Attachment 766725 Details for Bug 834882 – LastTest.log

LastTest.log

LastTest.log (text/x-log), 663.35 KB, created by Jakov Smolić on 2022-03-10 08:31:45 UTC

(hide)

Description:

Filename:

MIME Type:

Creator: Jakov Smolić

Created: 2022-03-10 08:31:45 UTC

Size: 663.35 KB

patch

obsolete

>Start testing: Mar 10 09:26 CET
>----------------------------------------------------------
>1/1 Testing: unit-test
>1/1 Test: unit-test
>Command: "/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3_build/unit-test"
>Directory: /var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test
>"unit-test" start time: Mar 10 09:26 CET
>Output:
>----------------------------------------------------------
>Running 2 test cases...
>5
>_audit_conform.dict_name      mmcif_pdbx_v50 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>6
>_audit_conform.dict_version   ? 
>_database_2.database_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>7
># 
>_database_2.database_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>8
>loop_
>PDB   1CBS         
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>9
>_software.name 
>WWPDB D_1000172215 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>10
>_software.classification 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>11
>_software.version 
>_pdbx_database_status.status_code                     REL 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>12
>_software.citation_id 
>_pdbx_database_status.entry_id                        1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>13
>_software.pdbx_ordinal 
>_pdbx_database_status.recvd_initial_deposition_date   1994-09-28 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>14
>_software.date 
>_pdbx_database_status.deposit_site                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>15
>X-PLOR 'model building' . ? 1 ? 
>_pdbx_database_status.process_site                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>16
>X-PLOR refinement       . ? 2 ? 
>_pdbx_database_status.status_code_sf                  REL 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>17
>X-PLOR phasing          . ? 3 ? 
>_pdbx_database_status.status_code_mr                  ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>18
>dssp   other            ? ? 4 ? 
>_pdbx_database_status.SG_entry                        ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>19
># 
>_pdbx_database_status.pdb_format_compatible           Y 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>20
>loop_
>_pdbx_database_status.status_code_cs                  ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>21
>_pdbx_poly_seq_scheme.asym_id 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>22
>_pdbx_poly_seq_scheme.entity_id 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>23
>_pdbx_poly_seq_scheme.seq_id 
>_audit_author.name 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>24
>_pdbx_poly_seq_scheme.mon_id 
>_audit_author.pdbx_ordinal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>25
>_pdbx_poly_seq_scheme.ndb_seq_num 
>'Kleywegt, G.J.' 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>26
>_pdbx_poly_seq_scheme.pdb_seq_num 
>'Bergfors, T.'   2 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>27
>_pdbx_poly_seq_scheme.auth_seq_num 
>'Jones, T.A.'    3 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>28
>_pdbx_poly_seq_scheme.pdb_mon_id 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>29
>_pdbx_poly_seq_scheme.auth_mon_id 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>30
>_pdbx_poly_seq_scheme.pdb_strand_id 
>_citation.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>31
>_pdbx_poly_seq_scheme.pdb_ins_code 
>_citation.title 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>32
>_pdbx_poly_seq_scheme.hetero 
>_citation.journal_abbrev 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>33
>A 1 1   PRO 1   1   1   PRO PRO A . n 
>_citation.journal_volume 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>34
>A 1 2   ASN 2   2   2   ASN ASN A . n 
>_citation.page_first 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>35
>A 1 3   PHE 3   3   3   PHE PHE A . n 
>_citation.page_last 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>36
>A 1 4   SER 4   4   4   SER SER A . n 
>_citation.year 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>37
>A 1 5   GLY 5   5   5   GLY GLY A . n 
>_citation.journal_id_ASTM 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>38
>A 1 6   ASN 6   6   6   ASN ASN A . n 
>_citation.country 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>39
>A 1 7   TRP 7   7   7   TRP TRP A . n 
>_citation.journal_id_ISSN 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>40
>A 1 8   LYS 8   8   8   LYS LYS A . n 
>_citation.journal_id_CSD 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>41
>A 1 9   ILE 9   9   9   ILE ILE A . n 
>_citation.book_publisher 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>42
>A 1 10  ILE 10  10  10  ILE ILE A . n 
>_citation.pdbx_database_id_PubMed 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>43
>A 1 11  ARG 11  11  11  ARG ARG A . n 
>_citation.pdbx_database_id_DOI 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>44
>A 1 12  SER 12  12  12  SER SER A . n 
>primary 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>45
>A 1 13  GLU 13  13  13  GLU GLU A . n 
>;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid.
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>46
>A 1 14  ASN 14  14  14  ASN ASN A . n 
>;
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>47
>A 1 15  PHE 15  15  15  PHE PHE A . n 
>Structure                  2   1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>48
>A 1 16  GLU 16  16  16  GLU GLU A . n 
>1       'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins'                              
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>49
>A 1 17  GLU 17  17  17  GLU GLU A . n 
>'Adv.Protein Chem.'        45  89   ?    1994 APCHA2 US 0065-3233 0433 ? ?       ?                             
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>50
>A 1 18  LEU 18  18  18  LEU LEU A . n 
>2       'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>51
>A 1 19  LEU 19  19  19  LEU LEU A . n 
>'Acta Crystallogr.,Sect.D' 50  370  ?    1994 ABCRE6 DK 0907-4449 0766 ? ?       ?                             
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>52
>A 1 20  LYS 20  20  20  LYS LYS A . n 
>3       
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>53
>A 1 21  VAL 21  21  21  VAL VAL A . n 
>;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>54
>A 1 22  LEU 22  22  22  LEU LEU A . n 
>;
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>55
>A 1 23  GLY 23  23  23  GLY GLY A . n 
>J.Mol.Biol.                230 1225 ?    1993 JMOBAK UK 0022-2836 0070 ? ?       ?                             
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>56
>A 1 24  VAL 24  24  24  VAL VAL A . n 
>4       'The Three-Dimensional Structure of P2 Myelin Protein'                                                        
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>57
>A 1 25  ASN 25  25  25  ASN ASN A . n 
>'Embo J.'                  7   1597 ?    1988 EMJODG UK 0261-4189 0897 ? ?       ?                             
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>58
>A 1 26  VAL 26  26  26  VAL VAL A . n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>59
>A 1 27  MET 27  27  27  MET MET A . n 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>60
>A 1 28  LEU 28  28  28  LEU LEU A . n 
>_citation_author.citation_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>61
>A 1 29  ARG 29  29  29  ARG ARG A . n 
>_citation_author.name 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>62
>A 1 30  LYS 30  30  30  LYS LYS A . n 
>_citation_author.ordinal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>63
>A 1 31  ILE 31  31  31  ILE ILE A . n 
>primary 'Kleywegt, G.J.' 1  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>64
>A 1 32  ALA 32  32  32  ALA ALA A . n 
>primary 'Bergfors, T.'   2  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>65
>A 1 33  VAL 33  33  33  VAL VAL A . n 
>primary 'Senn, H.'       3  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>66
>A 1 34  ALA 34  34  34  ALA ALA A . n 
>primary 'Le Motte, P.'   4  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>67
>A 1 35  ALA 35  35  35  ALA ALA A . n 
>primary 'Gsell, B.'      5  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>68
>A 1 36  ALA 36  36  36  ALA ALA A . n 
>primary 'Shudo, K.'      6  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>69
>A 1 37  SER 37  37  37  SER SER A . n 
>primary 'Jones, T.A.'    7  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>70
>A 1 38  LYS 38  38  38  LYS LYS A . n 
>1       'Banaszak, L.'   8  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>71
>A 1 39  PRO 39  39  39  PRO PRO A . n 
>1       'Winter, N.'     9  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>72
>A 1 40  ALA 40  40  40  ALA ALA A . n 
>1       'Xu, Z.'         10 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>73
>A 1 41  VAL 41  41  41  VAL VAL A . n 
>1       'Bernlohr, D.A.' 11 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>74
>A 1 42  GLU 42  42  42  GLU GLU A . n 
>1       'Cowan, S.W.'    12 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>75
>A 1 43  ILE 43  43  43  ILE ILE A . n 
>1       'Jones, T.A.'    13 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>76
>A 1 44  LYS 44  44  44  LYS LYS A . n 
>2       'Bergfors, T.'   14 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>77
>A 1 45  GLN 45  45  45  GLN GLN A . n 
>2       'Kleywegt, G.J.' 15 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>78
>A 1 46  GLU 46  46  46  GLU GLU A . n 
>2       'Jones, T.A.'    16 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>79
>A 1 47  GLY 47  47  47  GLY GLY A . n 
>3       'Cowan, S.W.'    17 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>80
>A 1 48  ASP 48  48  48  ASP ASP A . n 
>3       'Newcomer, M.E.' 18 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>81
>A 1 49  THR 49  49  49  THR THR A . n 
>3       'Jones, T.A.'    19 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>82
>A 1 50  PHE 50  50  50  PHE PHE A . n 
>4       'Jones, T.A.'    20 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>83
>A 1 51  TYR 51  51  51  TYR TYR A . n 
>4       'Bergfors, T.'   21 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>84
>A 1 52  ILE 52  52  52  ILE ILE A . n 
>4       'Sedzik, J.'     22 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>85
>A 1 53  LYS 53  53  53  LYS LYS A . n 
>4       'Unge, T.'       23 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>86
>A 1 54  THR 54  54  54  THR THR A . n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>87
>A 1 55  SER 55  55  55  SER SER A . n 
>_cell.entry_id           1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>88
>A 1 56  THR 56  56  56  THR THR A . n 
>_cell.length_a           45.650 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>89
>A 1 57  THR 57  57  57  THR THR A . n 
>_cell.length_b           47.560 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>90
>A 1 58  VAL 58  58  58  VAL VAL A . n 
>_cell.length_c           77.610 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>91
>A 1 59  ARG 59  59  59  ARG ARG A . n 
>_cell.angle_alpha        90.00 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>92
>A 1 60  THR 60  60  60  THR THR A . n 
>_cell.angle_beta         90.00 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>93
>A 1 61  THR 61  61  61  THR THR A . n 
>_cell.angle_gamma        90.00 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>94
>A 1 62  GLU 62  62  62  GLU GLU A . n 
>_cell.Z_PDB              4 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>95
>A 1 63  ILE 63  63  63  ILE ILE A . n 
>_cell.pdbx_unique_axis   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>96
>A 1 64  ASN 64  64  64  ASN ASN A . n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>97
>A 1 65  PHE 65  65  65  PHE PHE A . n 
>_symmetry.entry_id                         1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>98
>A 1 66  LYS 66  66  66  LYS LYS A . n 
>_symmetry.space_group_name_H-M             'P 21 21 21' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>99
>A 1 67  VAL 67  67  67  VAL VAL A . n 
>_symmetry.pdbx_full_space_group_name_H-M   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>100
>A 1 68  GLY 68  68  68  GLY GLY A . n 
>_symmetry.cell_setting                     ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>101
>A 1 69  GLU 69  69  69  GLU GLU A . n 
>_symmetry.Int_Tables_number                19 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>102
>A 1 70  GLU 70  70  70  GLU GLU A . n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>103
>A 1 71  PHE 71  71  71  PHE PHE A . n 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>104
>A 1 72  GLU 72  72  72  GLU GLU A . n 
>_entity.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>105
>A 1 73  GLU 73  73  73  GLU GLU A . n 
>_entity.type 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>106
>A 1 74  GLN 74  74  74  GLN GLN A . n 
>_entity.src_method 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>107
>A 1 75  THR 75  75  75  THR THR A . n 
>_entity.pdbx_description 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>108
>A 1 76  VAL 76  76  76  VAL VAL A . n 
>_entity.formula_weight 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>109
>A 1 77  ASP 77  77  77  ASP ASP A . n 
>_entity.pdbx_number_of_molecules 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>110
>A 1 78  GLY 78  78  78  GLY GLY A . n 
>_entity.pdbx_ec 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>111
>A 1 79  ARG 79  79  79  ARG ARG A . n 
>_entity.pdbx_mutation 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>112
>A 1 80  PRO 80  80  80  PRO PRO A . n 
>_entity.pdbx_fragment 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>113
>A 1 81  CYS 81  81  81  CYS CYS A . n 
>_entity.details 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>114
>A 1 82  LYS 82  82  82  LYS LYS A . n 
>1 polymer     man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1   ? ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>115
>A 1 83  SER 83  83  83  SER SER A . n 
>2 non-polymer syn 'RETINOIC ACID'                                  300.435   1   ? ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>116
>A 1 84  LEU 84  84  84  LEU LEU A . n 
>3 water       nat water                                            18.015    100 ? ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>117
>A 1 85  VAL 85  85  85  VAL VAL A . n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>118
>A 1 86  LYS 86  86  86  LYS LYS A . n 
>_entity_poly.entity_id                      1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>119
>A 1 87  TRP 87  87  87  TRP TRP A . n 
>_entity_poly.type                           polypeptide(L) 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>120
>A 1 88  GLU 88  88  88  GLU GLU A . n 
>_entity_poly.nstd_linkage                   no 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>121
>A 1 89  SER 89  89  89  SER SER A . n 
>_entity_poly.nstd_monomer                   no 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>122
>A 1 90  GLU 90  90  90  GLU GLU A . n 
>_entity_poly.pdbx_seq_one_letter_code       
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>123
>A 1 91  ASN 91  91  91  ASN ASN A . n 
>;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>124
>A 1 92  LYS 92  92  92  LYS LYS A . n 
>CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>125
>A 1 93  MET 93  93  93  MET MET A . n 
>;
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>126
>A 1 94  VAL 94  94  94  VAL VAL A . n 
>_entity_poly.pdbx_seq_one_letter_code_can   
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>127
>A 1 95  CYS 95  95  95  CYS CYS A . n 
>;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>128
>A 1 96  GLU 96  96  96  GLU GLU A . n 
>CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>129
>A 1 97  GLN 97  97  97  GLN GLN A . n 
>;
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>130
>A 1 98  LYS 98  98  98  LYS LYS A . n 
>_entity_poly.pdbx_strand_id                 A 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>131
>A 1 99  LEU 99  99  99  LEU LEU A . n 
>_entity_poly.pdbx_target_identifier         ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>132
>A 1 100 LEU 100 100 100 LEU LEU A . n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>133
>A 1 101 LYS 101 101 101 LYS LYS A . n 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>134
>A 1 102 GLY 102 102 102 GLY GLY A . n 
>_entity_poly_seq.entity_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>135
>A 1 103 GLU 103 103 103 GLU GLU A . n 
>_entity_poly_seq.num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>136
>A 1 104 GLY 104 104 104 GLY GLY A . n 
>_entity_poly_seq.mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>137
>A 1 105 PRO 105 105 105 PRO PRO A . n 
>_entity_poly_seq.hetero 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>138
>A 1 106 LYS 106 106 106 LYS LYS A . n 
>1 1   PRO n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>139
>A 1 107 THR 107 107 107 THR THR A . n 
>1 2   ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>140
>A 1 108 SER 108 108 108 SER SER A . n 
>1 3   PHE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>141
>A 1 109 TRP 109 109 109 TRP TRP A . n 
>1 4   SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>142
>A 1 110 THR 110 110 110 THR THR A . n 
>1 5   GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>143
>A 1 111 ARG 111 111 111 ARG ARG A . n 
>1 6   ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>144
>A 1 112 GLU 112 112 112 GLU GLU A . n 
>1 7   TRP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>145
>A 1 113 LEU 113 113 113 LEU LEU A . n 
>1 8   LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>146
>A 1 114 THR 114 114 114 THR THR A . n 
>1 9   ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>147
>A 1 115 ASN 115 115 115 ASN ASN A . n 
>1 10  ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>148
>A 1 116 ASP 116 116 116 ASP ASP A . n 
>1 11  ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>149
>A 1 117 GLY 117 117 117 GLY GLY A . n 
>1 12  SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>150
>A 1 118 GLU 118 118 118 GLU GLU A . n 
>1 13  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>151
>A 1 119 LEU 119 119 119 LEU LEU A . n 
>1 14  ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>152
>A 1 120 ILE 120 120 120 ILE ILE A . n 
>1 15  PHE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>153
>A 1 121 LEU 121 121 121 LEU LEU A . n 
>1 16  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>154
>A 1 122 THR 122 122 122 THR THR A . n 
>1 17  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>155
>A 1 123 MET 123 123 123 MET MET A . n 
>1 18  LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>156
>A 1 124 THR 124 124 124 THR THR A . n 
>1 19  LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>157
>A 1 125 ALA 125 125 125 ALA ALA A . n 
>1 20  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>158
>A 1 126 ASP 126 126 126 ASP ASP A . n 
>1 21  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>159
>A 1 127 ASP 127 127 127 ASP ASP A . n 
>1 22  LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>160
>A 1 128 VAL 128 128 128 VAL VAL A . n 
>1 23  GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>161
>A 1 129 VAL 129 129 129 VAL VAL A . n 
>1 24  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>162
>A 1 130 CYS 130 130 130 CYS CYS A . n 
>1 25  ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>163
>A 1 131 THR 131 131 131 THR THR A . n 
>1 26  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>164
>A 1 132 ARG 132 132 132 ARG ARG A . n 
>1 27  MET n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>165
>A 1 133 VAL 133 133 133 VAL VAL A . n 
>1 28  LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>166
>A 1 134 TYR 134 134 134 TYR TYR A . n 
>1 29  ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>167
>A 1 135 VAL 135 135 135 VAL VAL A . n 
>1 30  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>168
>A 1 136 ARG 136 136 136 ARG ARG A . n 
>1 31  ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>169
>A 1 137 GLU 137 137 137 GLU GLU A . n 
>1 32  ALA n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>170
># 
>1 33  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>171
>loop_
>1 34  ALA n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>172
>_struct_conf.conf_type_id 
>1 35  ALA n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>173
>_struct_conf.id 
>1 36  ALA n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>174
>_struct_conf.pdbx_PDB_helix_id 
>1 37  SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>175
>_struct_conf.beg_label_comp_id 
>1 38  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>176
>_struct_conf.beg_label_asym_id 
>1 39  PRO n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>177
>_struct_conf.beg_label_seq_id 
>1 40  ALA n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>178
>_struct_conf.pdbx_beg_PDB_ins_code 
>1 41  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>179
>_struct_conf.end_label_comp_id 
>1 42  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>180
>_struct_conf.end_label_asym_id 
>1 43  ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>181
>_struct_conf.end_label_seq_id 
>1 44  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>182
>_struct_conf.pdbx_end_PDB_ins_code 
>1 45  GLN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>183
>_struct_conf.beg_auth_comp_id 
>1 46  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>184
>_struct_conf.beg_auth_asym_id 
>1 47  GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>185
>_struct_conf.beg_auth_seq_id 
>1 48  ASP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>186
>_struct_conf.end_auth_comp_id 
>1 49  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>187
>_struct_conf.end_auth_asym_id 
>1 50  PHE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>188
>_struct_conf.end_auth_seq_id 
>1 51  TYR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>189
>_struct_conf.pdbx_PDB_helix_class 
>1 52  ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>190
>_struct_conf.details 
>1 53  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>191
>_struct_conf.pdbx_PDB_helix_length 
>1 54  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>192
>OTHER        OTHER1        ? PRO A 1   ? SER A 4   ? PRO A 1   SER A 4   ? ? ? 
>1 55  SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>193
>STRN         STRN1         ? GLY A 5   ? GLU A 13  ? GLY A 5   GLU A 13  ? ? ? 
>1 56  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>194
>BEND         BEND1         ? ASN A 14  ? ASN A 14  ? ASN A 14  ASN A 14  ? ? ? 
>1 57  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>195
>HELX_RH_AL_P HELX_RH_AL_P1 ? PHE A 15  ? VAL A 21  ? PHE A 15  VAL A 21  ? ? ? 
>1 58  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>196
>TURN_TY1_P   TURN_TY1_P1   ? LEU A 22  ? GLY A 23  ? LEU A 22  GLY A 23  ? ? ? 
>1 59  ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>197
>OTHER        OTHER2        ? VAL A 24  ? ASN A 25  ? VAL A 24  ASN A 25  ? ? ? 
>1 60  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>198
>HELX_RH_AL_P HELX_RH_AL_P2 ? VAL A 26  ? ALA A 36  ? VAL A 26  ALA A 36  ? ? ? 
>1 61  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>199
>TURN_TY1_P   TURN_TY1_P2   ? SER A 37  ? SER A 37  ? SER A 37  SER A 37  ? ? ? 
>1 62  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>200
>BEND         BEND2         ? LYS A 38  ? LYS A 38  ? LYS A 38  LYS A 38  ? ? ? 
>1 63  ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>201
>OTHER        OTHER3        ? PRO A 39  ? PRO A 39  ? PRO A 39  PRO A 39  ? ? ? 
>1 64  ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>202
>STRN         STRN2         ? ALA A 40  ? GLU A 46  ? ALA A 40  GLU A 46  ? ? ? 
>1 65  PHE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>203
>TURN_TY1_P   TURN_TY1_P3   ? GLY A 47  ? ASP A 48  ? GLY A 47  ASP A 48  ? ? ? 
>1 66  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>204
>STRN         STRN3         ? THR A 49  ? SER A 55  ? THR A 49  SER A 55  ? ? ? 
>1 67  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>205
>OTHER        OTHER4        ? THR A 56  ? THR A 56  ? THR A 56  THR A 56  ? ? ? 
>1 68  GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>206
>BEND         BEND3         ? THR A 57  ? VAL A 58  ? THR A 57  VAL A 58  ? ? ? 
>1 69  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>207
>OTHER        OTHER5        ? ARG A 59  ? ARG A 59  ? ARG A 59  ARG A 59  ? ? ? 
>1 70  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>208
>STRN         STRN4         ? THR A 60  ? LYS A 66  ? THR A 60  LYS A 66  ? ? ? 
>1 71  PHE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>209
>TURN_TY1_P   TURN_TY1_P4   ? VAL A 67  ? GLY A 68  ? VAL A 67  GLY A 68  ? ? ? 
>1 72  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>210
>BEND         BEND4         ? GLU A 69  ? GLU A 69  ? GLU A 69  GLU A 69  ? ? ? 
>1 73  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>211
>OTHER        OTHER6        ? GLU A 70  ? GLU A 70  ? GLU A 70  GLU A 70  ? ? ? 
>1 74  GLN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>212
>STRN         STRN5         ? PHE A 71  ? GLN A 74  ? PHE A 71  GLN A 74  ? ? ? 
>1 75  THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>213
>OTHER        OTHER7        ? THR A 75  ? THR A 75  ? THR A 75  THR A 75  ? ? ? 
>1 76  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>214
>TURN_TY1_P   TURN_TY1_P5   ? VAL A 76  ? ASP A 77  ? VAL A 76  ASP A 77  ? ? ? 
>1 77  ASP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>215
>BEND         BEND5         ? GLY A 78  ? GLY A 78  ? GLY A 78  GLY A 78  ? ? ? 
>1 78  GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>216
>OTHER        OTHER8        ? ARG A 79  ? ARG A 79  ? ARG A 79  ARG A 79  ? ? ? 
>1 79  ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>217
>STRN         STRN6         ? PRO A 80  ? SER A 89  ? PRO A 80  SER A 89  ? ? ? 
>1 80  PRO n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>218
>TURN_TY1_P   TURN_TY1_P6   ? GLU A 90  ? ASN A 91  ? GLU A 90  ASN A 91  ? ? ? 
>1 81  CYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>219
>STRN         STRN7         ? LYS A 92  ? LEU A 99  ? LYS A 92  LEU A 99  ? ? ? 
