; CARD32 nullImage; >} __GLXtexSubImage3DHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 imageHeight ; CARD32 imageDepth ; CARD32 skipRows ; CARD32 skipImages ; CARD32 skipVolumes ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 zoffset ; CARD32 woffset ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 size4d ; CARD32 format ; CARD32 type ; CARD32 nullImage; >} __GLXtexSubImage3DLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 imageHeight ; CARD32 imageDepth ; CARD32 skipRows ; CARD32 skipImages ; CARD32 skipVolumes ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 zoffset ; CARD32 woffset ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 size4d ; CARD32 format ; CARD32 type ; CARD32 nullImage; >} __GLXdispatchTexSubImage3DHeader; ># 1443 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > CARD32 target ; CARD32 level ; CARD32 internalFormat ; CARD32 width ; CARD32 height ; CARD32 border ; CARD32 imageSize ; >} __GLXcompressedTexImageHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > CARD32 target ; CARD32 level ; CARD32 internalFormat ; CARD32 width ; CARD32 height ; CARD32 border ; CARD32 imageSize ; >} __GLXcompressedTexImageLargeHeader; > >typedef struct { > CARD32 target ; CARD32 level ; CARD32 internalFormat ; CARD32 width ; CARD32 height ; CARD32 border ; CARD32 imageSize ; >} __GLXdispatchCompressedTexImageHeader; ># 1486 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 imageSize ; >} __GLXcompressedTexSubImageHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 imageSize ; >} __GLXcompressedTexSubImageLargeHeader; > >typedef struct { > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 imageSize ; >} __GLXdispatchCompressedTexSubImageHeader; ># 1525 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > CARD32 target ; CARD32 level ; CARD32 internalFormat ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 border ; CARD32 imageSize ; >} __GLXcompressedTexImage3DHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > CARD32 target ; CARD32 level ; CARD32 internalFormat ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 border ; CARD32 imageSize ; >} __GLXcompressedTexImage3DLargeHeader; > >typedef struct { > CARD32 target ; CARD32 level ; CARD32 internalFormat ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 border ; CARD32 imageSize ; >} __GLXdispatchCompressedTexImage3DHeader; ># 1566 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 zoffset ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 format ; CARD32 imageSize ; >} __GLXcompressedTexSubImage3DHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 zoffset ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 format ; CARD32 imageSize ; >} __GLXcompressedTexSubImage3DLargeHeader; > >typedef struct { > CARD32 target ; CARD32 level ; CARD32 xoffset ; CARD32 yoffset ; CARD32 zoffset ; CARD32 width ; CARD32 height ; CARD32 depth ; CARD32 format ; CARD32 imageSize ; >} __GLXdispatchCompressedTexSubImage3DHeader; ># 1601 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; >} __GLXdrawPixelsHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; >} __GLXdrawPixelsLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; >} __GLXdispatchDrawPixelsHeader; ># 1641 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 internalformat ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; >} __GLXConvolutionFilterHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 internalformat ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; >} __GLXConvolutionFilterLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 internalformat ; CARD32 width ; CARD32 height ; CARD32 format ; CARD32 type ; >} __GLXdispatchConvolutionFilterHeader; ># 1677 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > CARD32 numVertexes ; CARD32 numComponents ; CARD32 primType ; >} __GLXdrawArraysHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > CARD32 numVertexes ; CARD32 numComponents ; CARD32 primType ; >} __GLXdrawArraysLargeHeader; > >typedef struct { > CARD32 numVertexes ; CARD32 numComponents ; CARD32 primType ; >} __GLXdispatchDrawArraysHeader; > > > > > > >typedef struct { > CARD32 datatype ; INT32 numVals ; CARD32 component ; >} __GLXdispatchDrawArraysComponentHeader; ># 1722 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 internalformat ; CARD32 width ; CARD32 format ; CARD32 type ; >} __GLXColorTableHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 internalformat ; CARD32 width ; CARD32 format ; CARD32 type ; >} __GLXColorTableLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 internalformat ; CARD32 width ; CARD32 format ; CARD32 type ; >} __GLXdispatchColorTableHeader; ># 1760 "../../../../../../exports/include/GL/glxproto.h" >typedef struct { > CARD16 length ; CARD16 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 start ; CARD32 count ; CARD32 format ; CARD32 type ; >} __GLXColorSubTableHeader; > >typedef struct { > CARD32 length ; CARD32 opcode ; > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 start ; CARD32 count ; CARD32 format ; CARD32 type ; >} __GLXColorSubTableLargeHeader; > >typedef struct { > BOOL swapBytes; BOOL lsbFirst; CARD8 reserved0; CARD8 reserved1; CARD32 rowLength ; CARD32 skipRows ; CARD32 skipPixels ; CARD32 alignment ; > CARD32 target ; CARD32 start ; CARD32 count ; CARD32 format ; CARD32 type ; >} __GLXdispatchColorSubTableHeader; ># 57 "../../../../../../lib/GL/glx/glxclient.h" 2 ># 74 "../../../../../../lib/GL/glx/glxclient.h" >typedef struct __GLXcontextRec __GLXcontext; >typedef struct __GLXdisplayPrivateRec __GLXdisplayPrivate; >typedef struct _glapi_table __GLapi; > > > > > ># 1 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" 1 ># 58 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef struct __DRIdisplayRec __DRIdisplay; >typedef struct __DRIscreenRec __DRIscreen; >typedef struct __DRIcontextRec __DRIcontext; >typedef struct __DRIdrawableRec __DRIdrawable; >typedef struct __DRIdriverRec __DRIdriver; >typedef struct __DRIframebufferRec __DRIframebuffer; >typedef struct __DRIversionRec __DRIversion; >typedef unsigned long __DRIid; >typedef void __DRInativeDisplay; > > > > > > > >extern __DRIscreen *__glXFindDRIScreen(__DRInativeDisplay *dpy, int scrn); ># 83 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef int (* PFNGLXGETINTERNALVERSIONPROC) ( void ); > > > > > > > >typedef GLboolean (* PFNGLXWINDOWEXISTSPROC) (__DRInativeDisplay *dpy, __DRIid draw); > > > > > > >typedef int (* PFNGLXGETUSTPROC) ( int64_t * ust ); ># 107 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef __GLcontextModes * (* PFNGLXCREATECONTEXTMODES) ( unsigned count, > size_t minimum_bytes_per_struct ); ># 118 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef const char * (* PFNGLXGETSCREENDRIVERPROC) (__DRInativeDisplay *dpy, int scrNum); ># 127 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef const char * (* PFNGLXGETDRIVERCONFIGPROC) (const char *driverName); ># 136 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef void (* PFNGLXSCRENABLEEXTENSIONPROC) ( void *psc, const char * name ); ># 145 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef GLboolean (* PFNGLXGETDRAWABLEINFOPROC) ( __DRInativeDisplay *dpy, int scrn, > __DRIid draw, unsigned int * index, unsigned int * stamp, > int * x, int * y, int * width, int * height, > int * numClipRects, drm_clip_rect_t ** pClipRects, > int * backX, int * backY, > int * numBackClipRects, drm_clip_rect_t ** pBackClipRects ); > >extern GLboolean XF86DRIDestroyContext( __DRInativeDisplay *dpy, int screen, > __DRIid context_id ); > >extern GLboolean XF86DRICreateDrawable( __DRInativeDisplay *dpy, int screen, > __DRIid drawable, drm_drawable_t *hHWDrawable ); > >extern GLboolean XF86DRIDestroyDrawable( __DRInativeDisplay *dpy, int screen, > __DRIid drawable); ># 168 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >typedef void *(CREATENEWSCREENFUNC)(__DRInativeDisplay *dpy, int scrn, > __DRIscreen *psc, const __GLcontextModes * modes, > const __DRIversion * ddx_version, const __DRIversion * dri_version, > const __DRIversion * drm_version, const __DRIframebuffer * frame_buffer, > void * pSAREA, int fd, int internal_api_version, > __GLcontextModes ** driver_modes); >typedef CREATENEWSCREENFUNC* PFNCREATENEWSCREENFUNC; >extern CREATENEWSCREENFUNC __driCreateNewScreen; > > > >extern void *__driCreateScreen(Display *dpy, int scrn, __DRIscreen *psc, > int numConfigs, __GLXvisualConfig *config); ># 189 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >extern const char __driConfigOptions[]; ># 203 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >struct __DRIversionRec { > int major; > int minor; > int patch; >}; ># 221 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" >struct __DRIframebufferRec { > unsigned char *base; > > > > > > int size; > int stride; > int width; > int height; > int dev_priv_size; > void *dev_priv; >}; > > > > > > >struct __DRIscreenRec { > > > > void (*destroyScreen)(__DRInativeDisplay *dpy, int scrn, void *screenPrivate); ># 260 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > void *(*createContext)(Display *dpy, XVisualInfo *vis, void *sharedPrivate, > __DRIcontext *pctx); ># 270 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > void *(*createNewDrawable)(__DRInativeDisplay *dpy, const __GLcontextModes *modes, > __DRIid draw, __DRIdrawable *pdraw, > int renderType, const int *attrs); > > > > > __DRIdrawable *(*getDrawable)(__DRInativeDisplay *dpy, __DRIid draw, > void *drawablePrivate); > > > > > > > void *private; > > > > > > > > int (*getMSC)( void *screenPrivate, int64_t *msc ); ># 303 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > void *screenConfigs; > > > > > > > > void *(*allocateMemory)(__DRInativeDisplay *dpy, int scrn, GLsizei size, > GLfloat readfreq, GLfloat writefreq, > GLfloat priority); > > void (*freeMemory)(__DRInativeDisplay *dpy, int scrn, GLvoid *pointer); > > GLuint (*memoryOffset)(__DRInativeDisplay *dpy, int scrn, const GLvoid *pointer); ># 326 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > void * (*createNewContext)(__DRInativeDisplay *dpy, const __GLcontextModes *modes, > int render_type, > void *sharedPrivate, __DRIcontext *pctx); >}; > > > > > >struct __DRIcontextRec { > > > > void (*destroyContext)(__DRInativeDisplay *dpy, int scrn, void *contextPrivate); > > > > > > > > int (*bindContext)(Display *dpy, int scrn, GLXDrawable draw, > GLXContext gc); ># 359 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > int (*unbindContext)(Display *dpy, int scrn, GLXDrawable draw, > GLXContext gc, int will_rebind); ># 370 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > void *private; ># 379 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > int (*bindContext2)(Display *dpy, int scrn, GLXDrawable draw, > GLXDrawable read, GLXContext gc); ># 392 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > int (*unbindContext2)(Display *dpy, int scrn, GLXDrawable draw, > GLXDrawable read, GLXContext gc); ># 403 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > const __GLcontextModes * mode; > > > > > > > GLboolean (*bindContext3)(__DRInativeDisplay *dpy, int scrn, __DRIid draw, > __DRIid read, __DRIcontext *ctx); > > > > > > > GLboolean (*unbindContext3)(__DRInativeDisplay *dpy, int scrn, __DRIid draw, > __DRIid read, __DRIcontext *ctx); >}; > > > > > > > >struct __DRIdrawableRec { > > > > void (*destroyDrawable)(__DRInativeDisplay *dpy, void *drawablePrivate); > > > > > void (*swapBuffers)(__DRInativeDisplay *dpy, void *drawablePrivate); > > > > > > > void *private; > > > > > > > int (*getSBC)(__DRInativeDisplay *dpy, void *drawablePrivate, int64_t *sbc ); > > > > > > > int (*waitForSBC)( __DRInativeDisplay * dpy, void *drawablePriv, > int64_t target_sbc, > int64_t * msc, int64_t * sbc ); ># 470 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > int (*waitForMSC)( __DRInativeDisplay * dpy, void *drawablePriv, > int64_t target_msc, int64_t divisor, int64_t remainder, > int64_t * msc, int64_t * sbc ); ># 483 "../../../../../../extras/Mesa/include/GL/internal/dri_interface.h" > int64_t (*swapBuffersMSC)(__DRInativeDisplay *dpy, void *drawablePrivate, > int64_t target_msc, > int64_t divisor, int64_t remainder); > > > > > > > int (*frameTracking)(__DRInativeDisplay *dpy, void *drawablePrivate, GLboolean enable); > > > > > > > int (*queryFrameTracking)(__DRInativeDisplay *dpy, void *drawablePrivate, > int64_t * sbc, int64_t * missedFrames, > float * lastMissedUsage, float * usage ); > > > > > > > > unsigned swap_interval; >}; ># 83 "../../../../../../lib/GL/glx/glxclient.h" 2 > >typedef void *(*CreateScreenFunc)(Display *dpy, int scrn, __DRIscreen *psc, > int numConfigs, __GLXvisualConfig *config); > >typedef void *(*CreateNewScreenFunc)(Display *dpy, int scrn, __DRIscreen *psc, > const __GLcontextModes * modes, const __DRIversion * ddx_version, > const __DRIversion * dri_version, const __DRIversion * drm_version, > const __DRIframebuffer * frame_buffer, void * pSAREA, > int fd, int internal_api_version, __GLcontextModes ** driver_modes); > > > > > > >struct __DRIdisplayRec { > > > > void (*destroyDisplay)(Display *dpy, void *displayPrivate); ># 113 "../../../../../../lib/GL/glx/glxclient.h" > CreateScreenFunc * createScreen; > > > > > > struct __DRIdisplayPrivateRec *private; > > > > > > > > CreateNewScreenFunc * createNewScreen; >}; > > > > > >struct __DRIdriverRec { > const char *name; > void *handle; > CreateScreenFunc createScreenFunc; > CreateNewScreenFunc createNewScreenFunc; > struct __DRIdriverRec *next; >}; > > > > > >extern void *driCreateDisplay(Display *dpy, __DRIdisplay *pdisp); > >extern __DRIdriver *driGetDriver(Display *dpy, int scrNum); > >extern void DRI_glXUseXFont( Font font, int first, int count, int listbase ); > > > > > >extern const char *glXGetScreenDriver (Display *dpy, int scrNum); > >extern const char *glXGetDriverConfig (const char *driverName); > > > > > > > >typedef struct __GLXpixelStoreModeRec { > GLboolean swapEndian; > GLboolean lsbFirst; > GLuint rowLength; > GLuint imageHeight; > GLuint imageDepth; > GLuint skipRows; > GLuint skipPixels; > GLuint skipImages; > GLuint alignment; >} __GLXpixelStoreMode; > > > > > > >typedef struct __GLXvertexArrayPointerStateRecDEPRECATED { > GLboolean enable; > void (*proc)(const void *); > const GLubyte *ptr; > GLsizei skip; > GLint size; > GLenum type; > GLsizei stride; >} __GLXvertexArrayPointerStateDEPRECATED; > >typedef struct __GLXvertArrayStateRecDEPRECATED { > __GLXvertexArrayPointerStateDEPRECATED vertex; > __GLXvertexArrayPointerStateDEPRECATED normal; > __GLXvertexArrayPointerStateDEPRECATED color; > __GLXvertexArrayPointerStateDEPRECATED index; > __GLXvertexArrayPointerStateDEPRECATED texCoord[32]; > __GLXvertexArrayPointerStateDEPRECATED edgeFlag; > GLint maxElementsVertices; > GLint maxElementsIndices; > GLint activeTexture; >} __GLXvertArrayStateDEPRECATED; > >typedef struct __GLXattributeRecDEPRECATED { > GLuint mask; > > > > > > > __GLXpixelStoreMode storePack, storeUnpack; > > > > > > > __GLXvertArrayStateDEPRECATED vertArray; >} __GLXattributeDEPRECATED; > >typedef struct __GLXvertexArrayPointerStateRec { > void (*proc)(const void *); > void (*mtex_proc)(GLenum, const void *); > const GLubyte *ptr; > GLsizei skip; > GLint size; > GLenum type; > GLsizei stride; >} __GLXvertexArrayPointerState; ># 241 "../../../../../../lib/GL/glx/glxclient.h" >enum { > edgeFlag_ARRAY, > index_ARRAY, > fogCoord_ARRAY, > secondaryColor_ARRAY, > color_ARRAY, > normal_ARRAY, > > > > > > > vertex_ARRAY, > > __GLX_MAX_ARRAYS >}; ># 278 "../../../../../../lib/GL/glx/glxclient.h" >typedef struct __GLXvertArrayStateRec { > > > > > GLuint enables; > > > > > GLuint texture_enables; > > > > > > > > __GLXvertexArrayPointerState arrays[__GLX_MAX_ARRAYS]; > > __GLXvertexArrayPointerState texCoord[32]; > > GLint maxElementsVertices; > GLint maxElementsIndices; > GLint activeTexture; >} __GLXvertArrayState; > >typedef struct __GLXattributeRec { > GLuint mask; > > > > > > > __GLXpixelStoreMode storePack, storeUnpack; > > > > > > > __GLXvertArrayState vertArray; > > > > > > GLboolean NoDrawArraysProtocol; >} __GLXattribute; > >typedef struct __GLXattributeMachineRec { > __GLXattribute *stack[16]; > __GLXattribute **stackPointer; >} __GLXattributeMachine; > > > > > >struct __GLXcontextRec { ># 356 "../../../../../../lib/GL/glx/glxclient.h" > GLubyte *buf; > GLubyte *pc; > GLubyte *limit; > GLubyte *bufEnd; > GLint bufSize; ># 369 "../../../../../../lib/GL/glx/glxclient.h" > XID xid; > > > > > XID share_xid; ># 383 "../../../../../../lib/GL/glx/glxclient.h" > VisualID vid; > > > > > GLint screen; > > > > > > GLboolean imported; ># 404 "../../../../../../lib/GL/glx/glxclient.h" > GLXContextTag currentContextTag; ># 414 "../../../../../../lib/GL/glx/glxclient.h" > GLenum renderMode; > GLfloat *feedbackBuf; > GLuint *selectBuf; ># 425 "../../../../../../lib/GL/glx/glxclient.h" > GLboolean fastImageUnpack; > > > > > > void (*fillImage)(__GLXcontext*, GLint, GLint, GLint, GLint, GLenum, > GLenum, const GLvoid*, GLubyte*, GLubyte*); > > > > > > __GLXattributeDEPRECATED stateDEPRECATED; > __GLXattributeMachine attributes; > > > > > > > > GLenum error; > > > > > int isDirect; > > > > > > Display *currentDpy; > > > > > > GLXDrawable currentDrawable; ># 474 "../../../../../../lib/GL/glx/glxclient.h" > GLubyte *vendor; > GLubyte *renderer; > GLubyte *version; > GLubyte *extensions; > > > > > > Display *createDpy; > > > > > > GLint maxSmallRenderCommandSize; > > > > > > GLint majorOpcode; > > > > > > __DRIcontext driContext; ># 514 "../../../../../../lib/GL/glx/glxclient.h" > GLXFBConfigID fbconfigID; > > > > > > > > GLXDrawable currentReadable; ># 531 "../../../../../../lib/GL/glx/glxclient.h" > void * client_state_private; > > > > > int renderType; ># 546 "../../../../../../lib/GL/glx/glxclient.h" > int server_major; > int server_minor; > >}; > > > > > > >extern void __glFreeAttributeState(__GLXcontext *); ># 590 "../../../../../../lib/GL/glx/glxclient.h" >typedef struct __GLXscreenConfigsRec { > > > > > __GLXvisualConfig * old_configs; > int numOldConfigs; > > > > > > const char *serverGLXexts; > > > > > > char *effectiveGLXexts; > > > > > > __DRIscreen driScreen; > > > > > > > __GLcontextModes *configs; ># 630 "../../../../../../lib/GL/glx/glxclient.h" > unsigned char direct_support[8]; > GLboolean ext_list_first_time; > > >} __GLXscreenConfigs; > > > > > >struct __GLXdisplayPrivateRec { > > > > Display *dpy; > > > > > > int majorOpcode; > > > > > > > > int majorVersion, minorVersion; ># 668 "../../../../../../lib/GL/glx/glxclient.h" > const