>1 82  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>220
>BEND         BEND6         ? LEU A 100 ? GLY A 102 ? LEU A 100 GLY A 102 ? ? ? 
>1 83  SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>221
>OTHER        OTHER9        ? GLU A 103 ? LYS A 106 ? GLU A 103 LYS A 106 ? ? ? 
>1 84  LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>222
>STRN         STRN8         ? THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 ? ? ? 
>1 85  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>223
>OTHER        OTHER10       ? THR A 114 ? THR A 114 ? THR A 114 THR A 114 ? ? ? 
>1 86  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>224
>TURN_TY1_P   TURN_TY1_P7   ? ASN A 115 ? ASP A 116 ? ASN A 115 ASP A 116 ? ? ? 
>1 87  TRP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>225
>BEND         BEND7         ? GLY A 117 ? GLY A 117 ? GLY A 117 GLY A 117 ? ? ? 
>1 88  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>226
>OTHER        OTHER11       ? GLU A 118 ? GLU A 118 ? GLU A 118 GLU A 118 ? ? ? 
>1 89  SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>227
>STRN         STRN9         ? LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 ? ? ? 
>1 90  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>228
>TURN_TY1_P   TURN_TY1_P8   ? ASP A 126 ? ASP A 127 ? ASP A 126 ASP A 127 ? ? ? 
>1 91  ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>229
>STRN         STRN10        ? VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 ? ? ? 
>1 92  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>230
>OTHER        OTHER12       ? GLU A 137 ? GLU A 137 ? GLU A 137 GLU A 137 ? ? ? 
>1 93  MET n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>231
># 
>1 94  VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>232
>loop_
>1 95  CYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>233
>_struct_conf_type.id 
>1 96  GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>234
>_struct_conf_type.criteria 
>1 97  GLN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>235
>_struct_conf_type.reference 
>1 98  LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>236
>OTHER        DSSP ? 
>1 99  LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>237
>STRN         DSSP ? 
>1 100 LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>238
>BEND         DSSP ? 
>1 101 LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>239
>HELX_RH_AL_P DSSP ? 
>1 102 GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>240
>TURN_TY1_P   DSSP ? 
>1 103 GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>241
># 
>1 104 GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>242
>loop_
>1 105 PRO n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>243
>_pdbx_nonpoly_scheme.asym_id 
>1 106 LYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>244
>_pdbx_nonpoly_scheme.entity_id 
>1 107 THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>245
>_pdbx_nonpoly_scheme.mon_id 
>1 108 SER n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>246
>_pdbx_nonpoly_scheme.ndb_seq_num 
>1 109 TRP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>247
>_pdbx_nonpoly_scheme.pdb_seq_num 
>1 110 THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>248
>_pdbx_nonpoly_scheme.auth_seq_num 
>1 111 ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>249
>_pdbx_nonpoly_scheme.pdb_mon_id 
>1 112 GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>250
>_pdbx_nonpoly_scheme.auth_mon_id 
>1 113 LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>251
>_pdbx_nonpoly_scheme.pdb_strand_id 
>1 114 THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>252
>_pdbx_nonpoly_scheme.pdb_ins_code 
>1 115 ASN n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>253
>B 2 REA 1   200 200 REA REA A . 
>1 116 ASP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>254
>C 3 HOH 1   300 300 HOH HOH A . 
>1 117 GLY n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>255
>C 3 HOH 2   301 301 HOH HOH A . 
>1 118 GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>256
>C 3 HOH 3   302 302 HOH HOH A . 
>1 119 LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>257
>C 3 HOH 4   303 303 HOH HOH A . 
>1 120 ILE n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>258
>C 3 HOH 5   304 304 HOH HOH A . 
>1 121 LEU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>259
>C 3 HOH 6   305 305 HOH HOH A . 
>1 122 THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>260
>C 3 HOH 7   306 306 HOH HOH A . 
>1 123 MET n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>261
>C 3 HOH 8   307 307 HOH HOH A . 
>1 124 THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>262
>C 3 HOH 9   308 308 HOH HOH A . 
>1 125 ALA n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>263
>C 3 HOH 10  309 309 HOH HOH A . 
>1 126 ASP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>264
>C 3 HOH 11  310 310 HOH HOH A . 
>1 127 ASP n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>265
>C 3 HOH 12  311 311 HOH HOH A . 
>1 128 VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>266
>C 3 HOH 13  312 312 HOH HOH A . 
>1 129 VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>267
>C 3 HOH 14  313 313 HOH HOH A . 
>1 130 CYS n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>268
>C 3 HOH 15  314 314 HOH HOH A . 
>1 131 THR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>269
>C 3 HOH 16  315 315 HOH HOH A . 
>1 132 ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>270
>C 3 HOH 17  316 316 HOH HOH A . 
>1 133 VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>271
>C 3 HOH 18  317 317 HOH HOH A . 
>1 134 TYR n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>272
>C 3 HOH 19  318 318 HOH HOH A . 
>1 135 VAL n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>273
>C 3 HOH 20  319 319 HOH HOH A . 
>1 136 ARG n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>274
>C 3 HOH 21  320 320 HOH HOH A . 
>1 137 GLU n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>275
>C 3 HOH 22  321 321 HOH HOH A . 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>276
>C 3 HOH 23  322 322 HOH HOH A . 
>_entity_src_gen.entity_id                          1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>277
>C 3 HOH 24  323 323 HOH HOH A . 
>_entity_src_gen.pdbx_src_id                        1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>278
>C 3 HOH 25  324 324 HOH HOH A . 
>_entity_src_gen.pdbx_alt_source_flag               sample 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>279
>C 3 HOH 26  325 325 HOH HOH A . 
>_entity_src_gen.pdbx_seq_type                      ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>280
>C 3 HOH 27  326 326 HOH HOH A . 
>_entity_src_gen.pdbx_beg_seq_num                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>281
>C 3 HOH 28  327 327 HOH HOH A . 
>_entity_src_gen.pdbx_end_seq_num                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>282
>C 3 HOH 29  328 328 HOH HOH A . 
>_entity_src_gen.gene_src_common_name               human 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>283
>C 3 HOH 30  329 329 HOH HOH A . 
>_entity_src_gen.gene_src_genus                     Homo 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>284
>C 3 HOH 31  330 330 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_gene                 'HUMAN CRABP-II' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>285
>C 3 HOH 32  331 331 HOH HOH A . 
>_entity_src_gen.gene_src_species                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>286
>C 3 HOH 33  332 332 HOH HOH A . 
>_entity_src_gen.gene_src_strain                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>287
>C 3 HOH 34  333 333 HOH HOH A . 
>_entity_src_gen.gene_src_tissue                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>288
>C 3 HOH 35  334 334 HOH HOH A . 
>_entity_src_gen.gene_src_tissue_fraction           ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>289
>C 3 HOH 36  335 335 HOH HOH A . 
>_entity_src_gen.gene_src_details                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>290
>C 3 HOH 37  336 336 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_fragment             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>291
>C 3 HOH 38  337 337 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>292
>C 3 HOH 39  338 338 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>293
>C 3 HOH 40  339 339 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_variant              ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>294
>C 3 HOH 41  340 340 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_cell_line            BL21 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>295
>C 3 HOH 42  341 341 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_atcc                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>296
>C 3 HOH 43  342 342 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_organ                ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>297
>C 3 HOH 44  343 343 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_organelle            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>298
>C 3 HOH 45  344 344 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_cell                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>299
>C 3 HOH 46  345 345 HOH HOH A . 
>_entity_src_gen.pdbx_gene_src_cellular_location    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>300
>C 3 HOH 47  346 346 HOH HOH A . 
>_entity_src_gen.host_org_common_name               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>301
>C 3 HOH 48  347 347 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>302
>C 3 HOH 49  348 348 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>303
>C 3 HOH 50  349 349 HOH HOH A . 
>_entity_src_gen.host_org_genus                     Escherichia 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>304
>C 3 HOH 51  350 350 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_gene                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>305
>C 3 HOH 52  351 351 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_organ                ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>306
>C 3 HOH 53  352 352 HOH HOH A . 
>_entity_src_gen.host_org_species                   'Escherichia coli' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>307
>C 3 HOH 54  353 353 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_tissue               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>308
>C 3 HOH 55  354 354 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>309
>C 3 HOH 56  355 355 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>310
>C 3 HOH 57  356 356 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_variant              ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>311
>C 3 HOH 58  357 357 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_cell_line            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>312
>C 3 HOH 59  358 358 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_atcc                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>313
>C 3 HOH 60  359 359 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_culture_collection   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>314
>C 3 HOH 61  360 360 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_cell                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>315
>C 3 HOH 62  361 361 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_organelle            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>316
>C 3 HOH 63  362 362 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_cellular_location    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>317
>C 3 HOH 64  363 363 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_vector_type          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>318
>C 3 HOH 65  364 364 HOH HOH A . 
>_entity_src_gen.pdbx_host_org_vector               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>319
>C 3 HOH 66  365 365 HOH HOH A . 
>_entity_src_gen.host_org_details                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>320
>C 3 HOH 67  366 366 HOH HOH A . 
>_entity_src_gen.expression_system_id               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>321
>C 3 HOH 68  367 367 HOH HOH A . 
>_entity_src_gen.plasmid_name                       PET-3A 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>322
>C 3 HOH 69  368 368 HOH HOH A . 
>_entity_src_gen.plasmid_details                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>323
>C 3 HOH 70  369 369 HOH HOH A . 
>_entity_src_gen.pdbx_description                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>324
>C 3 HOH 71  370 370 HOH HOH A . 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>325
>C 3 HOH 72  371 371 HOH HOH A . 
>_struct_ref.id                         1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>326
>C 3 HOH 73  372 372 HOH HOH A . 
>_struct_ref.db_name                    UNP 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>327
>C 3 HOH 74  373 373 HOH HOH A . 
>_struct_ref.db_code                    RABP2_HUMAN 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>328
>C 3 HOH 75  374 374 HOH HOH A . 
>_struct_ref.entity_id                  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>329
>C 3 HOH 76  375 375 HOH HOH A . 
>_struct_ref.pdbx_db_accession          P29373 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>330
>C 3 HOH 77  376 376 HOH HOH A . 
>_struct_ref.pdbx_align_begin           1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>331
>C 3 HOH 78  377 377 HOH HOH A . 
>_struct_ref.pdbx_seq_one_letter_code   
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>332
>C 3 HOH 79  378 378 HOH HOH A . 
>;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>333
>C 3 HOH 80  379 379 HOH HOH A . 
>CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>334
>C 3 HOH 81  380 380 HOH HOH A . 
>;
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>335
>C 3 HOH 82  381 381 HOH HOH A . 
>_struct_ref.pdbx_db_isoform            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>336
>C 3 HOH 83  382 382 HOH HOH A . 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>337
>C 3 HOH 84  383 383 HOH HOH A . 
>_struct_ref_seq.align_id                      1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>338
>C 3 HOH 85  384 384 HOH HOH A . 
>_struct_ref_seq.ref_id                        1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>339
>C 3 HOH 86  385 385 HOH HOH A . 
>_struct_ref_seq.pdbx_PDB_id_code              1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>340
>C 3 HOH 87  386 386 HOH HOH A . 
>_struct_ref_seq.pdbx_strand_id                A 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>341
>C 3 HOH 88  387 387 HOH HOH A . 
>_struct_ref_seq.seq_align_beg                 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>342
>C 3 HOH 89  388 388 HOH HOH A . 
>_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>343
>C 3 HOH 90  389 389 HOH HOH A . 
>_struct_ref_seq.seq_align_end                 137 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>344
>C 3 HOH 91  390 390 HOH HOH A . 
>_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>345
>C 3 HOH 92  391 391 HOH HOH A . 
>_struct_ref_seq.pdbx_db_accession             P29373 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>346
>C 3 HOH 93  392 392 HOH HOH A . 
>_struct_ref_seq.db_align_beg                  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>347
>C 3 HOH 94  393 393 HOH HOH A . 
>_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>348
>C 3 HOH 95  394 394 HOH HOH A . 
>_struct_ref_seq.db_align_end                  137 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>349
>C 3 HOH 96  395 395 HOH HOH A . 
>_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>350
>C 3 HOH 97  396 396 HOH HOH A . 
>_struct_ref_seq.pdbx_auth_seq_align_beg       1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>351
>C 3 HOH 98  397 397 HOH HOH A . 
>_struct_ref_seq.pdbx_auth_seq_align_end       137 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>352
>C 3 HOH 99  398 398 HOH HOH A . 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>353
>C 3 HOH 100 399 399 HOH HOH A . 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>354
># 
>_chem_comp.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>355
>loop_
>_chem_comp.type 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>356
>_atom_site.group_PDB 
>_chem_comp.mon_nstd_flag 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>357
>_atom_site.id 
>_chem_comp.name 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>358
>_atom_site.type_symbol 
>_chem_comp.pdbx_synonyms 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>359
>_atom_site.label_atom_id 
>_chem_comp.formula 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>360
>_atom_site.label_alt_id 
>_chem_comp.formula_weight 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>361
>_atom_site.label_comp_id 
>ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>362
>_atom_site.label_asym_id 
>ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>363
>_atom_site.label_entity_id 
>ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>364
>_atom_site.label_seq_id 
>ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>365
>_atom_site.pdbx_PDB_ins_code 
>CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>366
>_atom_site.Cartn_x 
>GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>367
>_atom_site.Cartn_y 
>GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>368
>_atom_site.Cartn_z 
>GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>369
>_atom_site.occupancy 
>HOH non-polymer         . WATER           ? 'H2 O'           18.015  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>370
>_atom_site.B_iso_or_equiv 
>ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>371
>_atom_site.pdbx_formal_charge 
>LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>372
>_atom_site.auth_seq_id 
>LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>373
>_atom_site.auth_comp_id 
>MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>374
>_atom_site.auth_asym_id 
>PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>375
>_atom_site.auth_atom_id 
>PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>376
>_atom_site.pdbx_PDB_model_num 
>REA non-polymer         . 'RETINOIC ACID' ? 'C20 H28 O2'     300.435 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>377
>ATOM   1    N N   . PRO A 1 1   ? 16.979 13.301 44.555 1.00 30.05 ? 1   PRO A N   1 
>SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>378
>ATOM   2    C CA  . PRO A 1 1   ? 18.150 13.525 43.680 1.00 28.82 ? 1   PRO A CA  1 
>THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>379
>ATOM   3    C C   . PRO A 1 1   ? 18.656 14.966 43.784 1.00 26.59 ? 1   PRO A C   1 
>TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>380
>ATOM   4    O O   . PRO A 1 1   ? 17.890 15.889 44.078 1.00 26.84 ? 1   PRO A O   1 
>TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>381
>ATOM   5    C CB  . PRO A 1 1   ? 17.678 13.270 42.255 1.00 29.24 ? 1   PRO A CB  1 
>VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>382
>ATOM   6    C CG  . PRO A 1 1   ? 16.248 13.734 42.347 1.00 29.29 ? 1   PRO A CG  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>383
>ATOM   7    C CD  . PRO A 1 1   ? 15.762 13.216 43.724 1.00 30.71 ? 1   PRO A CD  1 
>_exptl.entry_id          1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>384
>ATOM   8    N N   . ASN A 1 2   ? 19.957 15.139 43.558 1.00 24.04 ? 2   ASN A N   1 
>_exptl.method            'X-RAY DIFFRACTION' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>385
>ATOM   9    C CA  . ASN A 1 2   ? 20.576 16.457 43.578 1.00 20.79 ? 2   ASN A CA  1 
>_exptl.crystals_number   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>386
>ATOM   10   C C   . ASN A 1 2   ? 21.301 16.714 42.262 1.00 16.75 ? 2   ASN A C   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>387
>ATOM   11   O O   . ASN A 1 2   ? 22.402 16.215 42.028 1.00 15.23 ? 2   ASN A O   1 
>_exptl_crystal.id                    1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>388
>ATOM   12   C CB  . ASN A 1 2   ? 21.559 16.620 44.724 1.00 22.81 ? 2   ASN A CB  1 
>_exptl_crystal.density_meas          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>389
>ATOM   13   C CG  . ASN A 1 2   ? 22.240 17.968 44.685 1.00 24.29 ? 2   ASN A CG  1 
>_exptl_crystal.density_Matthews      2.70 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>390
>ATOM   14   O OD1 . ASN A 1 2   ? 21.612 18.984 44.358 1.00 21.87 ? 2   ASN A OD1 1 
>_exptl_crystal.density_percent_sol   54.49 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>391
>ATOM   15   N ND2 . ASN A 1 2   ? 23.537 17.983 44.966 1.00 27.94 ? 2   ASN A ND2 1 
>_exptl_crystal.description           ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>392
>ATOM   16   N N   . PHE A 1 3   ? 20.637 17.477 41.402 1.00 14.69 ? 3   PHE A N   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>393
>ATOM   17   C CA  . PHE A 1 3   ? 21.144 17.838 40.087 1.00 12.62 ? 3   PHE A CA  1 
>_diffrn.id                     1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>394
>ATOM   18   C C   . PHE A 1 3   ? 22.152 18.987 40.140 1.00 12.43 ? 3   PHE A C   1 
>_diffrn.ambient_temp           ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>395
>ATOM   19   O O   . PHE A 1 3   ? 22.796 19.289 39.136 1.00 12.12 ? 3   PHE A O   1 
>_diffrn.ambient_temp_details   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>396
>ATOM   20   C CB  . PHE A 1 3   ? 19.970 18.262 39.188 1.00 10.74 ? 3   PHE A CB  1 
>_diffrn.crystal_id             1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>397
>ATOM   21   C CG  . PHE A 1 3   ? 19.073 17.128 38.750 1.00 11.85 ? 3   PHE A CG  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>398
>ATOM   22   C CD1 . PHE A 1 3   ? 18.066 16.646 39.581 1.00 10.90 ? 3   PHE A CD1 1 
>_diffrn_radiation.diffrn_id                        1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>399
>ATOM   23   C CD2 . PHE A 1 3   ? 19.189 16.588 37.475 1.00 13.26 ? 3   PHE A CD2 1 
>_diffrn_radiation.wavelength_id                    1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>400
>ATOM   24   C CE1 . PHE A 1 3   ? 17.200 15.662 39.149 1.00 9.12  ? 3   PHE A CE1 1 
>_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>401
>ATOM   25   C CE2 . PHE A 1 3   ? 18.312 15.594 37.041 1.00 11.76 ? 3   PHE A CE2 1 
>_diffrn_radiation.monochromator                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>402
>ATOM   26   C CZ  . PHE A 1 3   ? 17.324 15.137 37.878 1.00 10.30 ? 3   PHE A CZ  1 
>_diffrn_radiation.pdbx_diffrn_protocol             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>403
>ATOM   27   N N   . SER A 1 4   ? 22.282 19.630 41.299 1.00 11.24 ? 4   SER A N   1 
>_diffrn_radiation.pdbx_scattering_type             x-ray 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>404
>ATOM   28   C CA  . SER A 1 4   ? 23.170 20.780 41.464 1.00 11.30 ? 4   SER A CA  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>405
>ATOM   29   C C   . SER A 1 4   ? 24.627 20.568 41.091 1.00 10.39 ? 4   SER A C   1 
>_diffrn_radiation_wavelength.id           1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>406
>ATOM   30   O O   . SER A 1 4   ? 25.201 19.532 41.384 1.00 10.24 ? 4   SER A O   1 
>_diffrn_radiation_wavelength.wavelength   . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>407
>ATOM   31   C CB  . SER A 1 4   ? 23.112 21.301 42.906 1.00 13.53 ? 4   SER A CB  1 
>_diffrn_radiation_wavelength.wt           1.0 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>408
>ATOM   32   O OG  . SER A 1 4   ? 21.821 21.787 43.240 1.00 16.76 ? 4   SER A OG  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>409
>ATOM   33   N N   . GLY A 1 5   ? 25.224 21.572 40.460 1.00 9.87  ? 5   GLY A N   1 
>_reflns.entry_id                     1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>410
>ATOM   34   C CA  . GLY A 1 5   ? 26.628 21.486 40.103 1.00 10.86 ? 5   GLY A CA  1 
>_reflns.observed_criterion_sigma_I   3. 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>411
>ATOM   35   C C   . GLY A 1 5   ? 26.985 22.158 38.794 1.00 11.21 ? 5   GLY A C   1 
>_reflns.observed_criterion_sigma_F   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>412
>ATOM   36   O O   . GLY A 1 5   ? 26.123 22.761 38.142 1.00 9.91  ? 5   GLY A O   1 
>_reflns.d_resolution_low             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>413
>ATOM   37   N N   . ASN A 1 6   ? 28.277 22.142 38.475 1.00 10.41 ? 6   ASN A N   1 
>_reflns.d_resolution_high            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>414
>ATOM   38   C CA  . ASN A 1 6   ? 28.796 22.676 37.211 1.00 11.06 ? 6   ASN A CA  1 
>_reflns.number_obs                   14678 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>415
>ATOM   39   C C   . ASN A 1 6   ? 29.117 21.435 36.378 1.00 10.33 ? 6   ASN A C   1 
>_reflns.number_all                   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>416
>ATOM   40   O O   . ASN A 1 6   ? 29.947 20.603 36.754 1.00 11.28 ? 6   ASN A O   1 
>_reflns.percent_possible_obs         90.3 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>417
>ATOM   41   C CB  . ASN A 1 6   ? 30.023 23.548 37.445 1.00 12.95 ? 6   ASN A CB  1 
>_reflns.pdbx_Rmerge_I_obs            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>418
>ATOM   42   C CG  . ASN A 1 6   ? 29.675 24.816 38.200 1.00 18.08 ? 6   ASN A CG  1 
>_reflns.pdbx_Rsym_value              ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>419
>ATOM   43   O OD1 . ASN A 1 6   ? 29.022 25.708 37.665 1.00 19.52 ? 6   ASN A OD1 1 
>_reflns.pdbx_netI_over_sigmaI        ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>420
>ATOM   44   N ND2 . ASN A 1 6   ? 30.047 24.872 39.467 1.00 21.23 ? 6   ASN A ND2 1 
>_reflns.B_iso_Wilson_estimate        ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>421
>ATOM   45   N N   . TRP A 1 7   ? 28.399 21.289 35.272 1.00 8.66  ? 7   TRP A N   1 
>_reflns.pdbx_redundancy              ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>422
>ATOM   46   C CA  . TRP A 1 7   ? 28.518 20.119 34.424 1.00 8.74  ? 7   TRP A CA  1 
>_reflns.pdbx_diffrn_id               1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>423
>ATOM   47   C C   . TRP A 1 7   ? 29.246 20.352 33.092 1.00 9.63  ? 7   TRP A C   1 
>_reflns.pdbx_ordinal                 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>424
>ATOM   48   O O   . TRP A 1 7   ? 29.064 21.389 32.440 1.00 9.45  ? 7   TRP A O   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>425
>ATOM   49   C CB  . TRP A 1 7   ? 27.115 19.563 34.152 1.00 8.00  ? 7   TRP A CB  1 
>_refine.entry_id                                 1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>426
>ATOM   50   C CG  . TRP A 1 7   ? 26.325 19.198 35.391 1.00 8.01  ? 7   TRP A CG  1 
>_refine.ls_number_reflns_obs                     14312 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>427
>ATOM   51   C CD1 . TRP A 1 7   ? 25.556 20.031 36.159 1.00 8.29  ? 7   TRP A CD1 1 
>_refine.ls_number_reflns_all                     ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>428
>ATOM   52   C CD2 . TRP A 1 7   ? 26.174 17.885 35.947 1.00 7.60  ? 7   TRP A CD2 1 
>_refine.pdbx_ls_sigma_I                          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>429
>ATOM   53   N NE1 . TRP A 1 7   ? 24.922 19.308 37.156 1.00 9.20  ? 7   TRP A NE1 1 
>_refine.pdbx_ls_sigma_F                          2. 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>430
>ATOM   54   C CE2 . TRP A 1 7   ? 25.286 17.987 37.046 1.00 8.73  ? 7   TRP A CE2 1 
>_refine.pdbx_data_cutoff_high_absF               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>431
>ATOM   55   C CE3 . TRP A 1 7   ? 26.694 16.625 35.618 1.00 6.99  ? 7   TRP A CE3 1 
>_refine.pdbx_data_cutoff_low_absF                ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>432
>ATOM   56   C CZ2 . TRP A 1 7   ? 24.909 16.876 37.815 1.00 7.67  ? 7   TRP A CZ2 1 
>_refine.pdbx_data_cutoff_high_rms_absF           ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>433
>ATOM   57   C CZ3 . TRP A 1 7   ? 26.320 15.527 36.380 1.00 7.58  ? 7   TRP A CZ3 1 
>_refine.ls_d_res_low                             8.0 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>434
>ATOM   58   C CH2 . TRP A 1 7   ? 25.433 15.663 37.468 1.00 5.92  ? 7   TRP A CH2 1 
>_refine.ls_d_res_high                            1.8 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>435
>ATOM   59   N N   . LYS A 1 8   ? 30.052 19.368 32.702 1.00 9.39  ? 8   LYS A N   1 
>_refine.ls_percent_reflns_obs                    90.3 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>436
>ATOM   60   C CA  . LYS A 1 8   ? 30.802 19.424 31.450 1.00 11.56 ? 8   LYS A CA  1 
>_refine.ls_R_factor_obs                          0.2000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>437
>ATOM   61   C C   . LYS A 1 8   ? 30.342 18.243 30.611 1.00 10.56 ? 8   LYS A C   1 
>_refine.ls_R_factor_all                          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>438
>ATOM   62   O O   . LYS A 1 8   ? 30.091 17.158 31.138 1.00 10.14 ? 8   LYS A O   1 
>_refine.ls_R_factor_R_work                       0.2000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>439
>ATOM   63   C CB  . LYS A 1 8   ? 32.308 19.360 31.710 1.00 15.20 ? 8   LYS A CB  1 
>_refine.ls_R_factor_R_free                       0.2370000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>440
>ATOM   64   C CG  . LYS A 1 8   ? 32.785 18.080 32.313 1.00 18.52 ? 8   LYS A CG  1 
>_refine.ls_R_factor_R_free_error                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>441
>ATOM   65   C CD  . LYS A 1 8   ? 34.263 18.182 32.618 1.00 26.26 ? 8   LYS A CD  1 
>_refine.ls_R_factor_R_free_error_details         ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>442
>ATOM   66   C CE  . LYS A 1 8   ? 35.091 18.499 31.378 1.00 29.22 ? 8   LYS A CE  1 
>_refine.ls_percent_reflns_R_free                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>443
>ATOM   67   N NZ  . LYS A 1 8   ? 35.067 17.393 30.369 1.00 32.48 ? 8   LYS A NZ  1 
>_refine.ls_number_reflns_R_free                  ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>444
>ATOM   68   N N   . ILE A 1 9   ? 30.222 18.447 29.308 1.00 8.21  ? 9   ILE A N   1 
>_refine.ls_number_parameters                     ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>445
>ATOM   69   C CA  . ILE A 1 9   ? 29.739 17.384 28.441 1.00 8.08  ? 9   ILE A CA  1 
>_refine.ls_number_restraints                     ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>446
>ATOM   70   C C   . ILE A 1 9   ? 30.798 16.325 28.117 1.00 7.86  ? 9   ILE A C   1 
>_refine.occupancy_min                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>447
>ATOM   71   O O   . ILE A 1 9   ? 31.990 16.635 28.028 1.00 8.38  ? 9   ILE A O   1 
>_refine.occupancy_max                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>448
>ATOM   72   C CB  . ILE A 1 9   ? 29.148 17.997 27.144 1.00 10.70 ? 9   ILE A CB  1 
>_refine.B_iso_mean                               16.6 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>449
>ATOM   73   C CG1 . ILE A 1 9   ? 28.285 16.981 26.401 1.00 10.95 ? 9   ILE A CG1 1 
>_refine.aniso_B[1][1]                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>450
>ATOM   74   C CG2 . ILE A 1 9   ? 30.261 18.500 26.243 1.00 10.70 ? 9   ILE A CG2 1 
>_refine.aniso_B[2][2]                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>451
>ATOM   75   C CD1 . ILE A 1 9   ? 27.586 17.597 25.207 1.00 13.23 ? 9   ILE A CD1 1 
>_refine.aniso_B[3][3]                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>452
>ATOM   76   N N   . ILE A 1 10  ? 30.373 15.067 27.995 1.00 7.08  ? 10  ILE A N   1 
>_refine.aniso_B[1][2]                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>453
>ATOM   77   C CA  . ILE A 1 10  ? 31.288 13.988 27.656 1.00 7.45  ? 10  ILE A CA  1 
>_refine.aniso_B[1][3]                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>454
>ATOM   78   C C   . ILE A 1 10  ? 30.812 13.201 26.441 1.00 8.49  ? 10  ILE A C   1 
>_refine.aniso_B[2][3]                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>455
>ATOM   79   O O   . ILE A 1 10  ? 31.561 12.397 25.892 1.00 9.49  ? 10  ILE A O   1 
>_refine.solvent_model_details                    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>456
>ATOM   80   C CB  . ILE A 1 10  ? 31.586 13.023 28.847 1.00 10.28 ? 10  ILE A CB  1 
>_refine.solvent_model_param_ksol                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>457
>ATOM   81   C CG1 . ILE A 1 10  ? 30.304 12.393 29.382 1.00 10.51 ? 10  ILE A CG1 1 
>_refine.solvent_model_param_bsol                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>458
>ATOM   82   C CG2 . ILE A 1 10  ? 32.349 13.756 29.963 1.00 10.10 ? 10  ILE A CG2 1 
>_refine.pdbx_ls_cross_valid_method               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>459
>ATOM   83   C CD1 . ILE A 1 10  ? 30.578 11.242 30.325 1.00 12.18 ? 10  ILE A CD1 1 
>_refine.details                                  ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>460
>ATOM   84   N N   . ARG A 1 11  ? 29.566 13.419 26.030 1.00 7.59  ? 11  ARG A N   1 
>_refine.pdbx_starting_model                      ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>461
>ATOM   85   C CA  . ARG A 1 11  ? 29.015 12.742 24.851 1.00 8.70  ? 11  ARG A CA  1 
>_refine.pdbx_method_to_determine_struct          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>462
>ATOM   86   C C   . ARG A 1 11  ? 27.821 13.500 24.290 1.00 9.41  ? 11  ARG A C   1 
>_refine.pdbx_isotropic_thermal_model             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>463
>ATOM   87   O O   . ARG A 1 11  ? 26.990 14.004 25.043 1.00 9.84  ? 11  ARG A O   1 
>_refine.pdbx_stereochemistry_target_values       ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>464
>ATOM   88   C CB  . ARG A 1 11  ? 28.563 11.316 25.184 1.00 8.07  ? 11  ARG A CB  1 
>_refine.pdbx_stereochem_target_val_spec_case     ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>465
>ATOM   89   C CG  . ARG A 1 11  ? 27.912 10.616 23.998 1.00 12.26 ? 11  ARG A CG  1 
>_refine.pdbx_R_Free_selection_details            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>466
>ATOM   90   C CD  . ARG A 1 11  ? 27.234 9.340  24.394 1.00 13.46 ? 11  ARG A CD  1 
>_refine.pdbx_overall_ESU_R                       ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>467
>ATOM   91   N NE  . ARG A 1 11  ? 28.157 8.304  24.847 1.00 15.44 ? 11  ARG A NE  1 
>_refine.pdbx_overall_ESU_R_Free                  ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>468
>ATOM   92   C CZ  . ARG A 1 11  ? 28.815 7.470  24.037 1.00 19.59 ? 11  ARG A CZ  1 
>_refine.overall_SU_ML                            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>469
>ATOM   93   N NH1 . ARG A 1 11  ? 28.677 7.559  22.714 1.00 19.40 ? 11  ARG A NH1 1 
>_refine.overall_SU_B                             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>470
>ATOM   94   N NH2 . ARG A 1 11  ? 29.521 6.467  24.547 1.00 17.50 ? 11  ARG A NH2 1 
>_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>471
>ATOM   95   N N   . SER A 1 12  ? 27.748 13.594 22.965 1.00 8.84  ? 12  SER A N   1 
>_refine.pdbx_diffrn_id                           1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>472
>ATOM   96   C CA  . SER A 1 12  ? 26.621 14.245 22.310 1.00 8.61  ? 12  SER A CA  1 
>_refine.pdbx_TLS_residual_ADP_flag               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>473
>ATOM   97   C C   . SER A 1 12  ? 26.278 13.431 21.063 1.00 9.48  ? 12  SER A C   1 
>_refine.correlation_coeff_Fo_to_Fc               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>474
>ATOM   98   O O   . SER A 1 12  ? 27.159 13.147 20.250 1.00 9.84  ? 12  SER A O   1 
>_refine.correlation_coeff_Fo_to_Fc_free          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>475
>ATOM   99   C CB  . SER A 1 12  ? 26.966 15.676 21.925 1.00 9.02  ? 12  SER A CB  1 
>_refine.pdbx_solvent_vdw_probe_radii             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>476
>ATOM   100  O OG  . SER A 1 12  ? 25.863 16.285 21.273 1.00 11.97 ? 12  SER A OG  1 
>_refine.pdbx_solvent_ion_probe_radii             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>477
>ATOM   101  N N   . GLU A 1 13  ? 25.016 13.038 20.924 1.00 7.59  ? 13  GLU A N   1 
>_refine.pdbx_solvent_shrinkage_radii             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>478
>ATOM   102  C CA  . GLU A 1 13  ? 24.586 12.258 19.768 1.00 9.67  ? 13  GLU A CA  1 
>_refine.pdbx_overall_phase_error                 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>479
>ATOM   103  C C   . GLU A 1 13  ? 23.368 12.887 19.118 1.00 9.06  ? 13  GLU A C   1 
>_refine.overall_SU_R_Cruickshank_DPI             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>480
>ATOM   104  O O   . GLU A 1 13  ? 22.457 13.343 19.815 1.00 7.34  ? 13  GLU A O   1 
>_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>481
>ATOM   105  C CB  . GLU A 1 13  ? 24.185 10.833 20.184 1.00 9.72  ? 13  GLU A CB  1 
>_refine.pdbx_overall_SU_R_Blow_DPI               ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>482
>ATOM   106  C CG  . GLU A 1 13  ? 25.257 10.018 20.895 1.00 15.17 ? 13  GLU A CG  1 
>_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>483
>ATOM   107  C CD  . GLU A 1 13  ? 26.262 9.340  19.954 1.00 18.75 ? 13  GLU A CD  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>484
>ATOM   108  O OE1 . GLU A 1 13  ? 26.031 9.310  18.726 1.00 18.53 ? 13  GLU A OE1 1 
>_refine_analyze.entry_id                        1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>485
>ATOM   109  O OE2 . GLU A 1 13  ? 27.286 8.822  20.457 1.00 19.23 ? 13  GLU A OE2 1 
>_refine_analyze.Luzzati_coordinate_error_obs    0.2 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>486
>ATOM   110  N N   . ASN A 1 14  ? 23.363 12.919 17.786 1.00 8.79  ? 14  ASN A N   1 
>_refine_analyze.Luzzati_sigma_a_obs             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>487
>ATOM   111  C CA  . ASN A 1 14  ? 22.202 13.408 17.025 1.00 8.29  ? 14  ASN A CA  1 
>_refine_analyze.Luzzati_d_res_low_obs           ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>488
>ATOM   112  C C   . ASN A 1 14  ? 21.813 14.896 17.153 1.00 7.35  ? 14  ASN A C   1 
>_refine_analyze.Luzzati_coordinate_error_free   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>489
>ATOM   113  O O   . ASN A 1 14  ? 20.681 15.245 16.860 1.00 7.00  ? 14  ASN A O   1 
>_refine_analyze.Luzzati_sigma_a_free            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>490
>ATOM   114  C CB  . ASN A 1 14  ? 20.989 12.522 17.383 1.00 7.23  ? 14  ASN A CB  1 
>_refine_analyze.Luzzati_d_res_low_free          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>491
>ATOM   115  C CG  . ASN A 1 14  ? 20.358 11.833 16.172 1.00 9.38  ? 14  ASN A CG  1 
>_refine_analyze.number_disordered_residues      ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>492
>ATOM   116  O OD1 . ASN A 1 14  ? 20.996 11.670 15.128 1.00 10.37 ? 14  ASN A OD1 1 
>_refine_analyze.occupancy_sum_hydrogen          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>493
>ATOM   117  N ND2 . ASN A 1 14  ? 19.106 11.436 16.310 1.00 6.35  ? 14  ASN A ND2 1 
>_refine_analyze.occupancy_sum_non_hydrogen      ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>494
>ATOM   118  N N   . PHE A 1 15  ? 22.734 15.777 17.536 1.00 7.26  ? 15  PHE A N   1 
>_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>495
>ATOM   119  C CA  . PHE A 1 15  ? 22.385 17.198 17.681 1.00 9.06  ? 15  PHE A CA  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>496
>ATOM   120  C C   . PHE A 1 15  ? 22.041 17.878 16.358 1.00 9.15  ? 15  PHE A C   1 
>_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>497
>ATOM   121  O O   . PHE A 1 15  ? 21.041 18.578 16.265 1.00 8.64  ? 15  PHE A O   1 
>_refine_hist.cycle_id                         LAST 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>498
>ATOM   122  C CB  . PHE A 1 15  ? 23.497 17.990 18.379 1.00 10.05 ? 15  PHE A CB  1 
>_refine_hist.pdbx_number_atoms_protein        1091 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>499
>ATOM   123  C CG  . PHE A 1 15  ? 23.102 19.397 18.746 1.00 10.57 ? 15  PHE A CG  1 
>_refine_hist.pdbx_number_atoms_nucleic_acid   0 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>500
>ATOM   124  C CD1 . PHE A 1 15  ? 22.032 19.633 19.605 1.00 13.39 ? 15  PHE A CD1 1 
>_refine_hist.pdbx_number_atoms_ligand         22 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>501
>ATOM   125  C CD2 . PHE A 1 15  ? 23.813 20.485 18.254 1.00 11.47 ? 15  PHE A CD2 1 
>_refine_hist.number_atoms_solvent             100 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>502
>ATOM   126  C CE1 . PHE A 1 15  ? 21.678 20.929 19.968 1.00 13.52 ? 15  PHE A CE1 1 
>_refine_hist.number_atoms_total               1213 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>503
>ATOM   127  C CE2 . PHE A 1 15  ? 23.467 21.784 18.609 1.00 11.60 ? 15  PHE A CE2 1 