char *serverGLXvendor; > const char *serverGLXversion; > > > > > > > > __GLXscreenConfigs *screenConfigs; > > > > > > __DRIdisplay driDisplay; > >}; > >void __glXFreeContext(__GLXcontext*); > >extern GLubyte *__glXFlushRenderBuffer(__GLXcontext*, GLubyte*); > >extern void __glXSendLargeChunk(__GLXcontext *gc, GLint requestNumber, > GLint totalRequests, > const GLvoid * data, GLint dataLen); > >extern void __glXSendLargeCommand(__GLXcontext *, const GLvoid *, GLint, > const GLvoid *, GLint); > > >extern __GLXdisplayPrivate *__glXInitialize(Display*); > > > >extern int __glXDebug; > > > >extern __GLXcontext *__glXGetCurrentContext(void); >extern void __glXSetCurrentContext(__GLXcontext *c); ># 721 "../../../../../../lib/GL/glx/glxclient.h" >extern xmutex_rec __glXmutex; ># 732 "../../../../../../lib/GL/glx/glxclient.h" >extern CARD8 __glXSetupForCommand(Display *dpy); ># 741 "../../../../../../lib/GL/glx/glxclient.h" >extern GLint __glImageSize(GLint, GLint, GLint, GLenum, GLenum); > > >extern GLint __glElementsPerGroup(GLenum format, GLenum type); > > > > >extern GLint __glBytesPerElement(GLenum type); > > >extern GLint __glEvalComputeK(GLenum); ># 761 "../../../../../../lib/GL/glx/glxclient.h" >extern void __glFillImage(__GLXcontext*, GLint, GLint, GLint, GLint, GLenum, > GLenum, const GLvoid*, GLubyte*, GLubyte*); > > >extern void __glFillMap1f(GLint, GLint, GLint, const GLfloat *, GLubyte *); >extern void __glFillMap1d(GLint, GLint, GLint, const GLdouble *, GLubyte *); >extern void __glFillMap2f(GLint, GLint, GLint, GLint, GLint, > const GLfloat *, GLfloat *); >extern void __glFillMap2d(GLint, GLint, GLint, GLint, GLint, > const GLdouble *, GLdouble *); > > > > > >extern void __glEmptyImage(__GLXcontext*, GLint, GLint, GLint, GLint, GLenum, > GLenum, const GLubyte *, GLvoid *); > > > > > >extern void __glXInitVertexArrayState(__GLXcontext*); > > > > > >extern void __glXClientInfo ( Display *dpy, int opcode ); ># 815 "../../../../../../lib/GL/glx/glxclient.h" >extern void __glXInitializeVisualConfigFromTags( __GLcontextModes *config, > int count, const INT32 *bp, int tagged_only, int fbconfig_style_tags ); > >extern char * __glXGetStringFromServer( Display * dpy, int opcode, > CARD32 glxCode, CARD32 for_whom, CARD32 name ); > >extern char *__glXstrdup(const char *str); > > >extern const char __glXGLClientVersion[]; >extern const char __glXGLClientExtensions[]; > > >extern int __glXGetInternalVersion(void); > > >extern int __glXGetUST( int64_t * ust ); ># 61 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" 2 > > ># 1 "../../../../../../extras/drm/shared/drm_sarea.h" 1 ># 53 "../../../../../../extras/drm/shared/drm_sarea.h" >typedef struct drm_sarea_drawable { > unsigned int stamp; > unsigned int flags; >} drm_sarea_drawable_t; > > >typedef struct drm_sarea_frame { > unsigned int x; > unsigned int y; > unsigned int width; > unsigned int height; > unsigned int fullscreen; >} drm_sarea_frame_t; > > >typedef struct drm_sarea { > > drm_hw_lock_t lock; > > drm_hw_lock_t drawable_lock; > drm_sarea_drawable_t drawableTable[256]; > drm_sarea_frame_t frame; > drm_context_t dummy_context; >} drm_sarea_t; ># 64 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" 2 ># 76 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" >typedef struct __DRIdisplayPrivateRec __DRIdisplayPrivate; >typedef struct __DRIscreenPrivateRec __DRIscreenPrivate; >typedef struct __DRIcontextPrivateRec __DRIcontextPrivate; >typedef struct __DRIdrawablePrivateRec __DRIdrawablePrivate; >typedef struct __DRIswapInfoRec __DRIswapInfo; ># 125 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" >struct __DriverAPIRec { > > > > GLboolean (*InitDriver)(__DRIscreenPrivate *driScrnPriv); > > > > > void (*DestroyScreen)(__DRIscreenPrivate *driScrnPriv); > > > > > GLboolean (*CreateContext)(const __GLcontextModes *glVis, > __DRIcontextPrivate *driContextPriv, > void *sharedContextPrivate); > > > > > void (*DestroyContext)(__DRIcontextPrivate *driContextPriv); > > > > > GLboolean (*CreateBuffer)(__DRIscreenPrivate *driScrnPriv, > __DRIdrawablePrivate *driDrawPriv, > const __GLcontextModes *glVis, > GLboolean pixmapBuffer); > > > > > void (*DestroyBuffer)(__DRIdrawablePrivate *driDrawPriv); > > > > > void (*SwapBuffers)(__DRIdrawablePrivate *driDrawPriv); > > > > > GLboolean (*MakeCurrent)(__DRIcontextPrivate *driContextPriv, > __DRIdrawablePrivate *driDrawPriv, > __DRIdrawablePrivate *driReadPriv); > > > > > GLboolean (*UnbindContext)(__DRIcontextPrivate *driContextPriv); > > > > > > int (*GetSwapInfo)( __DRIdrawablePrivate *dPriv, __DRIswapInfo * sInfo ); > > > > > > > int (*GetMSC)( __DRIscreenPrivate * priv, int64_t * count ); > > > > > > int (*WaitForMSC)( __DRIdrawablePrivate *priv, int64_t target_msc, > int64_t divisor, int64_t remainder, > int64_t * msc ); > int (*WaitForSBC)( __DRIdrawablePrivate *priv, int64_t target_sbc, > int64_t * msc, int64_t * sbc ); > > int64_t (*SwapBuffersMSC)( __DRIdrawablePrivate *priv, int64_t target_msc, > int64_t divisor, int64_t remainder ); > >}; > > >struct __DRIswapInfoRec { > > > > uint64_t swap_count; > > > > > > int64_t swap_ust; > > > > > > > > uint64_t swap_missed_count; ># 234 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > float swap_missed_usage; >}; > > > > > >struct __DRIdrawablePrivateRec { > > > > drm_drawable_t hHWDrawable; > > > > > > > void *driverPrivate; > > > > > __DRIid draw; > __DRIdrawable *pdraw; ># 268 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > int refcount; > > > > > unsigned int index; > > > > > unsigned int *pStamp; ># 287 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > unsigned int lastStamp; > > > > > > > > int x; > int y; > int w; > int h; > int numClipRects; > drm_clip_rect_t *pClipRects; ># 309 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > int backX; > int backY; > int backClipRectType; > int numBackClipRects; > drm_clip_rect_t *pBackClipRects; > > > > > > __DRIcontextPrivate *driContextPriv; > > > > > __DRIscreenPrivate *driScreenPriv; ># 333 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > __DRInativeDisplay *display; > int screen; > > > > > > void (*swapBuffers)( __DRIdrawablePrivate *dPriv ); > > > > > > PFNGLXGETDRAWABLEINFOPROC getInfo; >}; > > > > >struct __DRIcontextPrivateRec { > > > > __DRIid contextID; > > > > > drm_context_t hHWContext; > > > > > void *driverPrivate; > > > > > __DRInativeDisplay *display; > > > > > __DRIdrawablePrivate *driDrawablePriv; > > > > > __DRIscreenPrivate *driScreenPriv; >}; > > > > >struct __DRIscreenPrivateRec { > > > > __DRInativeDisplay *display; > > > > > int myNum; > > > > > struct __DriverAPIRec DriverAPI; > > > > > > > > int ddxMajor; > int ddxMinor; > int ddxPatch; ># 420 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > int driMajor; > int driMinor; > int driPatch; ># 431 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > int drmMajor; > int drmMinor; > int drmPatch; ># 442 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > int drawLockID; ># 452 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > int fd; ># 461 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > drm_sarea_t *pSAREA; > > > > > > > unsigned char *pFB; > int fbSize; > int fbOrigin; > int fbStride; > int fbWidth; > int fbHeight; > int fbBPP; ># 483 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > void *pDevPriv; > int devPrivSize; ># 497 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > __DRIcontextPrivate dummyContextPriv; > > > > > void *drawHash; > > > > > > > void *private; ># 520 "../../../../../../extras/Mesa/src/mesa/drivers/dri/common/dri_util.h" > __GLcontextModes *modes; > > > > > > __DRIscreen *psc; >}; > > > >extern void >__driUtilMessage(const char *f, ...); > > >extern void >__driUtilUpdateDrawableInfo(__DRIdrawablePrivate *pdp); > > >extern __DRIscreenPrivate * __driUtilCreateNewScreen( __DRInativeDisplay *dpy, > int scrn, __DRIscreen *psc, __GLcontextModes * modes, > const __DRIversion * ddx_version, const __DRIversion * dri_version, > const __DRIversion * drm_version, const __DRIframebuffer * frame_buffer, > drm_sarea_t *pSAREA, int fd, int internal_api_version, > const struct __DriverAPIRec *driverAPI ); > > >extern __DRIscreenPrivate * >__driUtilCreateScreen(Display *dpy, int scrn, __DRIscreen *psc, > int numConfigs, __GLXvisualConfig *config, > const struct __DriverAPIRec *driverAPI); > > > >extern int >driCompareGLXAPIVersion( GLuint required_version ); > >extern float >driCalculateSwapUsage( __DRIdrawablePrivate *dPriv, > int64_t last_swap_ust, int64_t current_ust ); > >extern void >(*glXGetProcAddress(const GLubyte *procname))( void ); ># 31 "gamma_context.h" 2 > > > ># 1 "gamma_regs.h" 1 ># 38 "gamma_regs.h" ># 1 "gamma_client.h" 1 ># 39 "gamma_regs.h" 2 ># 35 "gamma_context.h" 2 ># 1 "gamma_macros.h" 1 ># 36 "gamma_context.h" 2 ># 1 "gamma_screen.h" 1 >typedef struct _gammaRegion { > drm_handle_t handle; > drmSize size; > drmAddress map; >} gammaRegion, *gammaRegionPtr; > >typedef struct { > > int regionCount; > gammaRegion *regions; > > drmBufMapPtr bufs; > > __DRIscreenPrivate *driScreen; > > int cpp; > int frontPitch; > int frontOffset; > > int backPitch; > int backOffset; > int backX; > int backY; > > int depthOffset; > int depthPitch; > > int textureSize; > int logTextureGranularity; >} gammaScreenRec, *gammaScreenPtr; ># 37 "gamma_context.h" 2 > > > > > >typedef union { > unsigned int i; > float f; >} dmaBufRec, *dmaBuf; ># 61 "gamma_context.h" >extern void gammaDDUpdateHWState(GLcontext *ctx); >extern gammaScreenPtr gammaCreateScreen(__DRIscreenPrivate *sPriv); >extern void gammaDestroyScreen(__DRIscreenPrivate *sPriv); >extern GLboolean gammaCreateContext( const __GLcontextModes *glVisual, > __DRIcontextPrivate *driContextPriv, > void *sharedContextPrivate); ># 114 "gamma_context.h" >struct gamma_context; >typedef struct gamma_context gammaContextRec; >typedef struct gamma_context *gammaContextPtr; >typedef struct gamma_texture_object_t *gammaTextureObjectPtr; ># 135 "gamma_context.h" >struct gamma_texture_object_t { > struct gamma_texture_object_t *next, *prev; > > GLuint age; > struct gl_texture_object *globj; > > int Pitch; > int Height; > int texelBytes; > int totalSize; > int bound; > > PMemBlock MemBlock; > char * BufAddr; > > GLuint min_level; > GLuint max_level; > GLuint dirty_images; > > GLint firstLevel, lastLevel; > > struct { > const struct gl_texture_image *image; > int offset; > int height; > int internalFormat; > } image[12]; > > uint32_t TextureBaseAddr[12]; > uint32_t TextureAddressMode; > uint32_t TextureColorMode; > uint32_t TextureFilterMode; > uint32_t TextureFormat; > uint32_t TextureReadMode; > uint32_t TextureBorderColor; >}; > > > > > > >void gammaUpdateTextureState( GLcontext *ctx ); > >void gammaDestroyTexObj( gammaContextPtr gmesa, gammaTextureObjectPtr t ); >void gammaSwapOutTexObj( gammaContextPtr gmesa, gammaTextureObjectPtr t ); >void gammaUploadTexImages( gammaContextPtr gmesa, gammaTextureObjectPtr t ); > >void gammaResetGlobalLRU( gammaContextPtr gmesa ); >void gammaUpdateTexLRU( gammaContextPtr gmesa, gammaTextureObjectPtr t ); >void gammaTexturesGone( gammaContextPtr gmesa, > GLuint start, GLuint end, > GLuint in_use ); > >void gammaEmitHwState( gammaContextPtr gmesa ); >void gammaDDInitExtensions( GLcontext *ctx ); >void gammaDDInitDriverFuncs( GLcontext *ctx ); >void gammaDDInitSpanFuncs( GLcontext *ctx ); >void gammaDDInitState( gammaContextPtr gmesa ); >void gammaInitHW( gammaContextPtr gmesa ); >void gammaDDInitStateFuncs( GLcontext *ctx ); >void gammaDDInitTextureFuncs( struct dd_function_table *table ); >void gammaInitTextureObjects( GLcontext *ctx ); >void gammaDDInitTriFuncs( GLcontext *ctx ); > >void gammaUpdateWindow( GLcontext *ctx ); >void gammaUpdateViewportOffset( GLcontext *ctx ); > >void gammaPrintLocalLRU( gammaContextPtr gmesa ); >void gammaPrintGlobalLRU( gammaContextPtr gmesa ); > >extern void gammaFallback( gammaContextPtr gmesa, GLuint bit, GLboolean mode ); > > > > > ># 1 "../../../../../../extras/Mesa/src/mesa/tnl_dd/t_dd_vertex.h" 1 ># 29 "../../../../../../extras/Mesa/src/mesa/tnl_dd/t_dd_vertex.h" >typedef struct { > GLfloat x, y, z, w; >} gamma_coord_t; ># 42 "../../../../../../extras/Mesa/src/mesa/tnl_dd/t_dd_vertex.h" >typedef struct { > > > > GLubyte blue, green, red, alpha; > >} gamma_color_t; > > >typedef union { > struct { > GLfloat