>_refine_hist.d_res_high                       1.8 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>504
>ATOM   128  C CZ  . PHE A 1 15  ? 22.399 22.006 19.469 1.00 13.52 ? 15  PHE A CZ  1 
>_refine_hist.d_res_low                        8.0 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>505
>ATOM   129  N N   . GLU A 1 16  ? 22.878 17.699 15.342 1.00 11.17 ? 16  GLU A N   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>506
>ATOM   130  C CA  . GLU A 1 16  ? 22.583 18.313 14.053 1.00 12.58 ? 16  GLU A CA  1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>507
>ATOM   131  C C   . GLU A 1 16  ? 21.271 17.797 13.468 1.00 11.71 ? 16  GLU A C   1 
>_refine_ls_restr.type 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>508
>ATOM   132  O O   . GLU A 1 16  ? 20.503 18.567 12.888 1.00 12.66 ? 16  GLU A O   1 
>_refine_ls_restr.dev_ideal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>509
>ATOM   133  C CB  . GLU A 1 16  ? 23.711 18.081 13.060 1.00 15.91 ? 16  GLU A CB  1 
>_refine_ls_restr.dev_ideal_target 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>510
>ATOM   134  C CG  . GLU A 1 16  ? 23.274 18.337 11.626 1.00 21.31 ? 16  GLU A CG  1 
>_refine_ls_restr.weight 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>511
>ATOM   135  C CD  . GLU A 1 16  ? 24.376 18.878 10.757 1.00 25.39 ? 16  GLU A CD  1 
>_refine_ls_restr.number 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>512
>ATOM   136  O OE1 . GLU A 1 16  ? 25.526 18.984 11.240 1.00 27.92 ? 16  GLU A OE1 1 
>_refine_ls_restr.pdbx_refine_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>513
>ATOM   137  O OE2 . GLU A 1 16  ? 24.084 19.213 9.588  1.00 28.60 ? 16  GLU A OE2 1 
>_refine_ls_restr.pdbx_restraint_function 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>514
>ATOM   138  N N   . GLU A 1 17  ? 21.018 16.497 13.619 1.00 11.67 ? 17  GLU A N   1 
>x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>515
>ATOM   139  C CA  . GLU A 1 17  ? 19.785 15.878 13.116 1.00 13.65 ? 17  GLU A CA  1 
>x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>516
>ATOM   140  C C   . GLU A 1 17  ? 18.529 16.490 13.767 1.00 13.48 ? 17  GLU A C   1 
>x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>517
>ATOM   141  O O   . GLU A 1 17  ? 17.490 16.662 13.115 1.00 11.68 ? 17  GLU A O   1 
>x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>518
>ATOM   142  C CB  . GLU A 1 17  ? 19.811 14.361 13.325 1.00 17.06 ? 17  GLU A CB  1 
>x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>519
>ATOM   143  C CG  . GLU A 1 17  ? 20.806 13.602 12.430 1.00 23.45 ? 17  GLU A CG  1 
>x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>520
>ATOM   144  C CD  . GLU A 1 17  ? 22.279 13.624 12.909 1.00 27.80 ? 17  GLU A CD  1 
>x_angle_deg             1.51  ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>521
>ATOM   145  O OE1 . GLU A 1 17  ? 22.637 14.338 13.881 1.00 26.52 ? 17  GLU A OE1 1 
>x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>522
>ATOM   146  O OE2 . GLU A 1 17  ? 23.097 12.897 12.291 1.00 31.80 ? 17  GLU A OE2 1 
>x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>523
>ATOM   147  N N   . LEU A 1 18  ? 18.640 16.834 15.048 1.00 10.82 ? 18  LEU A N   1 
>x_dihedral_angle_d      27.4  ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>524
>ATOM   148  C CA  . LEU A 1 18  ? 17.547 17.468 15.777 1.00 9.45  ? 18  LEU A CA  1 
>x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>525
>ATOM   149  C C   . LEU A 1 18  ? 17.302 18.849 15.155 1.00 9.27  ? 18  LEU A C   1 
>x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>526
>ATOM   150  O O   . LEU A 1 18  ? 16.153 19.246 14.927 1.00 9.04  ? 18  LEU A O   1 
>x_improper_angle_d      1.32  ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>527
>ATOM   151  C CB  . LEU A 1 18  ? 17.931 17.644 17.253 1.00 9.77  ? 18  LEU A CB  1 
>x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>528
>ATOM   152  C CG  . LEU A 1 18  ? 16.921 18.358 18.163 1.00 11.36 ? 18  LEU A CG  1 
>x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>529
>ATOM   153  C CD1 . LEU A 1 18  ? 15.817 17.402 18.554 1.00 13.85 ? 18  LEU A CD1 1 
>x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>530
>ATOM   154  C CD2 . LEU A 1 18  ? 17.616 18.876 19.409 1.00 12.69 ? 18  LEU A CD2 1 
>x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>531
>ATOM   155  N N   . LEU A 1 19  ? 18.387 19.568 14.864 1.00 10.75 ? 19  LEU A N   1 
>x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>532
>ATOM   156  C CA  . LEU A 1 19  ? 18.275 20.906 14.276 1.00 11.15 ? 19  LEU A CA  1 
>x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>533
>ATOM   157  C C   . LEU A 1 19  ? 17.671 20.873 12.874 1.00 12.52 ? 19  LEU A C   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>534
>ATOM   158  O O   . LEU A 1 19  ? 16.932 21.777 12.485 1.00 10.05 ? 19  LEU A O   1 
>_struct.entry_id                  1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>535
>ATOM   159  C CB  . LEU A 1 19  ? 19.631 21.616 14.263 1.00 12.01 ? 19  LEU A CB  1 
>_struct.title                     
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>536
>ATOM   160  C CG  . LEU A 1 19  ? 20.282 21.963 15.614 1.00 10.42 ? 19  LEU A CG  1 
>;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>537
>ATOM   161  C CD1 . LEU A 1 19  ? 21.560 22.763 15.369 1.00 13.01 ? 19  LEU A CD1 1 
>;
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>538
>ATOM   162  C CD2 . LEU A 1 19  ? 19.312 22.742 16.513 1.00 11.45 ? 19  LEU A CD2 1 
>_struct.pdbx_descriptor           
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>539
>ATOM   163  N N   . LYS A 1 20  ? 17.944 19.795 12.150 1.00 14.41 ? 20  LYS A N   1 
>'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>540
>ATOM   164  C CA  . LYS A 1 20  ? 17.427 19.628 10.800 1.00 16.54 ? 20  LYS A CA  1 
>_struct.pdbx_model_details        ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>541
>ATOM   165  C C   . LYS A 1 20  ? 15.902 19.512 10.832 1.00 16.17 ? 20  LYS A C   1 
>_struct.pdbx_CASP_flag            ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>542
>ATOM   166  O O   . LYS A 1 20  ? 15.201 20.164 10.053 1.00 15.90 ? 20  LYS A O   1 
>_struct.pdbx_model_type_details   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>543
>ATOM   167  C CB  . LYS A 1 20  ? 18.048 18.390 10.157 1.00 20.07 ? 20  LYS A CB  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>544
>ATOM   168  C CG  . LYS A 1 20  ? 18.592 18.643 8.765  1.00 26.61 ? 20  LYS A CG  1 
>_struct_keywords.entry_id        1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>545
>ATOM   169  C CD  . LYS A 1 20  ? 18.960 17.349 8.027  1.00 30.95 ? 20  LYS A CD  1 
>_struct_keywords.pdbx_keywords   'RETINOIC-ACID TRANSPORT' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>546
>ATOM   170  C CE  . LYS A 1 20  ? 20.226 16.690 8.579  1.00 35.68 ? 20  LYS A CE  1 
>_struct_keywords.text            'RETINOIC-ACID TRANSPORT' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>547
>ATOM   171  N NZ  . LYS A 1 20  ? 21.485 17.466 8.342  1.00 39.27 ? 20  LYS A NZ  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>548
>ATOM   172  N N   . VAL A 1 21  ? 15.395 18.700 11.759 1.00 15.31 ? 21  VAL A N   1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>549
>ATOM   173  C CA  . VAL A 1 21  ? 13.958 18.508 11.927 1.00 14.41 ? 21  VAL A CA  1 
>_struct_asym.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>550
>ATOM   174  C C   . VAL A 1 21  ? 13.275 19.831 12.316 1.00 15.02 ? 21  VAL A C   1 
>_struct_asym.pdbx_blank_PDB_chainid_flag 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>551
>ATOM   175  O O   . VAL A 1 21  ? 12.150 20.119 11.878 1.00 13.59 ? 21  VAL A O   1 
>_struct_asym.pdbx_modified 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>552
>ATOM   176  C CB  . VAL A 1 21  ? 13.674 17.422 12.998 1.00 14.93 ? 21  VAL A CB  1 
>_struct_asym.entity_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>553
>ATOM   177  C CG1 . VAL A 1 21  ? 12.194 17.383 13.364 1.00 17.29 ? 21  VAL A CG1 1 
>_struct_asym.details 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>554
>ATOM   178  C CG2 . VAL A 1 21  ? 14.115 16.082 12.482 1.00 15.09 ? 21  VAL A CG2 1 
>A N N 1 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>555
>ATOM   179  N N   . LEU A 1 22  ? 13.966 20.643 13.119 1.00 14.52 ? 22  LEU A N   1 
>B N N 2 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>556
>ATOM   180  C CA  . LEU A 1 22  ? 13.432 21.938 13.569 1.00 14.42 ? 22  LEU A CA  1 
>C N N 3 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>557
>ATOM   181  C C   . LEU A 1 22  ? 13.478 22.984 12.467 1.00 15.49 ? 22  LEU A C   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>558
>ATOM   182  O O   . LEU A 1 22  ? 13.038 24.115 12.666 1.00 16.81 ? 22  LEU A O   1 
>_struct_biol.id   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>559
>ATOM   183  C CB  . LEU A 1 22  ? 14.180 22.440 14.818 1.00 13.61 ? 22  LEU A CB  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>560
>ATOM   184  C CG  . LEU A 1 22  ? 13.986 21.565 16.069 1.00 13.97 ? 22  LEU A CG  1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>561
>ATOM   185  C CD1 . LEU A 1 22  ? 14.852 22.047 17.225 1.00 13.25 ? 22  LEU A CD1 1 
>_struct_conf.conf_type_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>562
>ATOM   186  C CD2 . LEU A 1 22  ? 12.525 21.580 16.467 1.00 14.62 ? 22  LEU A CD2 1 
>_struct_conf.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>563
>ATOM   187  N N   . GLY A 1 23  ? 14.062 22.618 11.328 1.00 16.41 ? 23  GLY A N   1 
>_struct_conf.pdbx_PDB_helix_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>564
>ATOM   188  C CA  . GLY A 1 23  ? 14.123 23.516 10.183 1.00 17.05 ? 23  GLY A CA  1 
>_struct_conf.beg_label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>565
>ATOM   189  C C   . GLY A 1 23  ? 15.241 24.539 10.125 1.00 18.00 ? 23  GLY A C   1 
>_struct_conf.beg_label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>566
>ATOM   190  O O   . GLY A 1 23  ? 15.112 25.545 9.425  1.00 19.45 ? 23  GLY A O   1 
>_struct_conf.beg_label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>567
>ATOM   191  N N   . VAL A 1 24  ? 16.320 24.315 10.869 1.00 14.78 ? 24  VAL A N   1 
>_struct_conf.pdbx_beg_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>568
>ATOM   192  C CA  . VAL A 1 24  ? 17.440 25.241 10.860 1.00 13.71 ? 24  VAL A CA  1 
>_struct_conf.end_label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>569
>ATOM   193  C C   . VAL A 1 24  ? 18.289 24.983 9.607  1.00 15.09 ? 24  VAL A C   1 
>_struct_conf.end_label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>570
>ATOM   194  O O   . VAL A 1 24  ? 18.679 23.840 9.334  1.00 14.12 ? 24  VAL A O   1 
>_struct_conf.end_label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>571
>ATOM   195  C CB  . VAL A 1 24  ? 18.297 25.081 12.139 1.00 12.19 ? 24  VAL A CB  1 
>_struct_conf.pdbx_end_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>572
>ATOM   196  C CG1 . VAL A 1 24  ? 19.465 26.054 12.109 1.00 8.69  ? 24  VAL A CG1 1 
>_struct_conf.beg_auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>573
>ATOM   197  C CG2 . VAL A 1 24  ? 17.416 25.294 13.388 1.00 11.37 ? 24  VAL A CG2 1 
>_struct_conf.beg_auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>574
>ATOM   198  N N   . ASN A 1 25  ? 18.595 26.047 8.866  1.00 15.37 ? 25  ASN A N   1 
>_struct_conf.beg_auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>575
>ATOM   199  C CA  . ASN A 1 25  ? 19.360 25.914 7.635  1.00 17.74 ? 25  ASN A CA  1 
>_struct_conf.end_auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>576
>ATOM   200  C C   . ASN A 1 25  ? 20.808 25.466 7.819  1.00 18.29 ? 25  ASN A C   1 
>_struct_conf.end_auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>577
>ATOM   201  O O   . ASN A 1 25  ? 21.377 25.592 8.903  1.00 18.05 ? 25  ASN A O   1 
>_struct_conf.end_auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>578
>ATOM   202  C CB  . ASN A 1 25  ? 19.230 27.172 6.742  1.00 19.41 ? 25  ASN A CB  1 
>_struct_conf.pdbx_PDB_helix_class 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>579
>ATOM   203  C CG  . ASN A 1 25  ? 20.090 28.351 7.200  1.00 22.35 ? 25  ASN A CG  1 
>_struct_conf.details 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>580
>ATOM   204  O OD1 . ASN A 1 25  ? 21.207 28.189 7.698  1.00 22.64 ? 25  ASN A OD1 1 
>_struct_conf.pdbx_PDB_helix_length 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>581
>ATOM   205  N ND2 . ASN A 1 25  ? 19.602 29.558 6.933  1.00 24.15 ? 25  ASN A ND2 1 
>OTHER        OTHER1        ? PRO A 1   ? SER A 4   ? PRO A 1   SER A 4   ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>582
>ATOM   206  N N   . VAL A 1 26  ? 21.398 24.971 6.733  1.00 18.67 ? 26  VAL A N   1 
>STRN         STRN1         ? GLY A 5   ? GLU A 13  ? GLY A 5   GLU A 13  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>583
>ATOM   207  C CA  . VAL A 1 26  ? 22.755 24.444 6.742  1.00 19.24 ? 26  VAL A CA  1 
>BEND         BEND1         ? ASN A 14  ? ASN A 14  ? ASN A 14  ASN A 14  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>584
>ATOM   208  C C   . VAL A 1 26  ? 23.825 25.280 7.421  1.00 18.39 ? 26  VAL A C   1 
>HELX_RH_AL_P HELX_RH_AL_P1 ? PHE A 15  ? VAL A 21  ? PHE A 15  VAL A 21  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>585
>ATOM   209  O O   . VAL A 1 26  ? 24.558 24.764 8.261  1.00 18.50 ? 26  VAL A O   1 
>TURN_TY1_P   TURN_TY1_P1   ? LEU A 22  ? GLY A 23  ? LEU A 22  GLY A 23  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>586
>ATOM   210  C CB  . VAL A 1 26  ? 23.223 24.088 5.320  1.00 20.77 ? 26  VAL A CB  1 
>OTHER        OTHER2        ? VAL A 24  ? ASN A 25  ? VAL A 24  ASN A 25  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>587
>ATOM   211  C CG1 . VAL A 1 26  ? 24.624 23.523 5.378  1.00 22.39 ? 26  VAL A CG1 1 
>HELX_RH_AL_P HELX_RH_AL_P2 ? VAL A 26  ? ALA A 36  ? VAL A 26  ALA A 36  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>588
>ATOM   212  C CG2 . VAL A 1 26  ? 22.276 23.084 4.698  1.00 21.28 ? 26  VAL A CG2 1 
>TURN_TY1_P   TURN_TY1_P2   ? SER A 37  ? SER A 37  ? SER A 37  SER A 37  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>589
>ATOM   213  N N   . MET A 1 27  ? 23.932 26.556 7.052  1.00 19.00 ? 27  MET A N   1 
>BEND         BEND2         ? LYS A 38  ? LYS A 38  ? LYS A 38  LYS A 38  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>590
>ATOM   214  C CA  . MET A 1 27  ? 24.948 27.433 7.628  1.00 19.54 ? 27  MET A CA  1 
>OTHER        OTHER3        ? PRO A 39  ? PRO A 39  ? PRO A 39  PRO A 39  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>591
>ATOM   215  C C   . MET A 1 27  ? 24.734 27.741 9.099  1.00 19.04 ? 27  MET A C   1 
>STRN         STRN2         ? ALA A 40  ? GLU A 46  ? ALA A 40  GLU A 46  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>592
>ATOM   216  O O   . MET A 1 27  ? 25.702 27.820 9.849  1.00 18.28 ? 27  MET A O   1 
>TURN_TY1_P   TURN_TY1_P3   ? GLY A 47  ? ASP A 48  ? GLY A 47  ASP A 48  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>593
>ATOM   217  C CB  . MET A 1 27  ? 25.104 28.736 6.830  1.00 23.31 ? 27  MET A CB  1 
>STRN         STRN3         ? THR A 49  ? SER A 55  ? THR A 49  SER A 55  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>594
>ATOM   218  C CG  . MET A 1 27  ? 25.955 28.602 5.552  1.00 29.99 ? 27  MET A CG  1 
>OTHER        OTHER4        ? THR A 56  ? THR A 56  ? THR A 56  THR A 56  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>595
>ATOM   219  S SD  . MET A 1 27  ? 24.975 28.527 4.010  1.00 37.48 ? 27  MET A SD  1 
>BEND         BEND3         ? THR A 57  ? VAL A 58  ? THR A 57  VAL A 58  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>596
>ATOM   220  C CE  . MET A 1 27  ? 26.198 29.150 2.776  1.00 35.24 ? 27  MET A CE  1 
>OTHER        OTHER5        ? ARG A 59  ? ARG A 59  ? ARG A 59  ARG A 59  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>597
>ATOM   221  N N   . LEU A 1 28  ? 23.480 27.932 9.507  1.00 16.74 ? 28  LEU A N   1 
>STRN         STRN4         ? THR A 60  ? LYS A 66  ? THR A 60  LYS A 66  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>598
>ATOM   222  C CA  . LEU A 1 28  ? 23.190 28.209 10.912 1.00 16.39 ? 28  LEU A CA  1 
>TURN_TY1_P   TURN_TY1_P4   ? VAL A 67  ? GLY A 68  ? VAL A 67  GLY A 68  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>599
>ATOM   223  C C   . LEU A 1 28  ? 23.477 26.954 11.722 1.00 16.86 ? 28  LEU A C   1 
>BEND         BEND4         ? GLU A 69  ? GLU A 69  ? GLU A 69  GLU A 69  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>600
>ATOM   224  O O   . LEU A 1 28  ? 23.954 27.038 12.852 1.00 15.09 ? 28  LEU A O   1 
>OTHER        OTHER6        ? GLU A 70  ? GLU A 70  ? GLU A 70  GLU A 70  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>601
>ATOM   225  C CB  . LEU A 1 28  ? 21.739 28.679 11.111 1.00 15.94 ? 28  LEU A CB  1 
>STRN         STRN5         ? PHE A 71  ? GLN A 74  ? PHE A 71  GLN A 74  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>602
>ATOM   226  C CG  . LEU A 1 28  ? 21.490 30.154 10.741 1.00 16.72 ? 28  LEU A CG  1 
>OTHER        OTHER7        ? THR A 75  ? THR A 75  ? THR A 75  THR A 75  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>603
>ATOM   227  C CD1 . LEU A 1 28  ? 20.008 30.496 10.780 1.00 14.38 ? 28  LEU A CD1 1 
>TURN_TY1_P   TURN_TY1_P5   ? VAL A 76  ? ASP A 77  ? VAL A 76  ASP A 77  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>604
>ATOM   228  C CD2 . LEU A 1 28  ? 22.302 31.074 11.665 1.00 12.81 ? 28  LEU A CD2 1 
>BEND         BEND5         ? GLY A 78  ? GLY A 78  ? GLY A 78  GLY A 78  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>605
>ATOM   229  N N   . ARG A 1 29  ? 23.228 25.791 11.121 1.00 16.05 ? 29  ARG A N   1 
>OTHER        OTHER8        ? ARG A 79  ? ARG A 79  ? ARG A 79  ARG A 79  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>606
>ATOM   230  C CA  . ARG A 1 29  ? 23.498 24.524 11.798 1.00 18.43 ? 29  ARG A CA  1 
>STRN         STRN6         ? PRO A 80  ? SER A 89  ? PRO A 80  SER A 89  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>607
>ATOM   231  C C   . ARG A 1 29  ? 24.980 24.377 12.076 1.00 19.22 ? 29  ARG A C   1 
>TURN_TY1_P   TURN_TY1_P6   ? GLU A 90  ? ASN A 91  ? GLU A 90  ASN A 91  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>608
>ATOM   232  O O   . ARG A 1 29  ? 25.383 23.987 13.171 1.00 17.97 ? 29  ARG A O   1 
>STRN         STRN7         ? LYS A 92  ? LEU A 99  ? LYS A 92  LEU A 99  ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>609
>ATOM   233  C CB  . ARG A 1 29  ? 23.030 23.334 10.969 1.00 18.63 ? 29  ARG A CB  1 
>BEND         BEND6         ? LEU A 100 ? GLY A 102 ? LEU A 100 GLY A 102 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>610
>ATOM   234  C CG  . ARG A 1 29  ? 21.596 22.983 11.189 1.00 21.26 ? 29  ARG A CG  1 
>OTHER        OTHER9        ? GLU A 103 ? LYS A 106 ? GLU A 103 LYS A 106 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>611
>ATOM   235  C CD  . ARG A 1 29  ? 21.339 21.572 10.739 1.00 24.71 ? 29  ARG A CD  1 
>STRN         STRN8         ? THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>612
>ATOM   236  N NE  . ARG A 1 29  ? 20.571 21.564 9.513  1.00 29.88 ? 29  ARG A NE  1 
>OTHER        OTHER10       ? THR A 114 ? THR A 114 ? THR A 114 THR A 114 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>613
>ATOM   237  C CZ  . ARG A 1 29  ? 21.019 21.147 8.340  1.00 29.19 ? 29  ARG A CZ  1 
>TURN_TY1_P   TURN_TY1_P7   ? ASN A 115 ? ASP A 116 ? ASN A 115 ASP A 116 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>614
>ATOM   238  N NH1 . ARG A 1 29  ? 22.248 20.682 8.205  1.00 30.52 ? 29  ARG A NH1 1 
>BEND         BEND7         ? GLY A 117 ? GLY A 117 ? GLY A 117 GLY A 117 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>615
>ATOM   239  N NH2 . ARG A 1 29  ? 20.232 21.233 7.295  1.00 31.61 ? 29  ARG A NH2 1 
>OTHER        OTHER11       ? GLU A 118 ? GLU A 118 ? GLU A 118 GLU A 118 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>616
>ATOM   240  N N   . LYS A 1 30  ? 25.790 24.709 11.078 1.00 19.76 ? 30  LYS A N   1 
>STRN         STRN9         ? LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>617
>ATOM   241  C CA  . LYS A 1 30  ? 27.235 24.619 11.198 1.00 21.96 ? 30  LYS A CA  1 
>TURN_TY1_P   TURN_TY1_P8   ? ASP A 126 ? ASP A 127 ? ASP A 126 ASP A 127 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>618
>ATOM   242  C C   . LYS A 1 30  ? 27.706 25.418 12.417 1.00 20.91 ? 30  LYS A C   1 
>STRN         STRN10        ? VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>619
>ATOM   243  O O   . LYS A 1 30  ? 28.470 24.916 13.239 1.00 22.15 ? 30  LYS A O   1 
>OTHER        OTHER12       ? GLU A 137 ? GLU A 137 ? GLU A 137 GLU A 137 ? ? ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>620
>ATOM   244  C CB  . LYS A 1 30  ? 27.894 25.143 9.915  1.00 25.07 ? 30  LYS A CB  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>621
>ATOM   245  C CG  . LYS A 1 30  ? 29.404 25.031 9.905  1.00 30.48 ? 30  LYS A CG  1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>622
>ATOM   246  C CD  . LYS A 1 30  ? 30.013 25.631 8.639  1.00 35.43 ? 30  LYS A CD  1 
>_struct_conf_type.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>623
>ATOM   247  C CE  . LYS A 1 30  ? 31.533 25.759 8.778  1.00 37.96 ? 30  LYS A CE  1 
>_struct_conf_type.criteria 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>624
>ATOM   248  N NZ  . LYS A 1 30  ? 32.180 26.388 7.584  1.00 41.61 ? 30  LYS A NZ  1 
>_struct_conf_type.reference 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>625
>ATOM   249  N N   . ILE A 1 31  ? 27.208 26.643 12.544 1.00 18.38 ? 31  ILE A N   1 
>OTHER        DSSP ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>626
>ATOM   250  C CA  . ILE A 1 31  ? 27.557 27.527 13.652 1.00 16.41 ? 31  ILE A CA  1 
>STRN         DSSP ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>627
>ATOM   251  C C   . ILE A 1 31  ? 27.105 26.932 14.989 1.00 15.39 ? 31  ILE A C   1 
>BEND         DSSP ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>628
>ATOM   252  O O   . ILE A 1 31  ? 27.888 26.855 15.930 1.00 14.90 ? 31  ILE A O   1 
>HELX_RH_AL_P DSSP ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>629
>ATOM   253  C CB  . ILE A 1 31  ? 26.881 28.920 13.471 1.00 16.63 ? 31  ILE A CB  1 
>TURN_TY1_P   DSSP ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>630
>ATOM   254  C CG1 . ILE A 1 31  ? 27.419 29.606 12.208 1.00 18.74 ? 31  ILE A CG1 1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>631
>ATOM   255  C CG2 . ILE A 1 31  ? 27.071 29.791 14.713 1.00 15.71 ? 31  ILE A CG2 1 
>_struct_sheet.id               A 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>632
>ATOM   256  C CD1 . ILE A 1 31  ? 26.735 30.946 11.858 1.00 17.27 ? 31  ILE A CD1 1 
>_struct_sheet.type             ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>633
>ATOM   257  N N   . ALA A 1 32  ? 25.853 26.487 15.048 1.00 13.39 ? 32  ALA A N   1 
>_struct_sheet.number_strands   10 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>634
>ATOM   258  C CA  . ALA A 1 32  ? 25.271 25.930 16.267 1.00 12.76 ? 32  ALA A CA  1 
>_struct_sheet.details          ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>635
>ATOM   259  C C   . ALA A 1 32  ? 25.994 24.685 16.775 1.00 12.11 ? 32  ALA A C   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>636
>ATOM   260  O O   . ALA A 1 32  ? 26.325 24.598 17.946 1.00 10.54 ? 32  ALA A O   1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>637
>ATOM   261  C CB  . ALA A 1 32  ? 23.790 25.638 16.040 1.00 12.45 ? 32  ALA A CB  1 
>_struct_sheet_order.sheet_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>638
>ATOM   262  N N   . VAL A 1 33  ? 26.252 23.731 15.886 1.00 11.95 ? 33  VAL A N   1 
>_struct_sheet_order.range_id_1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>639
>ATOM   263  C CA  . VAL A 1 33  ? 26.932 22.490 16.256 1.00 13.80 ? 33  VAL A CA  1 
>_struct_sheet_order.range_id_2 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>640
>ATOM   264  C C   . VAL A 1 33  ? 28.328 22.701 16.855 1.00 14.00 ? 33  VAL A C   1 
>_struct_sheet_order.offset 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>641
>ATOM   265  O O   . VAL A 1 33  ? 28.693 22.048 17.832 1.00 14.07 ? 33  VAL A O   1 
>_struct_sheet_order.sense 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>642
>ATOM   266  C CB  . VAL A 1 33  ? 27.016 21.504 15.044 1.00 13.56 ? 33  VAL A CB  1 
>A 1 2  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>643
>ATOM   267  C CG1 . VAL A 1 33  ? 27.909 20.318 15.375 1.00 16.07 ? 33  VAL A CG1 1 
>A 2 3  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>644
>ATOM   268  C CG2 . VAL A 1 33  ? 25.621 21.006 14.684 1.00 14.96 ? 33  VAL A CG2 1 
>A 3 4  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>645
>ATOM   269  N N   . ALA A 1 34  ? 29.101 23.620 16.281 1.00 14.73 ? 34  ALA A N   1 
>A 4 5  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>646
>ATOM   270  C CA  . ALA A 1 34  ? 30.443 23.898 16.780 1.00 14.95 ? 34  ALA A CA  1 
>A 5 6  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>647
>ATOM   271  C C   . ALA A 1 34  ? 30.381 24.505 18.178 1.00 15.59 ? 34  ALA A C   1 
>A 6 7  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>648
>ATOM   272  O O   . ALA A 1 34  ? 31.120 24.085 19.065 1.00 16.65 ? 34  ALA A O   1 
>A 7 8  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>649
>ATOM   273  C CB  . ALA A 1 34  ? 31.191 24.844 15.833 1.00 16.10 ? 34  ALA A CB  1 
>A 8 9  ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>650
>ATOM   274  N N   . ALA A 1 35  ? 29.495 25.480 18.375 1.00 13.20 ? 35  ALA A N   1 
>A 9 10 ? anti-parallel 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>651
>ATOM   275  C CA  . ALA A 1 35  ? 29.371 26.134 19.671 1.00 13.04 ? 35  ALA A CA  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>652
>ATOM   276  C C   . ALA A 1 35  ? 28.807 25.200 20.749 1.00 12.91 ? 35  ALA A C   1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>653
>ATOM   277  O O   . ALA A 1 35  ? 29.245 25.239 21.895 1.00 12.32 ? 35  ALA A O   1 
>_struct_sheet_range.sheet_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>654
>ATOM   278  C CB  . ALA A 1 35  ? 28.517 27.387 19.552 1.00 12.14 ? 35  ALA A CB  1 
>_struct_sheet_range.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>655
>ATOM   279  N N   . ALA A 1 36  ? 27.878 24.332 20.362 1.00 11.40 ? 36  ALA A N   1 
>_struct_sheet_range.beg_label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>656
>ATOM   280  C CA  . ALA A 1 36  ? 27.253 23.416 21.312 1.00 12.63 ? 36  ALA A CA  1 
>_struct_sheet_range.beg_label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>657
>ATOM   281  C C   . ALA A 1 36  ? 28.128 22.256 21.770 1.00 13.40 ? 36  ALA A C   1 
>_struct_sheet_range.beg_label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>658
>ATOM   282  O O   . ALA A 1 36  ? 27.743 21.512 22.668 1.00 13.47 ? 36  ALA A O   1 
>_struct_sheet_range.pdbx_beg_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>659
>ATOM   283  C CB  . ALA A 1 36  ? 25.952 22.883 20.744 1.00 11.79 ? 36  ALA A CB  1 
>_struct_sheet_range.end_label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>660
>ATOM   284  N N   . SER A 1 37  ? 29.286 22.080 21.148 1.00 13.86 ? 37  SER A N   1 
>_struct_sheet_range.end_label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>661
>ATOM   285  C CA  . SER A 1 37  ? 30.169 20.983 21.520 1.00 15.95 ? 37  SER A CA  1 
>_struct_sheet_range.end_label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>662
>ATOM   286  C C   . SER A 1 37  ? 30.938 21.245 22.818 1.00 16.46 ? 37  SER A C   1 
>_struct_sheet_range.pdbx_end_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>663
>ATOM   287  O O   . SER A 1 37  ? 31.488 20.320 23.406 1.00 18.23 ? 37  SER A O   1 
>_struct_sheet_range.beg_auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>664
>ATOM   288  C CB  . SER A 1 37  ? 31.145 20.689 20.388 1.00 16.93 ? 37  SER A CB  1 
>_struct_sheet_range.beg_auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>665
>ATOM   289  O OG  . SER A 1 37  ? 32.100 21.729 20.293 1.00 21.65 ? 37  SER A OG  1 
>_struct_sheet_range.beg_auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>666
>ATOM   290  N N   . LYS A 1 38  ? 30.957 22.496 23.272 1.00 16.91 ? 38  LYS A N   1 
>_struct_sheet_range.end_auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>667
>ATOM   291  C CA  . LYS A 1 38  ? 31.657 22.869 24.502 1.00 18.36 ? 38  LYS A CA  1 
>_struct_sheet_range.end_auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>668
>ATOM   292  C C   . LYS A 1 38  ? 30.817 23.809 25.382 1.00 15.90 ? 38  LYS A C   1 
>_struct_sheet_range.end_auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>669
>ATOM   293  O O   . LYS A 1 38  ? 31.175 24.975 25.591 1.00 16.72 ? 38  LYS A O   1 
>A 1  THR A 60  ? LYS A 66  ? THR A 60  LYS A 66  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>670
>ATOM   294  C CB  . LYS A 1 38  ? 33.004 23.539 24.156 1.00 23.99 ? 38  LYS A CB  1 
>A 2  THR A 49  ? SER A 55  ? THR A 49  SER A 55  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>671
>ATOM   295  C CG  . LYS A 1 38  ? 32.907 24.607 23.046 1.00 30.97 ? 38  LYS A CG  1 
>A 3  ALA A 40  ? GLU A 46  ? ALA A 40  GLU A 46  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>672
>ATOM   296  C CD  . LYS A 1 38  ? 34.250 25.320 22.792 1.00 36.44 ? 38  LYS A CD  1 
>A 4  GLY A 5   ? GLU A 13  ? GLY A 5   GLU A 13  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>673
>ATOM   297  C CE  . LYS A 1 38  ? 34.266 26.098 21.456 1.00 38.70 ? 38  LYS A CE  1 
>A 5  VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>674
>ATOM   298  N NZ  . LYS A 1 38  ? 33.193 27.131 21.321 1.00 39.37 ? 38  LYS A NZ  1 
>A 6  LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>675
>ATOM   299  N N   . PRO A 1 39  ? 29.669 23.321 25.906 1.00 13.53 ? 39  PRO A N   1 
>A 7  THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>676
>ATOM   300  C CA  . PRO A 1 39  ? 28.851 24.201 26.747 1.00 11.87 ? 39  PRO A CA  1 
>A 8  LYS A 92  ? LEU A 99  ? LYS A 92  LEU A 99  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>677
>ATOM   301  C C   . PRO A 1 39  ? 29.292 24.248 28.211 1.00 12.05 ? 39  PRO A C   1 
>A 9  PRO A 80  ? SER A 89  ? PRO A 80  SER A 89  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>678
>ATOM   302  O O   . PRO A 1 39  ? 30.027 23.380 28.676 1.00 12.12 ? 39  PRO A O   1 
>A 10 PHE A 71  ? GLN A 74  ? PHE A 71  GLN A 74  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>679
>ATOM   303  C CB  . PRO A 1 39  ? 27.469 23.560 26.649 1.00 9.34  ? 39  PRO A CB  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>680
>ATOM   304  C CG  . PRO A 1 39  ? 27.779 22.131 26.593 1.00 10.32 ? 39  PRO A CG  1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>681
>ATOM   305  C CD  . PRO A 1 39  ? 29.009 22.020 25.703 1.00 10.86 ? 39  PRO A CD  1 
>_pdbx_struct_sheet_hbond.sheet_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>682
>ATOM   306  N N   . ALA A 1 40  ? 28.921 25.316 28.898 1.00 11.52 ? 40  ALA A N   1 
>_pdbx_struct_sheet_hbond.range_id_1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>683
>ATOM   307  C CA  . ALA A 1 40  ? 29.192 25.423 30.329 1.00 11.84 ? 40  ALA A CA  1 
>_pdbx_struct_sheet_hbond.range_id_2 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>684
>ATOM   308  C C   . ALA A 1 40  ? 27.773 25.329 30.894 1.00 10.23 ? 40  ALA A C   1 
>_pdbx_struct_sheet_hbond.range_1_label_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>685
>ATOM   309  O O   . ALA A 1 40  ? 26.894 26.080 30.478 1.00 10.42 ? 40  ALA A O   1 
>_pdbx_struct_sheet_hbond.range_1_label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>686
>ATOM   310  C CB  . ALA A 1 40  ? 29.830 26.767 30.673 1.00 11.40 ? 40  ALA A CB  1 
>_pdbx_struct_sheet_hbond.range_1_label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>687
>ATOM   311  N N   . VAL A 1 41  ? 27.518 24.345 31.750 1.00 10.73 ? 41  VAL A N   1 
>_pdbx_struct_sheet_hbond.range_1_label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>688
>ATOM   312  C CA  . VAL A 1 41  ? 26.185 24.169 32.333 1.00 9.92  ? 41  VAL A CA  1 
>_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>689
>ATOM   313  C C   . VAL A 1 41  ? 26.226 24.295 33.854 1.00 11.64 ? 41  VAL A C   1 
>_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>690
>ATOM   314  O O   . VAL A 1 41  ? 27.026 23.627 34.514 1.00 11.40 ? 41  VAL A O   1 
>_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>691
>ATOM   315  C CB  . VAL A 1 41  ? 25.594 22.772 31.987 1.00 10.67 ? 41  VAL A CB  1 
>_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>692
>ATOM   316  C CG1 . VAL A 1 41  ? 24.204 22.596 32.612 1.00 11.34 ? 41  VAL A CG1 1 
>_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>693
>ATOM   317  C CG2 . VAL A 1 41  ? 25.507 22.583 30.475 1.00 11.31 ? 41  VAL A CG2 1 
>_pdbx_struct_sheet_hbond.range_2_label_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>694
>ATOM   318  N N   . GLU A 1 42  ? 25.364 25.147 34.399 1.00 10.94 ? 42  GLU A N   1 
>_pdbx_struct_sheet_hbond.range_2_label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>695
>ATOM   319  C CA  . GLU A 1 42  ? 25.271 25.327 35.845 1.00 12.40 ? 42  GLU A CA  1 
>_pdbx_struct_sheet_hbond.range_2_label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>696
>ATOM   320  C C   . GLU A 1 42  ? 23.837 25.095 36.316 1.00 11.42 ? 42  GLU A C   1 
>_pdbx_struct_sheet_hbond.range_2_label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>697
>ATOM   321  O O   . GLU A 1 42  ? 22.898 25.720 35.825 1.00 10.46 ? 42  GLU A O   1 
>_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>698
>ATOM   322  C CB  . GLU A 1 42  ? 25.711 26.721 36.270 1.00 16.26 ? 42  GLU A CB  1 
>_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>699
>ATOM   323  C CG  . GLU A 1 42  ? 25.495 26.947 37.768 1.00 23.78 ? 42  GLU A CG  1 
>_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>700
>ATOM   324  C CD  . GLU A 1 42  ? 25.944 28.311 38.242 1.00 27.94 ? 42  GLU A CD  1 
>_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>701
>ATOM   325  O OE1 . GLU A 1 42  ? 25.308 29.329 37.872 1.00 29.92 ? 42  GLU A OE1 1 
>_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>702
>ATOM   326  O OE2 . GLU A 1 42  ? 26.935 28.351 39.002 1.00 32.64 ? 42  GLU A OE2 1 
>A 1 2  O PHE A 65  ? O PHE A 65  N PHE A 50  ? N PHE A 50  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>703
>ATOM   327  N N   . ILE A 1 43  ? 23.673 24.176 37.261 1.00 10.55 ? 43  ILE A N   1 
>A 2 3  N SER A 55  ? N SER A 55  O ALA A 40  ? O ALA A 40  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>704
>ATOM   328  C CA  . ILE A 1 43  ? 22.362 23.864 37.794 1.00 10.69 ? 43  ILE A CA  1 
>A 3 4  N ILE A 43  ? N ILE A 43  O GLY A 5   ? O GLY A 5   
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>705
>ATOM   329  C C   . ILE A 1 43  ? 22.360 24.120 39.300 1.00 11.07 ? 43  ILE A C   1 
>A 4 5  N GLU A 13  ? N GLU A 13  O THR A 131 ? O THR A 131 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>706
>ATOM   330  O O   . ILE A 1 43  ? 23.307 23.764 39.992 1.00 10.83 ? 43  ILE A O   1 
>A 5 6  N TYR A 134 ? N TYR A 134 O LEU A 119 ? O LEU A 119 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>707
>ATOM   331  C CB  . ILE A 1 43  ? 21.996 22.374 37.552 1.00 10.47 ? 43  ILE A CB  1 
>A 6 7  N THR A 124 ? N THR A 124 O SER A 108 ? O SER A 108 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>708
>ATOM   332  C CG1 . ILE A 1 43  ? 21.974 22.072 36.056 1.00 10.46 ? 43  ILE A CG1 1 
>A 7 8  O ARG A 111 ? O ARG A 111 N MET A 93  ? N MET A 93  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>709
>ATOM   333  C CG2 . ILE A 1 43  ? 20.636 22.031 38.186 1.00 10.34 ? 43  ILE A CG2 1 
>A 8 9  O LYS A 98  ? O LYS A 98  N LYS A 82  ? N LYS A 82  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>710
>ATOM   334  C CD1 . ILE A 1 43  ? 21.607 20.639 35.726 1.00 9.00  ? 43  ILE A CD1 1 
>A 9 10 N SER A 83  ? N SER A 83  O PHE A 71  ? O PHE A 71  
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>711
>ATOM   335  N N   . LYS A 1 44  ? 21.315 24.784 39.778 1.00 12.26 ? 44  LYS A N   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>712
>ATOM   336  C CA  . LYS A 1 44  ? 21.127 25.051 41.201 1.00 13.96 ? 44  LYS A CA  1 
>_struct_site.id                   AC1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>713
>ATOM   337  C C   . LYS A 1 44  ? 19.729 24.528 41.516 1.00 14.16 ? 44  LYS A C   1 
>_struct_site.pdbx_evidence_code   Software 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>714
>ATOM   338  O O   . LYS A 1 44  ? 18.749 24.920 40.873 1.00 14.12 ? 44  LYS A O   1 
>_struct_site.pdbx_auth_asym_id    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>715
>ATOM   339  C CB  . LYS A 1 44  ? 21.220 26.545 41.503 1.00 16.58 ? 44  LYS A CB  1 
>_struct_site.pdbx_auth_comp_id    ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>716
>ATOM   340  C CG  . LYS A 1 44  ? 22.580 27.150 41.170 1.00 22.90 ? 44  LYS A CG  1 
>_struct_site.pdbx_auth_seq_id     ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>717
>ATOM   341  C CD  . LYS A 1 44  ? 22.571 28.654 41.385 1.00 29.01 ? 44  LYS A CD  1 
>_struct_site.pdbx_auth_ins_code   ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>718
>ATOM   342  C CE  . LYS A 1 44  ? 23.890 29.293 40.982 1.00 31.56 ? 44  LYS A CE  1 
>_struct_site.pdbx_num_residues    10 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>719
>ATOM   343  N NZ  . LYS A 1 44  ? 23.818 30.781 41.111 1.00 34.70 ? 44  LYS A NZ  1 
>_struct_site.details              'BINDING SITE FOR RESIDUE REA A 200' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>720
>ATOM   344  N N   . GLN A 1 45  ? 19.649 23.594 42.460 1.00 15.66 ? 45  GLN A N   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>721
>ATOM   345  C CA  . GLN A 1 45  ? 18.377 22.993 42.852 1.00 16.03 ? 45  GLN A CA  1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>722
>ATOM   346  C C   . GLN A 1 45  ? 18.098 23.182 44.342 1.00 17.60 ? 45  GLN A C   1 
>_struct_site_gen.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>723
>ATOM   347  O O   . GLN A 1 45  ? 18.989 23.024 45.164 1.00 17.17 ? 45  GLN A O   1 
>_struct_site_gen.site_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>724
>ATOM   348  C CB  . GLN A 1 45  ? 18.397 21.498 42.544 1.00 15.51 ? 45  GLN A CB  1 
>_struct_site_gen.pdbx_num_res 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>725
>ATOM   349  C CG  . GLN A 1 45  ? 17.168 20.744 43.015 1.00 13.62 ? 45  GLN A CG  1 
>_struct_site_gen.label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>726
>ATOM   350  C CD  . GLN A 1 45  ? 17.312 19.256 42.838 1.00 15.68 ? 45  GLN A CD  1 
>_struct_site_gen.label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>727
>ATOM   351  O OE1 . GLN A 1 45  ? 18.348 18.769 42.397 1.00 18.84 ? 45  GLN A OE1 1 
>_struct_site_gen.label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>728
>ATOM   352  N NE2 . GLN A 1 45  ? 16.276 18.521 43.177 1.00 16.73 ? 45  GLN A NE2 1 
>_struct_site_gen.pdbx_auth_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>729
>ATOM   353  N N   . GLU A 1 46  ? 16.868 23.551 44.670 1.00 18.48 ? 46  GLU A N   1 
>_struct_site_gen.auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>730
>ATOM   354  C CA  . GLU A 1 46  ? 16.441 23.718 46.062 1.00 21.26 ? 46  GLU A CA  1 
>_struct_site_gen.auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>731
>ATOM   355  C C   . GLU A 1 46  ? 15.108 23.004 46.105 1.00 19.06 ? 46  GLU A C   1 
>_struct_site_gen.auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>732
>ATOM   356  O O   . GLU A 1 46  ? 14.080 23.589 45.784 1.00 20.08 ? 46  GLU A O   1 
>_struct_site_gen.label_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>733
>ATOM   357  C CB  . GLU A 1 46  ? 16.239 25.194 46.408 1.00 26.45 ? 46  GLU A CB  1 
>_struct_site_gen.label_alt_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>734
>ATOM   358  C CG  . GLU A 1 46  ? 17.284 25.787 47.361 1.00 37.46 ? 46  GLU A CG  1 
>_struct_site_gen.symmetry 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>735
>ATOM   359  C CD  . GLU A 1 46  ? 17.093 25.374 48.832 1.00 42.24 ? 46  GLU A CD  1 
>_struct_site_gen.details 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>736
>ATOM   360  O OE1 . GLU A 1 46  ? 16.192 25.944 49.501 1.00 44.05 ? 46  GLU A OE1 1 
>1  AC1 10 GLU A 13  ? GLU A 13  . ? 3_655 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>737
>ATOM   361  O OE2 . GLU A 1 46  ? 17.867 24.507 49.320 1.00 44.14 ? 46  GLU A OE2 1 
>2  AC1 10 ALA A 32  ? ALA A 32  . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>738
>ATOM   362  N N   . GLY A 1 47  ? 15.131 21.720 46.429 1.00 18.35 ? 47  GLY A N   1 
>3  AC1 10 THR A 54  ? THR A 54  . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>739
>ATOM   363  C CA  . GLY A 1 47  ? 13.893 20.970 46.463 1.00 18.96 ? 47  GLY A CA  1 
>4  AC1 10 VAL A 58  ? VAL A 58  . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>740
>ATOM   364  C C   . GLY A 1 47  ? 13.382 20.755 45.053 1.00 18.27 ? 47  GLY A C   1 
>5  AC1 10 VAL A 76  ? VAL A 76  . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>741
>ATOM   365  O O   . GLY A 1 47  ? 14.067 20.157 44.238 1.00 18.05 ? 47  GLY A O   1 
>6  AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>742
>ATOM   366  N N   . ASP A 1 48  ? 12.194 21.262 44.755 1.00 16.66 ? 48  ASP A N   1 