x, y, z, w; > gamma_color_t color; > gamma_color_t specular; > GLfloat u0, v0; > GLfloat u1, v1; > GLfloat u2, v2; > GLfloat u3, v3; > } v; > struct { > GLfloat x, y, z, w; > gamma_color_t color; > gamma_color_t specular; > GLfloat u0, v0, q0; > GLfloat u1, v1, q1; > GLfloat u2, v2, q2; > GLfloat u3, v3, q3; > } pv; > struct { > GLfloat x, y, z; > gamma_color_t color; > } tv; > GLfloat f[24]; > GLuint ui[24]; > GLubyte ub4[24][4]; >} gammaVertex, *gammaVertexPtr; ># 213 "gamma_context.h" 2 > > >typedef void (*gamma_quad_func)( gammaContextPtr, > const gammaVertex *, > const gammaVertex *, > const gammaVertex *, > const gammaVertex * ); >typedef void (*gamma_tri_func)( gammaContextPtr, > const gammaVertex *, > const gammaVertex *, > const gammaVertex * ); >typedef void (*gamma_line_func)( gammaContextPtr, > const gammaVertex *, > const gammaVertex * ); >typedef void (*gamma_point_func)( gammaContextPtr, > const gammaVertex * ); > > >struct gamma_context { > GLcontext *glCtx; > > __DRIcontextPrivate *driContext; > __DRIscreenPrivate *driScreen; > __DRIdrawablePrivate *driDrawable; > > GLuint new_gl_state; > GLuint new_state; > GLuint dirty; > > GLINTSAREADRIPtr sarea; > > > > drm_context_t hHWContext; > drm_hw_lock_t *driHwLock; > int driFd; > > GLuint numClipRects; > drm_clip_rect_t *pClipRects; > > dmaBuf buf; > int bufIndex; > int bufSize; > int bufCount; > > dmaBuf WCbuf; > int WCbufIndex; > int WCbufSize; > int WCbufCount; > > gammaScreenPtr gammaScreen; > > int drawOffset; > int readOffset; > > gamma_point_func draw_point; > gamma_line_func draw_line; > gamma_tri_func draw_tri; > gamma_quad_func draw_quad; > > GLuint Fallback; > GLuint RenderIndex; > GLuint SetupNewInputs; > GLuint SetupIndex; > > GLuint vertex_format; > GLuint vertex_size; > GLuint vertex_stride_shift; > GLubyte *verts; > > GLfloat hw_viewport[16]; > GLuint hw_primitive; > GLenum render_primitive; > > GLfloat depth_scale; > > gammaTextureObjectPtr CurrentTexObj[2]; > struct gamma_texture_object_t TexObjList; > struct gamma_texture_object_t SwappedOut; > GLenum TexEnvImageFmt[2]; > > memHeap_t *texHeap; > > unsigned int lastSwap; > int texAge; > int ctxAge; > int dirtyAge; > unsigned int lastStamp; > > > uint32_t ClearColor; > uint32_t Color; > uint32_t DitherMode; > uint32_t ClearDepth; > uint32_t FogMode; > uint32_t AreaStippleMode; > uint32_t LBReadFormat; > uint32_t LBWriteFormat; > uint32_t LineMode; > uint32_t PointMode; > uint32_t TriangleMode; > uint32_t AntialiasMode; > GLfloat ViewportScaleX; > GLfloat ViewportScaleY; > GLfloat ViewportScaleZ; > GLfloat ViewportOffsetX; > GLfloat ViewportOffsetY; > GLfloat ViewportOffsetZ; > int MatrixMode; > int DepthMode; > int TransformMode; > int LBReadMode; > int FBReadMode; > int FBWindowBase; > int LBWindowBase; > int ColorDDAMode; > int GeometryMode; > int AlphaTestMode; > int AlphaBlendMode; > int AB_FBReadMode; > int AB_FBReadMode_Save; > int DeltaMode; > int ColorMaterialMode; > int FBHardwareWriteMask; > int MaterialMode; > int NormalizeMode; > int LightingMode; > int Light0Mode; > int Light1Mode; > int Light2Mode; > int Light3Mode; > int Light4Mode; > int Light5Mode; > int Light6Mode; > int Light7Mode; > int Light8Mode; > int Light9Mode; > int Light10Mode; > int Light11Mode; > int Light12Mode; > int Light13Mode; > int Light14Mode; > int Light15Mode; > int LogicalOpMode; > int ScissorMode; > int ScissorMaxXY; > int ScissorMinXY; > int Window; > int WindowOrigin; > int x, y, w, h; > int FrameCount; > int NotClipped; > int WindowChanged; > int Flags; > int EnabledFlags; > int DepthSize; > int Begin; > GLenum ErrorValue; > int Texture1DEnabled; > int Texture2DEnabled; > > float ModelView[16]; > float Proj[16]; > float ModelViewProj[16]; > float Texture[16]; > > float ModelViewStack[(16 -1)*16]; > int ModelViewCount; > float ProjStack[(2 -1)*16]; > int ProjCount; > float TextureStack[(2 -1)*16]; > int TextureCount; >}; > >static __inline GLuint gammaPackColor( GLuint cpp, > GLubyte r, GLubyte g, > GLubyte b, GLubyte a ) >{ > switch ( cpp ) { > case 2: > return ((((r) & 0xf8) << 8) | (((g) & 0xfc) << 3) | (((b) & 0xf8) >> 3)); > case 4: > return (((a) << 24) | ((r) << 16) | ((g) << 8) | (b)); > default: > return 0; > } >} ># 16 "gamma_texmem.c" 2 ># 1 "gamma_lock.h" 1 > > > > > >extern void gammaGetLock( gammaContextPtr gmesa, GLuint flags ); ># 17 "gamma_texmem.c" 2 > >void gammaDestroyTexObj(gammaContextPtr gmesa, gammaTextureObjectPtr t) >{ > if (!t) return; > > > > > if (t->MemBlock) { > mmFreeMem(t->MemBlock); > t->MemBlock = 0; > > if (gmesa && t->age > gmesa->dirtyAge) > gmesa->dirtyAge = t->age; > } > > if (t->globj) > t->globj->DriverData = 0; > > if (gmesa) { > if (gmesa->CurrentTexObj[0] == t) { > gmesa->CurrentTexObj[0] = 0; > gmesa->dirty &= ~0x00020000; > } > > > > > > > > } > > do { (t)->next->prev = (t)->prev; (t)->prev->next = (t)->next; } while (0); > free(t); >} > > >void gammaSwapOutTexObj(gammaContextPtr gmesa, gammaTextureObjectPtr t) >{ > > > if (t->MemBlock) { > mmFreeMem(t->MemBlock); > t->MemBlock = 0; > > if (t->age > gmesa->dirtyAge) > gmesa->dirtyAge = t->age; > } > > t->dirty_images = ~0; > do { do { (t)->next->prev = (t)->prev; (t)->prev->next = (t)->next; } while (0); do { (t)->next = &(gmesa->SwappedOut); (t)->prev = (&(gmesa->SwappedOut))->prev; (&(gmesa->SwappedOut))->prev->next = t; (&(gmesa->SwappedOut))->prev = t; } while(0); } while (0); >} > > > > > >static void gammaUploadTexLevel( gammaContextPtr gmesa, gammaTextureObjectPtr t, int level ) >{ > const struct gl_texture_image *image = t->image[level].image; > int i,j; > int l2d; > > > > int words, depthLog2; > > > > l2d = 5; > > if (level == 0) { > t->TextureAddressMode &= ~(0x00001e00 | 0x0001e000); > t->TextureAddressMode |= (image->WidthLog2 << 9) | > (image->HeightLog2 << 13); > t->TextureReadMode &= ~(0x0000001e | 0x000001e0 | > 0x00000e00 | 0x00001000 | > 0x00002000); > t->TextureReadMode |= (image->WidthLog2 << 1) | > (image->HeightLog2 << 5) | > (l2d << 9); > t->TextureFormat &= ~(0x00000018 | 0x000c0000); > } > > t->TextureBaseAddr[level] = > (unsigned long)(t->image[level].offset + t->BufAddr) << 5; > > do { int __s = 1<<l2d; depthLog2 = 0; while (__s > 1) { ++depthLog2; __s >>= 1; } } while (0); > words = (image->Width * image->Height) >> (5-depthLog2); > > do { if ((gmesa)->bufCount+(3<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (3<<1); } while (0); > do { gmesa->buf++->i = 0x0117; gmesa->buf++->i = t->TextureBaseAddr[level] >> 5; ; } while (0); > do { gmesa->buf++->i = 0x0092; gmesa->buf++->i = (0x00000002 | 0x00000001); ; } while (0); > do { gmesa->buf++->i = 0x0017; gmesa->buf++->i = 0; ; } while (0); > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > > switch (t->image[level].internalFormat) { > case 0x1907: > case 3: > { > GLubyte *src = (GLubyte *)image->Data; > > if (level == 0) > t->TextureFormat |= 0x00000010; ># 153 "gamma_texmem.c" > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011e; gmesa->buf++->i = 0; ; } while (0); > for (i = 0; i < words; i++) { > unsigned int data; > data = ((((src[0]) & 0xf8) << 8) | (((src[1]) & 0xfc) << 3) | (((src[2]) & 0xf8) >> 3)); > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011d; gmesa->buf++->i = data; ; } while (0); > src += 3; > } > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > > } > break; > > case 0x1908: > case 4: > { > GLubyte *src = (GLubyte *)image->Data; > > if (level == 0) > t->TextureFormat |= 0x00000018; > > > > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011e; gmesa->buf++->i = 0; ; } while (0); > for (i = 0; i < words; i++) { > unsigned int data; > data = (((src[0]) << 24) | ((src[1]) << 16) | ((src[2]) << 8) | (src[3])); > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011d; gmesa->buf++->i = data; ; } while (0); > src += 4; > } > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > } > break; > > case 0x1909: > { > GLubyte *src = (GLubyte *)image->Data; > > if (level == 0) > t->TextureFormat |= 0x00000000 | 0x00000000; > > > > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011e; gmesa->buf++->i = 0; ; } while (0); > for (i = 0; i < words; i++) { > unsigned int data; > data = (((src[0]) << 16) | ((src[0]) << 8) | (src[0])); > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011d; gmesa->buf++->i = data; ; } while (0); > src ++; > } > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > } > break; > > case 0x8049: > { > GLubyte *src = (GLubyte *)image->Data; > > if (level == 0) > t->TextureFormat |= 0x00000000 | 0x00080000; > > > > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011e; gmesa->buf++->i = 0; ; } while (0); > for (i = 0; i < words; i++) { > unsigned int data; > data = (((src[0]) << 24) | ((src[0]) << 16) | ((src[0]) << 8) | (src[0])); > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011d; gmesa->buf++->i = data; ; } while (0); > src ++; > } > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > } > break; > > case 0x190A: > { > GLubyte *src = (GLubyte *)image->Data; > > if (level == 0) > t->TextureFormat |= 0x00000008; > > > > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011e; gmesa->buf++->i = 0; ; } while (0); > for (i = 0; i < words; i++) { > unsigned int data; > data = (((src[0]) << 24) | ((src[0]) << 16) | ((src[0]) << 8) | (src[1])); > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011d; gmesa->buf++->i = data; ; } while (0); > src += 2; > } > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > } > break; > > case 0x1906: > { > GLubyte *src = (GLubyte *)image->Data; > > if (level == 0) > t->TextureFormat |= 0x00000000 | 0x00040000; > > > > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011e; gmesa->buf++->i = 0; ; } while (0); > for (i = 0; i < words; i++) { > unsigned int data; > data = (((255) << 24) | ((255) << 16) | ((255) << 8) | (src[0])); > do { if ((gmesa)->bufCount+(1<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (1<<1); } while (0); > do { gmesa->buf++->i = 0x011d; gmesa->buf++->i = data; ; } while (0); > src += 1; > } > do { if (gmesa->bufCount) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); } while (0); > } > break; > > > > case 0x1900: > { > GLubyte *dst = (GLubyte *)(t->BufAddr + t->image[level].offset); > GLubyte *src = (GLubyte *)image->Data; > > for (j = 0 ; j < image->Height ; j++, dst += t->Pitch) { > for (i = 0 ; i < image->Width ; i++) { > dst[i] = src[0]; > src += 1; > } > } > } > break; > > default: > fprintf(stderr, "Not supported texture format %s\n", > _mesa_lookup_enum_by_nr(image->Format)); > } > > do { if ((gmesa)->bufCount+(2<<1) >= (gmesa)->bufSize) do { do { __DRIscreenPrivate *psp = gmesa->driScreen; if (gmesa->driDrawable) { do { char __ret; do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (0), "r" (psp->drawLockID)); } while (0); if (__ret) while ((&psp->pSAREA->drawable_lock)->lock); } while (__ret); } while(0); do { __DRIdrawablePrivate *pdp = gmesa->driDrawable; if (*(pdp->pStamp) != pdp->lastStamp) { int old_index = pdp->index; while (*(pdp->pStamp) != pdp->lastStamp) { do { if (*(pdp->pStamp) != pdp->lastStamp) { __driUtilUpdateDrawableInfo(pdp); } } while (0); } if (pdp->index != old_index) { gmesa->Window &= ~0x000001e0; gmesa->Window |= (pdp->index << 5); do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x0130; gmesa->WCbuf++->i = gmesa->Window|(gmesa->FrameCount<<9); ; } while (0); } gammaUpdateViewportOffset( gmesa->glCtx); if (pdp->numClipRects == 1 && pdp->pClipRects->x1 == pdp->x && pdp->pClipRects->x2 == (pdp->x+pdp->w) && pdp->pClipRects->y1 == pdp->y && pdp->pClipRects->y2 == (pdp->y+pdp->h)) { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 0; ; } while (0); gmesa->NotClipped = 0x1; } else { do { (gmesa)->WCbufCount += (1<<1); } while (0); do { gmesa->WCbuf++->i = 0x029e; gmesa->WCbuf++->i = 1; ; } while (0); gmesa->NotClipped = 0x0; } gmesa->WindowChanged = 0x1; if (gmesa->WCbufCount) { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->WCbufIndex); dma.send_sizes = (&(gmesa)->WCbufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->WCbufCount)[i] = 0; } } while (0); (gmesa)->WCbufIndex = -1; } } } while (0); do { char __ret; if ((*&psp->pSAREA->drawable_lock).lock == psp->drawLockID) { do { do { int __dummy; __asm__ __volatile__( "lock ; cmpxchg %4,%1\n\t" "setnz %0" : "=d" (__ret), "=m" ((*(__volatile__ unsigned int *)&psp->pSAREA->drawable_lock)), "=a" (__dummy) : "2" (psp->drawLockID), "r" (0)); } while (0); } while (__ret); } } while(0); do { if ((gmesa)->WCbufIndex < 0) { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->WCbufIndex); dma.request_sizes = (&(gmesa)->WCbufSize); do { if ((retcode = drmDMA(((gmesa)->gammaScreen->driScreen->fd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->WCbufSize)[i] >>= 2; } } while (0); (gmesa)->WCbuf = (dmaBuf)(gmesa)->gammaScreen->bufs-> list[(gmesa)->WCbufIndex].address; } } while (0); } } while (0); do { do { drmDMAReq dma; int retcode, i; for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] <<= 2; } dma.context = ((gmesa)->hHWContext); dma.send_count = 1; dma.send_list = (&(gmesa)->bufIndex); dma.send_sizes = (&(gmesa)->bufCount); dma.flags = 0; dma.request_count = 0; dma.request_size = 0; dma.request_list = ((void *)0); dma.request_sizes = ((void *)0); if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } for (i = 0; i < (1); i++) { (&(gmesa)->bufCount)[i] = 0; } } while (0); } while (0); do { do { drmDMAReq dma; int retcode, i; dma.context = ((gmesa)->hHWContext); dma.send_count = 0; dma.send_list = ((void *)0); dma.send_sizes = ((void *)0); dma.flags = DRM_DMA_WAIT; dma.request_count = (1); dma.request_size = 4096; dma.request_list = (&(gmesa)->bufIndex); dma.request_sizes = (&(gmesa)->bufSize); do { if ((retcode = drmDMA(((gmesa)->driFd), &dma))) { printf ("drmDMA returned %d\n", retcode); } } while (!(dma).granted_count); for (i = 0; i < (1); i++) { (&(gmesa)->bufSize)[i] >>= 2; } } while (0); (gmesa)->buf = (dmaBuf)(gmesa)->gammaScreen->bufs->list[(gmesa)->bufIndex].address; } while (0); } while (0); (gmesa)->bufCount += (2<<1); } while (0); > do { gmesa->buf++->i = 0x0017; gmesa->buf++->i = 0; ; } while (0); > do { gmesa->buf++->i = 0x0117; gmesa->buf++->i = gmesa->LBWindowBase; ; } while (0); >} > >void gammaPrintLocalLRU( gammaContextPtr gmesa ) >{ > gammaTextureObjectPtr t; > int sz = 1 << (gmesa->gammaScreen->logTextureGranularity); > > for( t=(&gmesa->TexObjList)->next ; t!=&gmesa->TexObjList ; t=(t)->next ) { > if (!t->globj) > fprintf(stderr, "Placeholder %d at %x sz %x\n", > t->MemBlock->ofs / sz, > t->MemBlock->ofs, > t->MemBlock->size); > else > fprintf(stderr, "Texture at %x sz %x\n", > t->MemBlock->ofs, > t->MemBlock->size); > > } >} > >void gammaPrintGlobalLRU( gammaContextPtr gmesa ) >{ > int i, j; > GAMMATextureRegionPtr list = gmesa->sarea->texList; > > for (i = 0, j = 64 ; i < 64 ; i++) { > fprintf(stderr, "list[%d] age %d next %d prev %d\n", > j, list[j].age, list[j].next, list[j].prev); > j = list[j].next; > if (j == 64) break; > } > > if (j != 64) > fprintf(stderr, "Loop detected in global LRU\n"); >} > > >void gammaResetGlobalLRU( gammaContextPtr gmesa ) >{ > GAMMATextureRegionPtr list = gmesa->sarea->texList; > int sz = 1 << gmesa->gammaScreen->logTextureGranularity; > int i; > > > > > > > > for (i = 0 ; (i+1) * sz <= gmesa->gammaScreen->textureSize ; i++) { > list[i].prev = i-1; > list[i].next = i+1; > list[i].age = 0; > } > > i--; > list[0].prev = 64; > list[i].prev = i-1; > list[i].next = 64; > list[64].prev = i; > list[64].next = 0; > gmesa->sarea->texAge = 0; >} > > >void gammaUpdateTexLRU( gammaContextPtr gmesa, gammaTextureObjectPtr t ) >{ > int i; > int logsz = gmesa->gammaScreen->logTextureGranularity; > int start = t->MemBlock->ofs >> logsz; > int end = (t->MemBlock->ofs + t->MemBlock->size - 1) >> logsz; > GAMMATextureRegionPtr list = gmesa->sarea->texList; > > gmesa->texAge = ++gmesa->sarea->texAge; > > > > do { do { (t)->next->prev = (t)->prev; (t)->prev->next = (t)->next; } while (0); do { (t)->prev = &(gmesa->TexObjList); (t)->next = (&(gmesa->TexObjList))->next; (&(gmesa->TexObjList))->next->prev = t; (&(gmesa->TexObjList))->next = t; } while(0); } while (0); > > > > for (i = start ; i <= end ; i++) { > > list[i].in_use = 1; > list[i].age = gmesa->texAge; > > > > list[(unsigned)list[i].next].prev = list[i].prev; > list[(unsigned)list[i].prev].next = list[i].next; > > > > list[i].prev = 64; > list[i].next = list[64].next; > list[(unsigned)list[64].next].prev = i; > list[64].next = i; > } >} ># 411 "gamma_texmem.c" >void gammaTexturesGone( gammaContextPtr gmesa, > GLuint offset, > GLuint size, > GLuint in_use ) >{ > gammaTextureObjectPtr t, tmp; > > for(t=(&gmesa->TexObjList)->next,tmp=(t)->next; &gmesa->TexObjList != t; t=tmp, tmp=(tmp)->next) { > > if (t->MemBlock->ofs >= offset + size || > t->MemBlock->ofs + t->MemBlock->size <= offset) > continue; > > > > > gammaSwapOutTexObj( gmesa, t ); > } > > if (in_use) { > t = (gammaTextureObjectPtr) calloc(1,sizeof(*t)); > if (!t) return; > > t->MemBlock = mmAllocMem( gmesa->texHeap, size, 0, offset); > do { (t)->prev = &gmesa->TexObjList; (t)->next = (&gmesa->TexObjList)->next; (&gmesa->TexObjList)->next->prev = t; (&gmesa->TexObjList)->next = t; } while(0); > } ># 461 "gamma_texmem.c" >} ># 470 "gamma_texmem.c" >void gammaUploadTexImages( gammaContextPtr gmesa, gammaTextureObjectPtr t ) >{ > int i; > int ofs; > int numLevels; ># 483 "gamma_texmem.c" > if (!t->MemBlock) { > while (1) > { > t->MemBlock = mmAllocMem( gmesa->texHeap, t->totalSize, 12, 0 ); > if (t->MemBlock) > break; > > if (gmesa->TexObjList.prev == gmesa->CurrentTexObj[0] || > gmesa->TexObjList.prev == gmesa->CurrentTexObj[1]) { > fprintf(stderr, "Hit bound texture in upload\n"); > gammaPrintLocalLRU( gmesa ); > return; > } > > if (gmesa->TexObjList.prev == &(gmesa->TexObjList)) { > fprintf(stderr, "Failed to upload texture, sz %d\n", t->totalSize); > mmDumpMemInfo( gmesa->texHeap ); > return; > } > > gammaSwapOutTexObj( gmesa, gmesa->TexObjList.prev ); > } > > ofs = t->MemBlock->ofs; > t->BufAddr = (char *)(unsigned long)(gmesa->LBWindowBase + ofs); > > if (t == gmesa->CurrentTexObj[0]) > gmesa->dirty |= 0x00020000; > > > > > > > gammaUpdateTexLRU( gmesa, t ); > } > > > > > > > numLevels = t->lastLevel - t->firstLevel + 1; > for (i = 0 ; i < numLevels ; i++) > if (t->dirty_images & (1<<i)) > gammaUploadTexLevel( gmesa, t, i ); > > t->dirty_images = 0; > > > > >}
You cannot view the attachment while viewing its details because your browser does not support IFRAMEs.
View the attachment on a separate page
.
View Attachment As Raw
Actions:
View
Attachments on
bug 69067
: 42651 |
42680