>7  AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>743
>ATOM   367  C CA  . ASP A 1 48  ? 11.617 21.107 43.420 1.00 16.86 ? 48  ASP A CA  1 
>8  AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>744
>ATOM   368  C C   . ASP A 1 48  ? 11.771 22.378 42.566 1.00 15.92 ? 48  ASP A C   1 
>9  AC1 10 HOH C .   ? HOH A 309 . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>745
>ATOM   369  O O   . ASP A 1 48  ? 11.139 22.511 41.504 1.00 14.50 ? 48  ASP A O   1 
>10 AC1 10 HOH C .   ? HOH A 343 . ? 1_555 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>746
>ATOM   370  C CB  . ASP A 1 48  ? 10.136 20.694 43.513 1.00 19.00 ? 48  ASP A CB  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>747
>ATOM   371  C CG  . ASP A 1 48  ? 9.943  19.221 43.897 1.00 21.49 ? 48  ASP A CG  1 
>_database_PDB_matrix.entry_id          1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>748
>ATOM   372  O OD1 . ASP A 1 48  ? 10.901 18.406 43.840 1.00 23.51 ? 48  ASP A OD1 1 
>_database_PDB_matrix.origx[1][1]       1.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>749
>ATOM   373  O OD2 . ASP A 1 48  ? 8.802  18.868 44.243 1.00 25.04 ? 48  ASP A OD2 1 
>_database_PDB_matrix.origx[1][2]       0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>750
>ATOM   374  N N   . THR A 1 49  ? 12.610 23.299 43.042 1.00 13.75 ? 49  THR A N   1 
>_database_PDB_matrix.origx[1][3]       0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>751
>ATOM   375  C CA  . THR A 1 49  ? 12.870 24.551 42.348 1.00 13.82 ? 49  THR A CA  1 
>_database_PDB_matrix.origx[2][1]       0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>752
>ATOM   376  C C   . THR A 1 49  ? 14.231 24.460 41.678 1.00 13.22 ? 49  THR A C   1 
>_database_PDB_matrix.origx[2][2]       1.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>753
>ATOM   377  O O   . THR A 1 49  ? 15.235 24.152 42.322 1.00 12.56 ? 49  THR A O   1 
>_database_PDB_matrix.origx[2][3]       0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>754
>ATOM   378  C CB  . THR A 1 49  ? 12.847 25.741 43.316 1.00 16.10 ? 49  THR A CB  1 
>_database_PDB_matrix.origx[3][1]       0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>755
>ATOM   379  O OG1 . THR A 1 49  ? 11.556 25.815 43.941 1.00 17.94 ? 49  THR A OG1 1 
>_database_PDB_matrix.origx[3][2]       0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>756
>ATOM   380  C CG2 . THR A 1 49  ? 13.100 27.037 42.571 1.00 16.15 ? 49  THR A CG2 1 
>_database_PDB_matrix.origx[3][3]       1.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>757
>ATOM   381  N N   . PHE A 1 50  ? 14.266 24.794 40.392 1.00 12.20 ? 50  PHE A N   1 
>_database_PDB_matrix.origx_vector[1]   0.00000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>758
>ATOM   382  C CA  . PHE A 1 50  ? 15.485 24.704 39.602 1.00 10.82 ? 50  PHE A CA  1 
>_database_PDB_matrix.origx_vector[2]   0.00000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>759
>ATOM   383  C C   . PHE A 1 50  ? 15.842 25.979 38.855 1.00 10.40 ? 50  PHE A C   1 
>_database_PDB_matrix.origx_vector[3]   0.00000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>760
>ATOM   384  O O   . PHE A 1 50  ? 14.968 26.758 38.460 1.00 9.90  ? 50  PHE A O   1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>761
>ATOM   385  C CB  . PHE A 1 50  ? 15.338 23.591 38.547 1.00 10.78 ? 50  PHE A CB  1 
>_atom_sites.entry_id                    1CBS 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>762
>ATOM   386  C CG  . PHE A 1 50  ? 15.316 22.192 39.107 1.00 13.13 ? 50  PHE A CG  1 
>_atom_sites.fract_transf_matrix[1][1]   0.021906 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>763
>ATOM   387  C CD1 . PHE A 1 50  ? 14.146 21.653 39.634 1.00 11.97 ? 50  PHE A CD1 1 
>_atom_sites.fract_transf_matrix[1][2]   0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>764
>ATOM   388  C CD2 . PHE A 1 50  ? 16.464 21.401 39.079 1.00 14.34 ? 50  PHE A CD2 1 
>_atom_sites.fract_transf_matrix[1][3]   0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>765
>ATOM   389  C CE1 . PHE A 1 50  ? 14.113 20.367 40.120 1.00 12.69 ? 50  PHE A CE1 1 
>_atom_sites.fract_transf_matrix[2][1]   0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>766
>ATOM   390  C CE2 . PHE A 1 50  ? 16.439 20.098 39.569 1.00 14.64 ? 50  PHE A CE2 1 
>_atom_sites.fract_transf_matrix[2][2]   0.021026 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>767
>ATOM   391  C CZ  . PHE A 1 50  ? 15.258 19.582 40.092 1.00 13.15 ? 50  PHE A CZ  1 
>_atom_sites.fract_transf_matrix[2][3]   0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>768
>ATOM   392  N N   . TYR A 1 51  ? 17.147 26.165 38.678 1.00 10.37 ? 51  TYR A N   1 
>_atom_sites.fract_transf_matrix[3][1]   0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>769
>ATOM   393  C CA  . TYR A 1 51  ? 17.709 27.258 37.910 1.00 10.95 ? 51  TYR A CA  1 
>_atom_sites.fract_transf_matrix[3][2]   0.000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>770
>ATOM   394  C C   . TYR A 1 51  ? 18.714 26.513 37.039 1.00 9.84  ? 51  TYR A C   1 
>_atom_sites.fract_transf_matrix[3][3]   0.012885 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>771
>ATOM   395  O O   . TYR A 1 51  ? 19.540 25.761 37.547 1.00 9.78  ? 51  TYR A O   1 
>_atom_sites.fract_transf_vector[1]      0.00000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>772
>ATOM   396  C CB  . TYR A 1 51  ? 18.436 28.284 38.790 1.00 12.57 ? 51  TYR A CB  1 
>_atom_sites.fract_transf_vector[2]      0.00000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>773
>ATOM   397  C CG  . TYR A 1 51  ? 19.396 29.178 38.014 1.00 12.91 ? 51  TYR A CG  1 
>_atom_sites.fract_transf_vector[3]      0.00000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>774
>ATOM   398  C CD1 . TYR A 1 51  ? 18.939 30.302 37.327 1.00 15.83 ? 51  TYR A CD1 1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>775
>ATOM   399  C CD2 . TYR A 1 51  ? 20.762 28.896 37.974 1.00 14.05 ? 51  TYR A CD2 1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>776
>ATOM   400  C CE1 . TYR A 1 51  ? 19.822 31.126 36.621 1.00 16.52 ? 51  TYR A CE1 1 
>_atom_type.symbol 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>777
>ATOM   401  C CE2 . TYR A 1 51  ? 21.655 29.705 37.275 1.00 14.62 ? 51  TYR A CE2 1 
>C 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>778
>ATOM   402  C CZ  . TYR A 1 51  ? 21.179 30.818 36.604 1.00 16.59 ? 51  TYR A CZ  1 
>N 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>779
>ATOM   403  O OH  . TYR A 1 51  ? 22.060 31.633 35.932 1.00 17.52 ? 51  TYR A OH  1 
>O 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>780
>ATOM   404  N N   . ILE A 1 52  ? 18.610 26.676 35.726 1.00 10.57 ? 52  ILE A N   1 
>S 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>781
>ATOM   405  C CA  . ILE A 1 52  ? 19.520 26.004 34.801 1.00 9.09  ? 52  ILE A CA  1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>782
>ATOM   406  C C   . ILE A 1 52  ? 20.066 27.020 33.801 1.00 8.55  ? 52  ILE A C   1 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>783
>ATOM   407  O O   . ILE A 1 52  ? 19.296 27.652 33.086 1.00 10.49 ? 52  ILE A O   1 
>_atom_site.group_PDB 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>784
>ATOM   408  C CB  . ILE A 1 52  ? 18.807 24.859 34.026 1.00 8.96  ? 52  ILE A CB  1 
>_atom_site.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>785
>ATOM   409  C CG1 . ILE A 1 52  ? 18.242 23.814 35.013 1.00 9.15  ? 52  ILE A CG1 1 
>_atom_site.type_symbol 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>786
>ATOM   410  C CG2 . ILE A 1 52  ? 19.792 24.189 33.070 1.00 10.39 ? 52  ILE A CG2 1 
>_atom_site.label_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>787
>ATOM   411  C CD1 . ILE A 1 52  ? 17.585 22.616 34.366 1.00 8.10  ? 52  ILE A CD1 1 
>_atom_site.label_alt_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>788
>ATOM   412  N N   . LYS A 1 53  ? 21.388 27.197 33.791 1.00 8.61  ? 53  LYS A N   1 
>_atom_site.label_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>789
>ATOM   413  C CA  . LYS A 1 53  ? 22.049 28.115 32.868 1.00 9.66  ? 53  LYS A CA  1 
>_atom_site.label_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>790
>ATOM   414  C C   . LYS A 1 53  ? 22.939 27.319 31.924 1.00 8.71  ? 53  LYS A C   1 
>_atom_site.label_entity_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>791
>ATOM   415  O O   . LYS A 1 53  ? 23.815 26.583 32.362 1.00 7.58  ? 53  LYS A O   1 
>_atom_site.label_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>792
>ATOM   416  C CB  . LYS A 1 53  ? 22.909 29.120 33.611 1.00 10.60 ? 53  LYS A CB  1 
>_atom_site.pdbx_PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>793
>ATOM   417  C CG  . LYS A 1 53  ? 23.580 30.135 32.688 1.00 14.21 ? 53  LYS A CG  1 
>_atom_site.Cartn_x 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>794
>ATOM   418  C CD  . LYS A 1 53  ? 24.496 31.006 33.505 1.00 20.27 ? 53  LYS A CD  1 
>_atom_site.Cartn_y 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>795
>ATOM   419  C CE  . LYS A 1 53  ? 24.831 32.319 32.828 1.00 26.91 ? 53  LYS A CE  1 
>_atom_site.Cartn_z 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>796
>ATOM   420  N NZ  . LYS A 1 53  ? 25.878 33.009 33.659 1.00 29.12 ? 53  LYS A NZ  1 
>_atom_site.occupancy 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>797
>ATOM   421  N N   . THR A 1 54  ? 22.686 27.445 30.625 1.00 8.49  ? 54  THR A N   1 
>_atom_site.B_iso_or_equiv 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>798
>ATOM   422  C CA  . THR A 1 54  ? 23.478 26.747 29.628 1.00 7.98  ? 54  THR A CA  1 
>_atom_site.pdbx_formal_charge 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>799
>ATOM   423  C C   . THR A 1 54  ? 24.118 27.820 28.764 1.00 8.23  ? 54  THR A C   1 
>_atom_site.auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>800
>ATOM   424  O O   . THR A 1 54  ? 23.433 28.584 28.087 1.00 8.40  ? 54  THR A O   1 
>_atom_site.auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>801
>ATOM   425  C CB  . THR A 1 54  ? 22.621 25.817 28.789 1.00 8.33  ? 54  THR A CB  1 
>_atom_site.auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>802
>ATOM   426  O OG1 . THR A 1 54  ? 21.896 24.946 29.660 1.00 9.95  ? 54  THR A OG1 1 
>_atom_site.auth_atom_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>803
>ATOM   427  C CG2 . THR A 1 54  ? 23.505 24.976 27.873 1.00 4.95  ? 54  THR A CG2 1 
>_atom_site.pdbx_PDB_model_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>804
>ATOM   428  N N   . SER A 1 55  ? 25.444 27.840 28.758 1.00 8.75  ? 55  SER A N   1 
>ATOM   1    N N   . PRO A 1 1   ? 16.979 13.301 44.555 1.00 30.05 ? 1   PRO A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>805
>ATOM   429  C CA  . SER A 1 55  ? 26.171 28.865 28.047 1.00 10.50 ? 55  SER A CA  1 
>ATOM   2    C CA  . PRO A 1 1   ? 18.150 13.525 43.680 1.00 28.82 ? 1   PRO A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>806
>ATOM   430  C C   . SER A 1 55  ? 27.116 28.382 26.950 1.00 9.24  ? 55  SER A C   1 
>ATOM   3    C C   . PRO A 1 1   ? 18.656 14.966 43.784 1.00 26.59 ? 1   PRO A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>807
>ATOM   431  O O   . SER A 1 55  ? 27.802 27.370 27.101 1.00 8.98  ? 55  SER A O   1 
>ATOM   4    O O   . PRO A 1 1   ? 17.890 15.889 44.078 1.00 26.84 ? 1   PRO A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>808
>ATOM   432  C CB  . SER A 1 55  ? 26.934 29.694 29.082 1.00 13.09 ? 55  SER A CB  1 
>ATOM   5    C CB  . PRO A 1 1   ? 17.678 13.270 42.255 1.00 29.24 ? 1   PRO A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>809
>ATOM   433  O OG  . SER A 1 55  ? 27.781 30.646 28.473 1.00 23.11 ? 55  SER A OG  1 
>ATOM   6    C CG  . PRO A 1 1   ? 16.248 13.734 42.347 1.00 29.29 ? 1   PRO A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>810
>ATOM   434  N N   . THR A 1 56  ? 27.091 29.094 25.825 1.00 8.86  ? 56  THR A N   1 
>ATOM   7    C CD  . PRO A 1 1   ? 15.762 13.216 43.724 1.00 30.71 ? 1   PRO A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>811
>ATOM   435  C CA  . THR A 1 56  ? 27.978 28.831 24.684 1.00 8.05  ? 56  THR A CA  1 
>ATOM   8    N N   . ASN A 1 2   ? 19.957 15.139 43.558 1.00 24.04 ? 2   ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>812
>ATOM   436  C C   . THR A 1 56  ? 28.393 30.215 24.138 1.00 8.09  ? 56  THR A C   1 
>ATOM   9    C CA  . ASN A 1 2   ? 20.576 16.457 43.578 1.00 20.79 ? 2   ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>813
>ATOM   437  O O   . THR A 1 56  ? 27.834 31.237 24.525 1.00 7.17  ? 56  THR A O   1 
>ATOM   10   C C   . ASN A 1 2   ? 21.301 16.714 42.262 1.00 16.75 ? 2   ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>814
>ATOM   438  C CB  . THR A 1 56  ? 27.296 28.024 23.534 1.00 6.70  ? 56  THR A CB  1 
>ATOM   11   O O   . ASN A 1 2   ? 22.402 16.215 42.028 1.00 15.23 ? 2   ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>815
>ATOM   439  O OG1 . THR A 1 56  ? 26.294 28.829 22.909 1.00 9.76  ? 56  THR A OG1 1 
>ATOM   12   C CB  . ASN A 1 2   ? 21.559 16.620 44.724 1.00 22.81 ? 2   ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>816
>ATOM   440  C CG2 . THR A 1 56  ? 26.653 26.751 24.049 1.00 7.76  ? 56  THR A CG2 1 
>ATOM   13   C CG  . ASN A 1 2   ? 22.240 17.968 44.685 1.00 24.29 ? 2   ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>817
>ATOM   441  N N   . THR A 1 57  ? 29.381 30.242 23.249 1.00 9.17  ? 57  THR A N   1 
>ATOM   14   O OD1 . ASN A 1 2   ? 21.612 18.984 44.358 1.00 21.87 ? 2   ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>818
>ATOM   442  C CA  . THR A 1 57  ? 29.871 31.485 22.644 1.00 8.49  ? 57  THR A CA  1 
>ATOM   15   N ND2 . ASN A 1 2   ? 23.537 17.983 44.966 1.00 27.94 ? 2   ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>819
>ATOM   443  C C   . THR A 1 57  ? 28.820 32.222 21.802 1.00 7.50  ? 57  THR A C   1 
>ATOM   16   N N   . PHE A 1 3   ? 20.637 17.477 41.402 1.00 14.69 ? 3   PHE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>820
>ATOM   444  O O   . THR A 1 57  ? 28.952 33.412 21.565 1.00 9.40  ? 57  THR A O   1 
>ATOM   17   C CA  . PHE A 1 3   ? 21.144 17.838 40.087 1.00 12.62 ? 3   PHE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>821
>ATOM   445  C CB  . THR A 1 57  ? 31.091 31.205 21.716 1.00 9.12  ? 57  THR A CB  1 
>ATOM   18   C C   . PHE A 1 3   ? 22.152 18.987 40.140 1.00 12.43 ? 3   PHE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>822
>ATOM   446  O OG1 . THR A 1 57  ? 30.758 30.171 20.786 1.00 9.41  ? 57  THR A OG1 1 
>ATOM   19   O O   . PHE A 1 3   ? 22.796 19.289 39.136 1.00 12.12 ? 3   PHE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>823
>ATOM   447  C CG2 . THR A 1 57  ? 32.297 30.775 22.516 1.00 11.48 ? 57  THR A CG2 1 
>ATOM   20   C CB  . PHE A 1 3   ? 19.970 18.262 39.188 1.00 10.74 ? 3   PHE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>824
>ATOM   448  N N   . VAL A 1 58  ? 27.786 31.510 21.356 1.00 8.04  ? 58  VAL A N   1 
>ATOM   21   C CG  . PHE A 1 3   ? 19.073 17.128 38.750 1.00 11.85 ? 3   PHE A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>825
>ATOM   449  C CA  . VAL A 1 58  ? 26.733 32.090 20.500 1.00 9.09  ? 58  VAL A CA  1 
>ATOM   22   C CD1 . PHE A 1 3   ? 18.066 16.646 39.581 1.00 10.90 ? 3   PHE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>826
>ATOM   450  C C   . VAL A 1 58  ? 25.328 32.224 21.102 1.00 8.67  ? 58  VAL A C   1 
>ATOM   23   C CD2 . PHE A 1 3   ? 19.189 16.588 37.475 1.00 13.26 ? 3   PHE A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>827
>ATOM   451  O O   . VAL A 1 58  ? 24.466 32.892 20.531 1.00 6.97  ? 58  VAL A O   1 
>ATOM   24   C CE1 . PHE A 1 3   ? 17.200 15.662 39.149 1.00 9.12  ? 3   PHE A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>828
>ATOM   452  C CB  . VAL A 1 58  ? 26.602 31.287 19.155 1.00 9.96  ? 58  VAL A CB  1 
>ATOM   25   C CE2 . PHE A 1 3   ? 18.312 15.594 37.041 1.00 11.76 ? 3   PHE A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>829
>ATOM   453  C CG1 . VAL A 1 58  ? 27.976 31.161 18.454 1.00 11.08 ? 58  VAL A CG1 1 
>ATOM   26   C CZ  . PHE A 1 3   ? 17.324 15.137 37.878 1.00 10.30 ? 3   PHE A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>830
>ATOM   454  C CG2 . VAL A 1 58  ? 26.010 29.890 19.404 1.00 9.41  ? 58  VAL A CG2 1 
>ATOM   27   N N   . SER A 1 4   ? 22.282 19.630 41.299 1.00 11.24 ? 4   SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>831
>ATOM   455  N N   . ARG A 1 59  ? 25.100 31.620 22.266 1.00 8.88  ? 59  ARG A N   1 
>ATOM   28   C CA  . SER A 1 4   ? 23.170 20.780 41.464 1.00 11.30 ? 4   SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>832
>ATOM   456  C CA  . ARG A 1 59  ? 23.783 31.655 22.882 1.00 9.95  ? 59  ARG A CA  1 
>ATOM   29   C C   . SER A 1 4   ? 24.627 20.568 41.091 1.00 10.39 ? 4   SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>833
>ATOM   457  C C   . ARG A 1 59  ? 23.843 31.140 24.303 1.00 10.14 ? 59  ARG A C   1 
>ATOM   30   O O   . SER A 1 4   ? 25.201 19.532 41.384 1.00 10.24 ? 4   SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>834
>ATOM   458  O O   . ARG A 1 59  ? 24.440 30.108 24.556 1.00 10.10 ? 59  ARG A O   1 
>ATOM   31   C CB  . SER A 1 4   ? 23.112 21.301 42.906 1.00 13.53 ? 4   SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>835
>ATOM   459  C CB  . ARG A 1 59  ? 22.837 30.751 22.074 1.00 13.11 ? 59  ARG A CB  1 
>ATOM   32   O OG  . SER A 1 4   ? 21.821 21.787 43.240 1.00 16.76 ? 4   SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>836
>ATOM   460  C CG  . ARG A 1 59  ? 21.417 30.569 22.623 1.00 16.80 ? 59  ARG A CG  1 
>ATOM   33   N N   . GLY A 1 5   ? 25.224 21.572 40.460 1.00 9.87  ? 5   GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>837
>ATOM   461  C CD  . ARG A 1 59  ? 20.521 29.961 21.535 1.00 18.74 ? 59  ARG A CD  1 
>ATOM   34   C CA  . GLY A 1 5   ? 26.628 21.486 40.103 1.00 10.86 ? 5   GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>838
>ATOM   462  N NE  . ARG A 1 59  ? 19.250 29.440 22.032 1.00 20.63 ? 59  ARG A NE  1 
>ATOM   35   C C   . GLY A 1 5   ? 26.985 22.158 38.794 1.00 11.21 ? 5   GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>839
>ATOM   463  C CZ  . ARG A 1 59  ? 18.147 30.165 22.193 1.00 22.94 ? 59  ARG A CZ  1 
>ATOM   36   O O   . GLY A 1 5   ? 26.123 22.761 38.142 1.00 9.91  ? 5   GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>840
>ATOM   464  N NH1 . ARG A 1 59  ? 18.138 31.462 21.894 1.00 22.55 ? 59  ARG A NH1 1 
>ATOM   37   N N   . ASN A 1 6   ? 28.277 22.142 38.475 1.00 10.41 ? 6   ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>841
>ATOM   465  N NH2 . ARG A 1 59  ? 17.051 29.594 22.686 1.00 23.68 ? 59  ARG A NH2 1 
>ATOM   38   C CA  . ASN A 1 6   ? 28.796 22.676 37.211 1.00 11.06 ? 6   ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>842
>ATOM   466  N N   . THR A 1 60  ? 23.183 31.849 25.211 1.00 11.23 ? 60  THR A N   1 
>ATOM   39   C C   . ASN A 1 6   ? 29.117 21.435 36.378 1.00 10.33 ? 6   ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>843
>ATOM   467  C CA  . THR A 1 60  ? 23.120 31.458 26.611 1.00 11.84 ? 60  THR A CA  1 
>ATOM   40   O O   . ASN A 1 6   ? 29.947 20.603 36.754 1.00 11.28 ? 6   ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>844
>ATOM   468  C C   . THR A 1 60  ? 21.650 31.500 27.005 1.00 11.73 ? 60  THR A C   1 
>ATOM   41   C CB  . ASN A 1 6   ? 30.023 23.548 37.445 1.00 12.95 ? 6   ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>845
>ATOM   469  O O   . THR A 1 60  ? 20.934 32.423 26.620 1.00 13.69 ? 60  THR A O   1 
>ATOM   42   C CG  . ASN A 1 6   ? 29.675 24.816 38.200 1.00 18.08 ? 6   ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>846
>ATOM   470  C CB  . THR A 1 60  ? 23.916 32.451 27.519 1.00 10.13 ? 60  THR A CB  1 
>ATOM   43   O OD1 . ASN A 1 6   ? 29.022 25.708 37.665 1.00 19.52 ? 6   ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>847
>ATOM   471  O OG1 . THR A 1 60  ? 25.320 32.302 27.276 1.00 10.55 ? 60  THR A OG1 1 
>ATOM   44   N ND2 . ASN A 1 6   ? 30.047 24.872 39.467 1.00 21.23 ? 6   ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>848
>ATOM   472  C CG2 . THR A 1 60  ? 23.632 32.181 29.003 1.00 11.01 ? 60  THR A CG2 1 
>ATOM   45   N N   . TRP A 1 7   ? 28.399 21.289 35.272 1.00 8.66  ? 7   TRP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>849
>ATOM   473  N N   . THR A 1 61  ? 21.183 30.470 27.706 1.00 11.78 ? 61  THR A N   1 
>ATOM   46   C CA  . TRP A 1 7   ? 28.518 20.119 34.424 1.00 8.74  ? 7   TRP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>850
>ATOM   474  C CA  . THR A 1 61  ? 19.797 30.413 28.175 1.00 11.54 ? 61  THR A CA  1 
>ATOM   47   C C   . TRP A 1 7   ? 29.246 20.352 33.092 1.00 9.63  ? 7   TRP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>851
>ATOM   475  C C   . THR A 1 61  ? 19.831 30.214 29.686 1.00 10.88 ? 61  THR A C   1 
>ATOM   48   O O   . TRP A 1 7   ? 29.064 21.389 32.440 1.00 9.45  ? 7   TRP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>852
>ATOM   476  O O   . THR A 1 61  ? 20.734 29.570 30.205 1.00 9.63  ? 61  THR A O   1 
>ATOM   49   C CB  . TRP A 1 7   ? 27.115 19.563 34.152 1.00 8.00  ? 7   TRP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>853
>ATOM   477  C CB  . THR A 1 61  ? 18.965 29.229 27.539 1.00 12.65 ? 61  THR A CB  1 
>ATOM   50   C CG  . TRP A 1 7   ? 26.325 19.198 35.391 1.00 8.01  ? 7   TRP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>854
>ATOM   478  O OG1 . THR A 1 61  ? 19.563 27.976 27.874 1.00 14.13 ? 61  THR A OG1 1 
>ATOM   51   C CD1 . TRP A 1 7   ? 25.556 20.031 36.159 1.00 8.29  ? 7   TRP A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>855
>ATOM   479  C CG2 . THR A 1 61  ? 18.889 29.336 26.012 1.00 14.15 ? 61  THR A CG2 1 
>ATOM   52   C CD2 . TRP A 1 7   ? 26.174 17.885 35.947 1.00 7.60  ? 7   TRP A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>856
>ATOM   480  N N   . GLU A 1 62  ? 18.878 30.828 30.382 1.00 12.14 ? 62  GLU A N   1 
>ATOM   53   N NE1 . TRP A 1 7   ? 24.922 19.308 37.156 1.00 9.20  ? 7   TRP A NE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>857
>ATOM   481  C CA  . GLU A 1 62  ? 18.749 30.698 31.833 1.00 12.88 ? 62  GLU A CA  1 
>ATOM   54   C CE2 . TRP A 1 7   ? 25.286 17.987 37.046 1.00 8.73  ? 7   TRP A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>858
>ATOM   482  C C   . GLU A 1 62  ? 17.283 30.444 32.100 1.00 12.21 ? 62  GLU A C   1 
>ATOM   55   C CE3 . TRP A 1 7   ? 26.694 16.625 35.618 1.00 6.99  ? 7   TRP A CE3 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>859
>ATOM   483  O O   . GLU A 1 62  ? 16.450 31.270 31.745 1.00 13.95 ? 62  GLU A O   1 
>ATOM   56   C CZ2 . TRP A 1 7   ? 24.909 16.876 37.815 1.00 7.67  ? 7   TRP A CZ2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>860
>ATOM   484  C CB  . GLU A 1 62  ? 19.151 31.990 32.538 1.00 16.15 ? 62  GLU A CB  1 
>ATOM   57   C CZ3 . TRP A 1 7   ? 26.320 15.527 36.380 1.00 7.58  ? 7   TRP A CZ3 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>861
>ATOM   485  C CG  . GLU A 1 62  ? 20.585 32.344 32.326 1.00 23.65 ? 62  GLU A CG  1 
>ATOM   58   C CH2 . TRP A 1 7   ? 25.433 15.663 37.468 1.00 5.92  ? 7   TRP A CH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>862
>ATOM   486  C CD  . GLU A 1 62  ? 20.961 33.649 32.979 1.00 29.90 ? 62  GLU A CD  1 
>ATOM   59   N N   . LYS A 1 8   ? 30.052 19.368 32.702 1.00 9.39  ? 8   LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>863
>ATOM   487  O OE1 . GLU A 1 62  ? 20.969 33.703 34.229 1.00 31.84 ? 62  GLU A OE1 1 
>ATOM   60   C CA  . LYS A 1 8   ? 30.802 19.424 31.450 1.00 11.56 ? 8   LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>864
>ATOM   488  O OE2 . GLU A 1 62  ? 21.258 34.616 32.236 1.00 33.89 ? 62  GLU A OE2 1 
>ATOM   61   C C   . LYS A 1 8   ? 30.342 18.243 30.611 1.00 10.56 ? 8   LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>865
>ATOM   489  N N   . ILE A 1 63  ? 16.943 29.292 32.657 1.00 10.43 ? 63  ILE A N   1 
>ATOM   62   O O   . LYS A 1 8   ? 30.091 17.158 31.138 1.00 10.14 ? 8   LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>866
>ATOM   490  C CA  . ILE A 1 63  ? 15.548 29.021 32.946 1.00 11.02 ? 63  ILE A CA  1 
>ATOM   63   C CB  . LYS A 1 8   ? 32.308 19.360 31.710 1.00 15.20 ? 8   LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>867
>ATOM   491  C C   . ILE A 1 63  ? 15.352 28.816 34.446 1.00 11.60 ? 63  ILE A C   1 
>ATOM   64   C CG  . LYS A 1 8   ? 32.785 18.080 32.313 1.00 18.52 ? 8   LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>868
>ATOM   492  O O   . ILE A 1 63  ? 16.286 28.434 35.144 1.00 9.20  ? 63  ILE A O   1 
>ATOM   65   C CD  . LYS A 1 8   ? 34.263 18.182 32.618 1.00 26.26 ? 8   LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>869
>ATOM   493  C CB  . ILE A 1 63  ? 14.976 27.816 32.125 1.00 11.28 ? 63  ILE A CB  1 
>ATOM   66   C CE  . LYS A 1 8   ? 35.091 18.499 31.378 1.00 29.22 ? 8   LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>870
>ATOM   494  C CG1 . ILE A 1 63  ? 15.717 26.519 32.431 1.00 10.60 ? 63  ILE A CG1 1 
>ATOM   67   N NZ  . LYS A 1 8   ? 35.067 17.393 30.369 1.00 32.48 ? 8   LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>871
>ATOM   495  C CG2 . ILE A 1 63  ? 15.020 28.129 30.638 1.00 11.62 ? 63  ILE A CG2 1 
>ATOM   68   N N   . ILE A 1 9   ? 30.222 18.447 29.308 1.00 8.21  ? 9   ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>872
>ATOM   496  C CD1 . ILE A 1 63  ? 15.126 25.293 31.720 1.00 13.40 ? 63  ILE A CD1 1 
>ATOM   69   C CA  . ILE A 1 9   ? 29.739 17.384 28.441 1.00 8.08  ? 9   ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>873
>ATOM   497  N N   . ASN A 1 64  ? 14.184 29.219 34.933 1.00 12.13 ? 64  ASN A N   1 
>ATOM   70   C C   . ILE A 1 9   ? 30.798 16.325 28.117 1.00 7.86  ? 9   ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>874
>ATOM   498  C CA  . ASN A 1 64  ? 13.824 29.083 36.343 1.00 14.79 ? 64  ASN A CA  1 
>ATOM   71   O O   . ILE A 1 9   ? 31.990 16.635 28.028 1.00 8.38  ? 9   ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>875
>ATOM   499  C C   . ASN A 1 64  ? 12.451 28.441 36.375 1.00 13.29 ? 64  ASN A C   1 
>ATOM   72   C CB  . ILE A 1 9   ? 29.148 17.997 27.144 1.00 10.70 ? 9   ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>876
>ATOM   500  O O   . ASN A 1 64  ? 11.490 28.976 35.802 1.00 13.29 ? 64  ASN A O   1 
>ATOM   73   C CG1 . ILE A 1 9   ? 28.285 16.981 26.401 1.00 10.95 ? 9   ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>877
>ATOM   501  C CB  . ASN A 1 64  ? 13.732 30.450 37.054 1.00 16.87 ? 64  ASN A CB  1 
>ATOM   74   C CG2 . ILE A 1 9   ? 30.261 18.500 26.243 1.00 10.70 ? 9   ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>878
>ATOM   502  C CG  . ASN A 1 64  ? 15.079 31.089 37.279 1.00 20.91 ? 64  ASN A CG  1 
>ATOM   75   C CD1 . ILE A 1 9   ? 27.586 17.597 25.207 1.00 13.23 ? 9   ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>879
>ATOM   503  O OD1 . ASN A 1 64  ? 15.775 30.764 38.238 1.00 22.91 ? 64  ASN A OD1 1 
>ATOM   76   N N   . ILE A 1 10  ? 30.373 15.067 27.995 1.00 7.08  ? 10  ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>880
>ATOM   504  N ND2 . ASN A 1 64  ? 15.459 32.007 36.393 1.00 22.20 ? 64  ASN A ND2 1 
>ATOM   77   C CA  . ILE A 1 10  ? 31.288 13.988 27.656 1.00 7.45  ? 10  ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>881
>ATOM   505  N N   . PHE A 1 65  ? 12.347 27.301 37.044 1.00 12.90 ? 65  PHE A N   1 
>ATOM   78   C C   . ILE A 1 10  ? 30.812 13.201 26.441 1.00 8.49  ? 10  ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>882
>ATOM   506  C CA  . PHE A 1 65  ? 11.058 26.641 37.132 1.00 12.63 ? 65  PHE A CA  1 
>ATOM   79   O O   . ILE A 1 10  ? 31.561 12.397 25.892 1.00 9.49  ? 10  ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>883
>ATOM   507  C C   . PHE A 1 65  ? 10.858 25.841 38.410 1.00 13.07 ? 65  PHE A C   1 
>ATOM   80   C CB  . ILE A 1 10  ? 31.586 13.023 28.847 1.00 10.28 ? 10  ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>884
>ATOM   508  O O   . PHE A 1 65  ? 11.811 25.531 39.121 1.00 12.50 ? 65  PHE A O   1 
>ATOM   81   C CG1 . ILE A 1 10  ? 30.304 12.393 29.382 1.00 10.51 ? 10  ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>885
>ATOM   509  C CB  . PHE A 1 65  ? 10.829 25.731 35.922 1.00 11.31 ? 65  PHE A CB  1 
>ATOM   82   C CG2 . ILE A 1 10  ? 32.349 13.756 29.963 1.00 10.10 ? 10  ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>886
>ATOM   510  C CG  . PHE A 1 65  ? 11.794 24.586 35.825 1.00 12.32 ? 65  PHE A CG  1 
>ATOM   83   C CD1 . ILE A 1 10  ? 30.578 11.242 30.325 1.00 12.18 ? 10  ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>887
>ATOM   511  C CD1 . PHE A 1 65  ? 11.549 23.386 36.494 1.00 10.31 ? 65  PHE A CD1 1 
>ATOM   84   N N   . ARG A 1 11  ? 29.566 13.419 26.030 1.00 7.59  ? 11  ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>888
>ATOM   512  C CD2 . PHE A 1 65  ? 12.947 24.706 35.070 1.00 11.23 ? 65  PHE A CD2 1 
>ATOM   85   C CA  . ARG A 1 11  ? 29.015 12.742 24.851 1.00 8.70  ? 11  ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>889
>ATOM   513  C CE1 . PHE A 1 65  ? 12.441 22.329 36.413 1.00 11.00 ? 65  PHE A CE1 1 
>ATOM   86   C C   . ARG A 1 11  ? 27.821 13.500 24.290 1.00 9.41  ? 11  ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>890
>ATOM   514  C CE2 . PHE A 1 65  ? 13.847 23.645 34.984 1.00 11.69 ? 65  PHE A CE2 1 
>ATOM   87   O O   . ARG A 1 11  ? 26.990 14.004 25.043 1.00 9.84  ? 11  ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>891
>ATOM   515  C CZ  . PHE A 1 65  ? 13.593 22.461 35.655 1.00 12.20 ? 65  PHE A CZ  1 
>ATOM   88   C CB  . ARG A 1 11  ? 28.563 11.316 25.184 1.00 8.07  ? 11  ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>892
>ATOM   516  N N   . LYS A 1 66  ? 9.599  25.560 38.713 1.00 13.15 ? 66  LYS A N   1 
>ATOM   89   C CG  . ARG A 1 11  ? 27.912 10.616 23.998 1.00 12.26 ? 11  ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>893
>ATOM   517  C CA  . LYS A 1 66  ? 9.251  24.735 39.849 1.00 13.41 ? 66  LYS A CA  1 
>ATOM   90   C CD  . ARG A 1 11  ? 27.234 9.340  24.394 1.00 13.46 ? 11  ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>894
>ATOM   518  C C   . LYS A 1 66  ? 8.555  23.552 39.178 1.00 12.17 ? 66  LYS A C   1 
>ATOM   91   N NE  . ARG A 1 11  ? 28.157 8.304  24.847 1.00 15.44 ? 11  ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>895
>ATOM   519  O O   . LYS A 1 66  ? 7.763  23.747 38.251 1.00 12.93 ? 66  LYS A O   1 
>ATOM   92   C CZ  . ARG A 1 11  ? 28.815 7.470  24.037 1.00 19.59 ? 11  ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>896
>ATOM   520  C CB  . LYS A 1 66  ? 8.313  25.498 40.800 1.00 16.68 ? 66  LYS A CB  1 
>ATOM   93   N NH1 . ARG A 1 11  ? 28.677 7.559  22.714 1.00 19.40 ? 11  ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>897
>ATOM   521  C CG  . LYS A 1 66  ? 7.722  24.639 41.907 1.00 24.60 ? 66  LYS A CG  1 
>ATOM   94   N NH2 . ARG A 1 11  ? 29.521 6.467  24.547 1.00 17.50 ? 11  ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>898
>ATOM   522  C CD  . LYS A 1 66  ? 7.391  25.453 43.165 1.00 28.53 ? 66  LYS A CD  1 
>ATOM   95   N N   . SER A 1 12  ? 27.748 13.594 22.965 1.00 8.84  ? 12  SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>899
>ATOM   523  C CE  . LYS A 1 66  ? 6.664  24.585 44.213 1.00 32.17 ? 66  LYS A CE  1 
>ATOM   96   C CA  . SER A 1 12  ? 26.621 14.245 22.310 1.00 8.61  ? 12  SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>900
>ATOM   524  N NZ  . LYS A 1 66  ? 7.393  23.332 44.604 1.00 32.54 ? 66  LYS A NZ  1 
>ATOM   97   C C   . SER A 1 12  ? 26.278 13.431 21.063 1.00 9.48  ? 12  SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>901
>ATOM   525  N N   . VAL A 1 67  ? 8.918  22.329 39.562 1.00 11.82 ? 67  VAL A N   1 
>ATOM   98   O O   . SER A 1 12  ? 27.159 13.147 20.250 1.00 9.84  ? 12  SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>902
>ATOM   526  C CA  . VAL A 1 67  ? 8.295  21.141 38.975 1.00 10.93 ? 67  VAL A CA  1 
>ATOM   99   C CB  . SER A 1 12  ? 26.966 15.676 21.925 1.00 9.02  ? 12  SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>903
>ATOM   527  C C   . VAL A 1 67  ? 6.783  21.174 39.226 1.00 11.97 ? 67  VAL A C   1 
>ATOM   100  O OG  . SER A 1 12  ? 25.863 16.285 21.273 1.00 11.97 ? 12  SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>904
>ATOM   528  O O   . VAL A 1 67  ? 6.343  21.480 40.342 1.00 13.54 ? 67  VAL A O   1 
>ATOM   101  N N   . GLU A 1 13  ? 25.016 13.038 20.924 1.00 7.59  ? 13  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>905
>ATOM   529  C CB  . VAL A 1 67  ? 8.908  19.827 39.541 1.00 10.09 ? 67  VAL A CB  1 
>ATOM   102  C CA  . GLU A 1 13  ? 24.586 12.258 19.768 1.00 9.67  ? 13  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>906
>ATOM   530  C CG1 . VAL A 1 67  ? 8.271  18.617 38.883 1.00 10.96 ? 67  VAL A CG1 1 
>ATOM   103  C C   . GLU A 1 13  ? 23.368 12.887 19.118 1.00 9.06  ? 13  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>907
>ATOM   531  C CG2 . VAL A 1 67  ? 10.410 19.808 39.320 1.00 10.21 ? 67  VAL A CG2 1 
>ATOM   104  O O   . GLU A 1 13  ? 22.457 13.343 19.815 1.00 7.34  ? 13  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>908
>ATOM   532  N N   . GLY A 1 68  ? 6.006  20.965 38.160 1.00 9.80  ? 68  GLY A N   1 
>ATOM   105  C CB  . GLU A 1 13  ? 24.185 10.833 20.184 1.00 9.72  ? 13  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>909
>ATOM   533  C CA  . GLY A 1 68  ? 4.557  20.962 38.265 1.00 9.33  ? 68  GLY A CA  1 
>ATOM   106  C CG  . GLU A 1 13  ? 25.257 10.018 20.895 1.00 15.17 ? 13  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>910
>ATOM   534  C C   . GLY A 1 68  ? 3.887  22.298 38.031 1.00 10.60 ? 68  GLY A C   1 
>ATOM   107  C CD  . GLU A 1 13  ? 26.262 9.340  19.954 1.00 18.75 ? 13  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>911
>ATOM   535  O O   . GLY A 1 68  ? 2.653  22.389 38.039 1.00 11.93 ? 68  GLY A O   1 
>ATOM   108  O OE1 . GLU A 1 13  ? 26.031 9.310  18.726 1.00 18.53 ? 13  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>912
>ATOM   536  N N   . GLU A 1 69  ? 4.688  23.337 37.809 1.00 11.12 ? 69  GLU A N   1 
>ATOM   109  O OE2 . GLU A 1 13  ? 27.286 8.822  20.457 1.00 19.23 ? 13  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>913
>ATOM   537  C CA  . GLU A 1 69  ? 4.165  24.682 37.553 1.00 12.64 ? 69  GLU A CA  1 
>ATOM   110  N N   . ASN A 1 14  ? 23.363 12.919 17.786 1.00 8.79  ? 14  ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>914
>ATOM   538  C C   . GLU A 1 69  ? 4.604  25.185 36.184 1.00 13.09 ? 69  GLU A C   1 
>ATOM   111  C CA  . ASN A 1 14  ? 22.202 13.408 17.025 1.00 8.29  ? 14  ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>915
>ATOM   539  O O   . GLU A 1 69  ? 5.774  25.107 35.820 1.00 12.17 ? 69  GLU A O   1 
>ATOM   112  C C   . ASN A 1 14  ? 21.813 14.896 17.153 1.00 7.35  ? 14  ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>916
>ATOM   540  C CB  . GLU A 1 69  ? 4.578  25.642 38.668 1.00 12.20 ? 69  GLU A CB  1 
>ATOM   113  O O   . ASN A 1 14  ? 20.681 15.245 16.860 1.00 7.00  ? 14  ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>917
>ATOM   541  C CG  . GLU A 1 69  ? 3.857  25.282 39.964 1.00 17.44 ? 69  GLU A CG  1 
>ATOM   114  C CB  . ASN A 1 14  ? 20.989 12.522 17.383 1.00 7.23  ? 14  ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>918
>ATOM   542  C CD  . GLU A 1 69  ? 4.116  26.211 41.138 1.00 21.02 ? 69  GLU A CD  1 
>ATOM   115  C CG  . ASN A 1 14  ? 20.358 11.833 16.172 1.00 9.38  ? 14  ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>919
>ATOM   543  O OE1 . GLU A 1 69  ? 4.496  27.384 40.945 1.00 21.43 ? 69  GLU A OE1 1 
>ATOM   116  O OD1 . ASN A 1 14  ? 20.996 11.670 15.128 1.00 10.37 ? 14  ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>920
>ATOM   544  O OE2 . GLU A 1 69  ? 3.902  25.753 42.282 1.00 23.44 ? 69  GLU A OE2 1 
>ATOM   117  N ND2 . ASN A 1 14  ? 19.106 11.436 16.310 1.00 6.35  ? 14  ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>921
>ATOM   545  N N   . GLU A 1 70  ? 3.633  25.622 35.397 1.00 14.53 ? 70  GLU A N   1 
>ATOM   118  N N   . PHE A 1 15  ? 22.734 15.777 17.536 1.00 7.26  ? 15  PHE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>922
>ATOM   546  C CA  . GLU A 1 70  ? 3.912  26.102 34.059 1.00 15.80 ? 70  GLU A CA  1 
>ATOM   119  C CA  . PHE A 1 15  ? 22.385 17.198 17.681 1.00 9.06  ? 15  PHE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>923
>ATOM   547  C C   . GLU A 1 70  ? 4.816  27.329 34.007 1.00 13.72 ? 70  GLU A C   1 
>ATOM   120  C C   . PHE A 1 15  ? 22.041 17.878 16.358 1.00 9.15  ? 15  PHE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>924
>ATOM   548  O O   . GLU A 1 70  ? 4.761  28.208 34.863 1.00 13.66 ? 70  GLU A O   1 
>ATOM   121  O O   . PHE A 1 15  ? 21.041 18.578 16.265 1.00 8.64  ? 15  PHE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>925
>ATOM   549  C CB  . GLU A 1 70  ? 2.606  26.359 33.320 1.00 19.99 ? 70  GLU A CB  1 
>ATOM   122  C CB  . PHE A 1 15  ? 23.497 17.990 18.379 1.00 10.05 ? 15  PHE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>926
>ATOM   550  C CG  . GLU A 1 70  ? 2.814  26.634 31.851 1.00 28.23 ? 70  GLU A CG  1 
>ATOM   123  C CG  . PHE A 1 15  ? 23.102 19.397 18.746 1.00 10.57 ? 15  PHE A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>927
>ATOM   551  C CD  . GLU A 1 70  ? 1.518  26.678 31.097 1.00 32.73 ? 70  GLU A CD  1 
>ATOM   124  C CD1 . PHE A 1 15  ? 22.032 19.633 19.605 1.00 13.39 ? 15  PHE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>928
>ATOM   552  O OE1 . GLU A 1 70  ? 0.975  25.589 30.789 1.00 35.76 ? 70  GLU A OE1 1 
>ATOM   125  C CD2 . PHE A 1 15  ? 23.813 20.485 18.254 1.00 11.47 ? 15  PHE A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>929
>ATOM   553  O OE2 . GLU A 1 70  ? 1.045  27.802 30.823 1.00 35.75 ? 70  GLU A OE2 1 
>ATOM   126  C CE1 . PHE A 1 15  ? 21.678 20.929 19.968 1.00 13.52 ? 15  PHE A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>930
>ATOM   554  N N   . PHE A 1 71  ? 5.713  27.340 33.028 1.00 12.80 ? 71  PHE A N   1 
>ATOM   127  C CE2 . PHE A 1 15  ? 23.467 21.784 18.609 1.00 11.60 ? 15  PHE A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>931
>ATOM   555  C CA  . PHE A 1 71  ? 6.638  28.448 32.837 1.00 12.36 ? 71  PHE A CA  1 
>ATOM   128  C CZ  . PHE A 1 15  ? 22.399 22.006 19.469 1.00 13.52 ? 15  PHE A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>932
>ATOM   556  C C   . PHE A 1 71  ? 6.856  28.678 31.350 1.00 12.97 ? 71  PHE A C   1 
>ATOM   129  N N   . GLU A 1 16  ? 22.878 17.699 15.342 1.00 11.17 ? 16  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>933
>ATOM   557  O O   . PHE A 1 71  ? 6.382  27.917 30.516 1.00 12.54 ? 71  PHE A O   1 
>ATOM   130  C CA  . GLU A 1 16  ? 22.583 18.313 14.053 1.00 12.58 ? 16  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>934
>ATOM   558  C CB  . PHE A 1 71  ? 7.975  28.243 33.589 1.00 10.02 ? 71  PHE A CB  1 
>ATOM   131  C C   . GLU A 1 16  ? 21.271 17.797 13.468 1.00 11.71 ? 16  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>935
>ATOM   559  C CG  . PHE A 1 71  ? 8.851  27.148 33.033 1.00 10.48 ? 71  PHE A CG  1 
>ATOM   132  O O   . GLU A 1 16  ? 20.503 18.567 12.888 1.00 12.66 ? 16  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>936
>ATOM   560  C CD1 . PHE A 1 71  ? 8.549  25.815 33.256 1.00 9.95  ? 71  PHE A CD1 1 
>ATOM   133  C CB  . GLU A 1 16  ? 23.711 18.081 13.060 1.00 15.91 ? 16  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>937
>ATOM   561  C CD2 . PHE A 1 71  ? 10.006 27.459 32.331 1.00 9.29  ? 71  PHE A CD2 1 
>ATOM   134  C CG  . GLU A 1 16  ? 23.274 18.337 11.626 1.00 21.31 ? 16  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>938
>ATOM   562  C CE1 . PHE A 1 71  ? 9.380  24.811 32.793 1.00 9.74  ? 71  PHE A CE1 1 
>ATOM   135  C CD  . GLU A 1 16  ? 24.376 18.878 10.757 1.00 25.39 ? 16  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>939
>ATOM   563  C CE2 . PHE A 1 71  ? 10.832 26.464 31.868 1.00 9.51  ? 71  PHE A CE2 1 
>ATOM   136  O OE1 . GLU A 1 16  ? 25.526 18.984 11.240 1.00 27.92 ? 16  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>940
>ATOM   564  C CZ  . PHE A 1 71  ? 10.518 25.136 32.102 1.00 8.47  ? 71  PHE A CZ  1 
>ATOM   137  O OE2 . GLU A 1 16  ? 24.084 19.213 9.588  1.00 28.60 ? 16  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>941
>ATOM   565  N N   . GLU A 1 72  ? 7.581  29.733 31.028 1.00 15.04 ? 72  GLU A N   1 
>ATOM   138  N N   . GLU A 1 17  ? 21.018 16.497 13.619 1.00 11.67 ? 17  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>942
>ATOM   566  C CA  . GLU A 1 72  ? 7.826  30.063 29.644 1.00 17.19 ? 72  GLU A CA  1 
>ATOM   139  C CA  . GLU A 1 17  ? 19.785 15.878 13.116 1.00 13.65 ? 17  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>943
>ATOM   567  C C   . GLU A 1 72  ? 9.323  30.036 29.357 1.00 15.53 ? 72  GLU A C   1 
>ATOM   140  C C   . GLU A 1 17  ? 18.529 16.490 13.767 1.00 13.48 ? 17  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>944
>ATOM   568  O O   . GLU A 1 72  ? 10.130 30.511 30.158 1.00 16.16 ? 72  GLU A O   1 
>ATOM   141  O O   . GLU A 1 17  ? 17.490 16.662 13.115 1.00 11.68 ? 17  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>945
>ATOM   569  C CB  . GLU A 1 72  ? 7.248  31.448 29.379 1.00 22.03 ? 72  GLU A CB  1 
>ATOM   142  C CB  . GLU A 1 17  ? 19.811 14.361 13.325 1.00 17.06 ? 17  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>946
>ATOM   570  C CG  . GLU A 1 72  ? 6.700  31.658 28.002 1.00 30.80 ? 72  GLU A CG  1 
>ATOM   143  C CG  . GLU A 1 17  ? 20.806 13.602 12.430 1.00 23.45 ? 17  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>947
>ATOM   571  C CD  . GLU A 1 72  ? 6.157  33.060 27.827 1.00 34.75 ? 72  GLU A CD  1 
>ATOM   144  C CD  . GLU A 1 17  ? 22.279 13.624 12.909 1.00 27.80 ? 17  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>948
>ATOM   572  O OE1 . GLU A 1 72  ? 5.014  33.309 28.276 1.00 35.88 ? 72  GLU A OE1 1 
>ATOM   145  O OE1 . GLU A 1 17  ? 22.637 14.338 13.881 1.00 26.52 ? 17  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>949
>ATOM   573  O OE2 . GLU A 1 72  ? 6.885  33.912 27.255 1.00 38.91 ? 72  GLU A OE2 1 
>ATOM   146  O OE2 . GLU A 1 17  ? 23.097 12.897 12.291 1.00 31.80 ? 17  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>950
>ATOM   574  N N   . GLU A 1 73  ? 9.691  29.378 28.263 1.00 13.46 ? 73  GLU A N   1 
>ATOM   147  N N   . LEU A 1 18  ? 18.640 16.834 15.048 1.00 10.82 ? 18  LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>951
>ATOM   575  C CA  . GLU A 1 73  ? 11.088 29.302 27.836 1.00 13.89 ? 73  GLU A CA  1 
>ATOM   148  C CA  . LEU A 1 18  ? 17.547 17.468 15.777 1.00 9.45  ? 18  LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>952
>ATOM   576  C C   . GLU A 1 73  ? 11.083 29.318 26.301 1.00 13.70 ? 73  GLU A C   1 
>ATOM   149  C C   . LEU A 1 18  ? 17.302 18.849 15.155 1.00 9.27  ? 18  LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>953
>ATOM   577  O O   . GLU A 1 73  ? 10.159 29.859 25.690 1.00 13.63 ? 73  GLU A O   1 
>ATOM   150  O O   . LEU A 1 18  ? 16.153 19.246 14.927 1.00 9.04  ? 18  LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>954
>ATOM   578  C CB  . GLU A 1 73  ? 11.780 28.032 28.379 1.00 12.63 ? 73  GLU A CB  1 
>ATOM   151  C CB  . LEU A 1 18  ? 17.931 17.644 17.253 1.00 9.77  ? 18  LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>955
>ATOM   579  C CG  . GLU A 1 73  ? 11.145 26.706 27.986 1.00 10.55 ? 73  GLU A CG  1 
>ATOM   152  C CG  . LEU A 1 18  ? 16.921 18.358 18.163 1.00 11.36 ? 18  LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>956
>ATOM   580  C CD  . GLU A 1 73  ? 11.997 25.499 28.366 1.00 8.94  ? 73  GLU A CD  1 
>ATOM   153  C CD1 . LEU A 1 18  ? 15.817 17.402 18.554 1.00 13.85 ? 18  LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>957
>ATOM   581  O OE1 . GLU A 1 73  ? 13.191 25.650 28.642 1.00 12.29 ? 73  GLU A OE1 1 
>ATOM   154  C CD2 . LEU A 1 18  ? 17.616 18.876 19.409 1.00 12.69 ? 18  LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>958
>ATOM   582  O OE2 . GLU A 1 73  ? 11.485 24.374 28.363 1.00 10.37 ? 73  GLU A OE2 1 
>ATOM   155  N N   . LEU A 1 19  ? 18.387 19.568 14.864 1.00 10.75 ? 19  LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>959
>ATOM   583  N N   . GLN A 1 74  ? 12.115 28.751 25.685 1.00 13.09 ? 74  GLN A N   1 
>ATOM   156  C CA  . LEU A 1 19  ? 18.275 20.906 14.276 1.00 11.15 ? 19  LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>960
>ATOM   584  C CA  . GLN A 1 74  ? 12.187 28.691 24.239 1.00 13.16 ? 74  GLN A CA  1 
>ATOM   157  C C   . LEU A 1 19  ? 17.671 20.873 12.874 1.00 12.52 ? 19  LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>961
>ATOM   585  C C   . GLN A 1 74  ? 12.618 27.315 23.806 1.00 12.86 ? 74  GLN A C   1 
>ATOM   158  O O   . LEU A 1 19  ? 16.932 21.777 12.485 1.00 10.05 ? 19  LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>962
>ATOM   586  O O   . GLN A 1 74  ? 13.290 26.596 24.552 1.00 13.17 ? 74  GLN A O   1 
>ATOM   159  C CB  . LEU A 1 19  ? 19.631 21.616 14.263 1.00 12.01 ? 19  LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>963
>ATOM   587  C CB  . GLN A 1 74  ? 13.218 29.685 23.706 1.00 15.91 ? 74  GLN A CB  1 
>ATOM   160  C CG  . LEU A 1 19  ? 20.282 21.963 15.614 1.00 10.42 ? 19  LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>964
>ATOM   588  C CG  . GLN A 1 74  ? 12.803 31.133 23.779 1.00 19.68 ? 74  GLN A CG  1 
>ATOM   161  C CD1 . LEU A 1 19  ? 21.560 22.763 15.369 1.00 13.01 ? 19  LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>965
>ATOM   589  C CD  . GLN A 1 74  ? 13.827 32.066 23.159 1.00 21.00 ? 74  GLN A CD  1 
>ATOM   162  C CD2 . LEU A 1 19  ? 19.312 22.742 16.513 1.00 11.45 ? 19  LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>966
>ATOM   590  O OE1 . GLN A 1 74  ? 15.010 31.730 23.024 1.00 22.37 ? 74  GLN A OE1 1 
>ATOM   163  N N   . LYS A 1 20  ? 17.944 19.795 12.150 1.00 14.41 ? 20  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>967
>ATOM   591  N NE2 . GLN A 1 74  ? 13.373 33.247 22.774 1.00 24.07 ? 74  GLN A NE2 1 
>ATOM   164  C CA  . LYS A 1 20  ? 17.427 19.628 10.800 1.00 16.54 ? 20  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>968
>ATOM   592  N N   . THR A 1 75  ? 12.229 26.935 22.600 1.00 10.98 ? 75  THR A N   1 
>ATOM   165  C C   . LYS A 1 20  ? 15.902 19.512 10.832 1.00 16.17 ? 20  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>969
>ATOM   593  C CA  . THR A 1 75  ? 12.664 25.656 22.056 1.00 11.83 ? 75  THR A CA  1 
>ATOM   166  O O   . LYS A 1 20  ? 15.201 20.164 10.053 1.00 15.90 ? 20  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>970
>ATOM   594  C C   . THR A 1 75  ? 14.162 25.828 21.729 1.00 11.24 ? 75  THR A C   1 
>ATOM   167  C CB  . LYS A 1 20  ? 18.048 18.390 10.157 1.00 20.07 ? 20  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>971
>ATOM   595  O O   . THR A 1 75  ? 14.681 26.951 21.764 1.00 9.95  ? 75  THR A O   1 
>ATOM   168  C CG  . LYS A 1 20  ? 18.592 18.643 8.765  1.00 26.61 ? 20  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>972
>ATOM   596  C CB  . THR A 1 75  ? 11.895 25.325 20.757 1.00 11.93 ? 75  THR A CB  1 
>ATOM   169  C CD  . LYS A 1 20  ? 18.960 17.349 8.027  1.00 30.95 ? 20  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>973
>ATOM   597  O OG1 . THR A 1 75  ? 12.123 26.366 19.795 1.00 13.31 ? 75  THR A OG1 1 
>ATOM   170  C CE  . LYS A 1 20  ? 20.226 16.690 8.579  1.00 35.68 ? 20  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>974
>ATOM   598  C CG2 . THR A 1 75  ? 10.396 25.202 21.042 1.00 13.29 ? 75  THR A CG2 1 
>ATOM   171  N NZ  . LYS A 1 20  ? 21.485 17.466 8.342  1.00 39.27 ? 20  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>975
>ATOM   599  N N   . VAL A 1 76  ? 14.841 24.731 21.377 1.00 13.77 ? 76  VAL A N   1 
>ATOM   172  N N   . VAL A 1 21  ? 15.395 18.700 11.759 1.00 15.31 ? 21  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>976
>ATOM   600  C CA  . VAL A 1 76  ? 16.278 24.762 21.049 1.00 14.39 ? 76  VAL A CA  1 
>ATOM   173  C CA  . VAL A 1 21  ? 13.958 18.508 11.927 1.00 14.41 ? 21  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>977
>ATOM   601  C C   . VAL A 1 76  ? 16.612 25.734 19.914 1.00 12.97 ? 76  VAL A C   1 
>ATOM   174  C C   . VAL A 1 21  ? 13.275 19.831 12.316 1.00 15.02 ? 21  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>978
>ATOM   602  O O   . VAL A 1 76  ? 17.639 26.407 19.956 1.00 13.75 ? 76  VAL A O   1 
>ATOM   175  O O   . VAL A 1 21  ? 12.150 20.119 11.878 1.00 13.59 ? 21  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>979
>ATOM   603  C CB  . VAL A 1 76  ? 16.827 23.351 20.680 1.00 15.44 ? 76  VAL A CB  1 
>ATOM   176  C CB  . VAL A 1 21  ? 13.674 17.422 12.998 1.00 14.93 ? 21  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>980
>ATOM   604  C CG1 . VAL A 1 76  ? 18.332 23.314 20.844 1.00 17.74 ? 76  VAL A CG1 1 
>ATOM   177  C CG1 . VAL A 1 21  ? 12.194 17.383 13.364 1.00 17.29 ? 21  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>981
>ATOM   605  C CG2 . VAL A 1 76  ? 16.218 22.293 21.548 1.00 19.99 ? 76  VAL A CG2 1 
>ATOM   178  C CG2 . VAL A 1 21  ? 14.115 16.082 12.482 1.00 15.09 ? 21  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>982
>ATOM   606  N N   . ASP A 1 77  ? 15.730 25.824 18.921 1.00 13.67 ? 77  ASP A N   1 
>ATOM   179  N N   . LEU A 1 22  ? 13.966 20.643 13.119 1.00 14.52 ? 22  LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>983
>ATOM   607  C CA  . ASP A 1 77  ? 15.933 26.727 17.789 1.00 14.47 ? 77  ASP A CA  1 
>ATOM   180  C CA  . LEU A 1 22  ? 13.432 21.938 13.569 1.00 14.42 ? 22  LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>984
>ATOM   608  C C   . ASP A 1 77  ? 15.486 28.172 18.061 1.00 15.23 ? 77  ASP A C   1 
>ATOM   181  C C   . LEU A 1 22  ? 13.478 22.984 12.467 1.00 15.49 ? 22  LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>985
>ATOM   609  O O   . ASP A 1 77  ? 15.461 29.002 17.153 1.00 14.90 ? 77  ASP A O   1 
>ATOM   182  O O   . LEU A 1 22  ? 13.038 24.115 12.666 1.00 16.81 ? 22  LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>986
>ATOM   610  C CB  . ASP A 1 77  ? 15.301 26.158 16.503 1.00 15.63 ? 77  ASP A CB  1 
>ATOM   183  C CB  . LEU A 1 22  ? 14.180 22.440 14.818 1.00 13.61 ? 22  LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>987
>ATOM   611  C CG  . ASP A 1 77  ? 13.790 26.007 16.585 1.00 15.92 ? 77  ASP A CG  1 
>ATOM   184  C CG  . LEU A 1 22  ? 13.986 21.565 16.069 1.00 13.97 ? 22  LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>988
>ATOM   612  O OD1 . ASP A 1 77  ? 13.260 25.470 17.586 1.00 14.64 ? 77  ASP A OD1 1 
>ATOM   185  C CD1 . LEU A 1 22  ? 14.852 22.047 17.225 1.00 13.25 ? 22  LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>989
>ATOM   613  O OD2 . ASP A 1 77  ? 13.123 26.409 15.613 1.00 17.79 ? 77  ASP A OD2 1 
>ATOM   186  C CD2 . LEU A 1 22  ? 12.525 21.580 16.467 1.00 14.62 ? 22  LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>990
>ATOM   614  N N   . GLY A 1 78  ? 15.095 28.445 19.312 1.00 15.17 ? 78  GLY A N   1 
>ATOM   187  N N   . GLY A 1 23  ? 14.062 22.618 11.328 1.00 16.41 ? 23  GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>991
>ATOM   615  C CA  . GLY A 1 78  ? 14.709 29.790 19.726 1.00 15.90 ? 78  GLY A CA  1 
>ATOM   188  C CA  . GLY A 1 23  ? 14.123 23.516 10.183 1.00 17.05 ? 23  GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>992
>ATOM   616  C C   . GLY A 1 78  ? 13.268 30.281 19.701 1.00 16.89 ? 78  GLY A C   1 
>ATOM   189  C C   . GLY A 1 23  ? 15.241 24.539 10.125 1.00 18.00 ? 23  GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>993
>ATOM   617  O O   . GLY A 1 78  ? 13.038 31.489 19.790 1.00 19.37 ? 78  GLY A O   1 
>ATOM   190  O O   . GLY A 1 23  ? 15.112 25.545 9.425  1.00 19.45 ? 23  GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>994
>ATOM   618  N N   . ARG A 1 79  ? 12.292 29.389 19.620 1.00 16.76 ? 79  ARG A N   1 
>ATOM   191  N N   . VAL A 1 24  ? 16.320 24.315 10.869 1.00 14.78 ? 24  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>995
>ATOM   619  C CA  . ARG A 1 79  ? 10.896 29.822 19.587 1.00 18.08 ? 79  ARG A CA  1 
>ATOM   192  C CA  . VAL A 1 24  ? 17.440 25.241 10.860 1.00 13.71 ? 24  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>996
>ATOM   620  C C   . ARG A 1 79  ? 10.229 29.768 20.961 1.00 16.55 ? 79  ARG A C   1 
>ATOM   193  C C   . VAL A 1 24  ? 18.289 24.983 9.607  1.00 15.09 ? 24  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>997
>ATOM   621  O O   . ARG A 1 79  ? 10.379 28.787 21.680 1.00 16.57 ? 79  ARG A O   1 
>ATOM   194  O O   . VAL A 1 24  ? 18.679 23.840 9.334  1.00 14.12 ? 24  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>998
>ATOM   622  C CB  . ARG A 1 79  ? 10.112 28.961 18.604 1.00 20.74 ? 79  ARG A CB  1 
>ATOM   195  C CB  . VAL A 1 24  ? 18.297 25.081 12.139 1.00 12.19 ? 24  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>999
>ATOM   623  C CG  . ARG A 1 79  ? 10.667 28.997 17.194 1.00 25.89 ? 79  ARG A CG  1 
>ATOM   196  C CG1 . VAL A 1 24  ? 19.465 26.054 12.109 1.00 8.69  ? 24  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1000
>ATOM   624  C CD  . ARG A 1 79  ? 9.986  27.976 16.310 1.00 29.77 ? 79  ARG A CD  1 
>ATOM   197  C CG2 . VAL A 1 24  ? 17.416 25.294 13.388 1.00 11.37 ? 24  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1001
>ATOM   625  N NE  . ARG A 1 79  ? 10.144 26.626 16.842 1.00 34.52 ? 79  ARG A NE  1 
>ATOM   198  N N   . ASN A 1 25  ? 18.595 26.047 8.866  1.00 15.37 ? 25  ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1002
>ATOM   626  C CZ  . ARG A 1 79  ? 10.128 25.516 16.109 1.00 35.90 ? 79  ARG A CZ  1 
>ATOM   199  C CA  . ASN A 1 25  ? 19.360 25.914 7.635  1.00 17.74 ? 25  ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1003
>ATOM   627  N NH1 . ARG A 1 79  ? 9.971  25.580 14.789 1.00 37.70 ? 79  ARG A NH1 1 
>ATOM   200  C C   . ASN A 1 25  ? 20.808 25.466 7.819  1.00 18.29 ? 25  ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1004
>ATOM   628  N NH2 . ARG A 1 79  ? 10.266 24.337 16.702 1.00 35.58 ? 79  ARG A NH2 1 
>ATOM   201  O O   . ASN A 1 25  ? 21.377 25.592 8.903  1.00 18.05 ? 25  ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1005
>ATOM   629  N N   . PRO A 1 80  ? 9.501  30.830 21.352 1.00 15.98 ? 80  PRO A N   1 
>ATOM   202  C CB  . ASN A 1 25  ? 19.230 27.172 6.742  1.00 19.41 ? 25  ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1006
>ATOM   630  C CA  . PRO A 1 80  ? 8.819  30.867 22.651 1.00 15.47 ? 80  PRO A CA  1 
>ATOM   203  C CG  . ASN A 1 25  ? 20.090 28.351 7.200  1.00 22.35 ? 25  ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1007
>ATOM   631  C C   . PRO A 1 80  ? 7.825  29.725 22.833 1.00 14.23 ? 80  PRO A C   1 
>ATOM   204  O OD1 . ASN A 1 25  ? 21.207 28.189 7.698  1.00 22.64 ? 25  ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1008
>ATOM   632  O O   . PRO A 1 80  ? 7.058  29.393 21.926 1.00 14.56 ? 80  PRO A O   1 
>ATOM   205  N ND2 . ASN A 1 25  ? 19.602 29.558 6.933  1.00 24.15 ? 25  ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1009
>ATOM   633  C CB  . PRO A 1 80  ? 8.100  32.220 22.628 1.00 15.48 ? 80  PRO A CB  1 
>ATOM   206  N N   . VAL A 1 26  ? 21.398 24.971 6.733  1.00 18.67 ? 26  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1010
>ATOM   634  C CG  . PRO A 1 80  ? 9.010  33.057 21.846 1.00 18.18 ? 80  PRO A CG  1 
>ATOM   207  C CA  . VAL A 1 26  ? 22.755 24.444 6.742  1.00 19.24 ? 26  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1011
>ATOM   635  C CD  . PRO A 1 80  ? 9.418  32.145 20.696 1.00 17.08 ? 80  PRO A CD  1 
>ATOM   208  C C   . VAL A 1 26  ? 23.825 25.280 7.421  1.00 18.39 ? 26  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1012
>ATOM   636  N N   . CYS A 1 81  ? 7.817  29.148 24.028 1.00 13.52 ? 81  CYS A N   1 
>ATOM   209  O O   . VAL A 1 26  ? 24.558 24.764 8.261  1.00 18.50 ? 26  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1013
>ATOM   637  C CA  . CYS A 1 81  ? 6.914  28.055 24.331 1.00 12.41 ? 81  CYS A CA  1 
>ATOM   210  C CB  . VAL A 1 26  ? 23.223 24.088 5.320  1.00 20.77 ? 26  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1014
>ATOM   638  C C   . CYS A 1 81  ? 6.548  28.054 25.811 1.00 12.52 ? 81  CYS A C   1 
>ATOM   211  C CG1 . VAL A 1 26  ? 24.624 23.523 5.378  1.00 22.39 ? 26  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1015
>ATOM   639  O O   . CYS A 1 81  ? 7.202  28.718 26.624 1.00 11.74 ? 81  CYS A O   1 
>ATOM   212  C CG2 . VAL A 1 26  ? 22.276 23.084 4.698  1.00 21.28 ? 26  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1016
>ATOM   640  C CB  . CYS A 1 81  ? 7.563  26.705 23.950 1.00 11.59 ? 81  CYS A CB  1 
>ATOM   213  N N   . MET A 1 27  ? 23.932 26.556 7.052  1.00 19.00 ? 27  MET A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1017
>ATOM   641  S SG  . CYS A 1 81  ? 9.063  26.255 24.894 1.00 12.86 ? 81  CYS A SG  1 
>ATOM   214  C CA  . MET A 1 27  ? 24.948 27.433 7.628  1.00 19.54 ? 27  MET A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1018
>ATOM   642  N N   . LYS A 1 82  ? 5.448  27.379 26.121 1.00 13.86 ? 82  LYS A N   1 
>ATOM   215  C C   . MET A 1 27  ? 24.734 27.741 9.099  1.00 19.04 ? 27  MET A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1019
>ATOM   643  C CA  . LYS A 1 82  ? 4.988  27.197 27.492 1.00 14.38 ? 82  LYS A CA  1 
>ATOM   216  O O   . MET A 1 27  ? 25.702 27.820 9.849  1.00 18.28 ? 27  MET A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1020
>ATOM   644  C C   . LYS A 1 82  ? 5.436  25.779 27.839 1.00 13.51 ? 82  LYS A C   1 
>ATOM   217  C CB  . MET A 1 27  ? 25.104 28.736 6.830  1.00 23.31 ? 27  MET A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1021
>ATOM   645  O O   . LYS A 1 82  ? 5.227  24.842 27.063 1.00 12.69 ? 82  LYS A O   1 
>ATOM   218  C CG  . MET A 1 27  ? 25.955 28.602 5.552  1.00 29.99 ? 27  MET A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1022
>ATOM   646  C CB  . LYS A 1 82  ? 3.473  27.299 27.589 1.00 18.36 ? 82  LYS A CB  1 
>ATOM   219  S SD  . MET A 1 27  ? 24.975 28.527 4.010  1.00 37.48 ? 27  MET A SD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1023
>ATOM   647  C CG  . LYS A 1 82  ? 2.940  28.716 27.584 1.00 26.02 ? 82  LYS A CG  1 
>ATOM   220  C CE  . MET A 1 27  ? 26.198 29.150 2.776  1.00 35.24 ? 27  MET A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1024
>ATOM   648  C CD  . LYS A 1 82  ? 3.353  29.506 28.826 1.00 31.13 ? 82  LYS A CD  1 
>ATOM   221  N N   . LEU A 1 28  ? 23.480 27.932 9.507  1.00 16.74 ? 28  LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1025
>ATOM   649  C CE  . LYS A 1 82  ? 2.686  30.894 28.832 1.00 35.39 ? 82  LYS A CE  1 
>ATOM   222  C CA  . LEU A 1 28  ? 23.190 28.209 10.912 1.00 16.39 ? 28  LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1026
>ATOM   650  N NZ  . LYS A 1 82  ? 2.868  31.652 30.120 1.00 37.63 ? 82  LYS A NZ  1 
>ATOM   223  C C   . LEU A 1 28  ? 23.477 26.954 11.722 1.00 16.86 ? 28  LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1027
>ATOM   651  N N   . SER A 1 83  ? 6.110  25.638 28.974 1.00 11.15 ? 83  SER A N   1 
>ATOM   224  O O   . LEU A 1 28  ? 23.954 27.038 12.852 1.00 15.09 ? 28  LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1028
>ATOM   652  C CA  . SER A 1 83  ? 6.624  24.352 29.397 1.00 10.10 ? 83  SER A CA  1 
>ATOM   225  C CB  . LEU A 1 28  ? 21.739 28.679 11.111 1.00 15.94 ? 28  LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1029
>ATOM   653  C C   . SER A 1 83  ? 6.083  23.931 30.752 1.00 11.16 ? 83  SER A C   1 
>ATOM   226  C CG  . LEU A 1 28  ? 21.490 30.154 10.741 1.00 16.72 ? 28  LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1030
>ATOM   654  O O   . SER A 1 83  ? 5.721  24.769 31.575 1.00 10.21 ? 83  SER A O   1 
>ATOM   227  C CD1 . LEU A 1 28  ? 20.008 30.496 10.780 1.00 14.38 ? 28  LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1031
>ATOM   655  C CB  . SER A 1 83  ? 8.149  24.418 29.446 1.00 10.30 ? 83  SER A CB  1 
>ATOM   228  C CD2 . LEU A 1 28  ? 22.302 31.074 11.665 1.00 12.81 ? 28  LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1032
>ATOM   656  O OG  . SER A 1 83  ? 8.686  24.518 28.132 1.00 11.50 ? 83  SER A OG  1 
>ATOM   229  N N   . ARG A 1 29  ? 23.228 25.791 11.121 1.00 16.05 ? 29  ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1033
>ATOM   657  N N   . LEU A 1 84  ? 6.028  22.620 30.954 1.00 11.17 ? 84  LEU A N   1 
>ATOM   230  C CA  . ARG A 1 29  ? 23.498 24.524 11.798 1.00 18.43 ? 29  ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1034
>ATOM   658  C CA  . LEU A 1 84  ? 5.557  22.016 32.192 1.00 11.84 ? 84  LEU A CA  1 
>ATOM   231  C C   . ARG A 1 29  ? 24.980 24.377 12.076 1.00 19.22 ? 29  ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1035
>ATOM   659  C C   . LEU A 1 84  ? 6.427  20.793 32.470 1.00 10.42 ? 84  LEU A C   1 
>ATOM   232  O O   . ARG A 1 29  ? 25.383 23.987 13.171 1.00 17.97 ? 29  ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1036
>ATOM   660  O O   . LEU A 1 84  ? 6.444  19.846 31.684 1.00 11.20 ? 84  LEU A O   1 
>ATOM   233  C CB  . ARG A 1 29  ? 23.030 23.334 10.969 1.00 18.63 ? 29  ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1037
>ATOM   661  C CB  . LEU A 1 84  ? 4.091  21.576 32.067 1.00 13.44 ? 84  LEU A CB  1 
>ATOM   234  C CG  . ARG A 1 29  ? 21.596 22.983 11.189 1.00 21.26 ? 29  ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1038
>ATOM   662  C CG  . LEU A 1 84  ? 3.552  20.784 33.270 1.00 15.74 ? 84  LEU A CG  1 
>ATOM   235  C CD  . ARG A 1 29  ? 21.339 21.572 10.739 1.00 24.71 ? 29  ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1039
>ATOM   663  C CD1 . LEU A 1 84  ? 3.515  21.683 34.484 1.00 16.96 ? 84  LEU A CD1 1 
>ATOM   236  N NE  . ARG A 1 29  ? 20.571 21.564 9.513  1.00 29.88 ? 29  ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1040
>ATOM   664  C CD2 . LEU A 1 84  ? 2.178  20.231 32.982 1.00 18.76 ? 84  LEU A CD2 1 
>ATOM   237  C CZ  . ARG A 1 29  ? 21.019 21.147 8.340  1.00 29.19 ? 29  ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1041
>ATOM   665  N N   . VAL A 1 85  ? 7.146  20.828 33.589 1.00 9.60  ? 85  VAL A N   1 
>ATOM   238  N NH1 . ARG A 1 29  ? 22.248 20.682 8.205  1.00 30.52 ? 29  ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1042
>ATOM   666  C CA  . VAL A 1 85  ? 8.028  19.738 34.006 1.00 9.50  ? 85  VAL A CA  1 
>ATOM   239  N NH2 . ARG A 1 29  ? 20.232 21.233 7.295  1.00 31.61 ? 29  ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1043
>ATOM   667  C C   . VAL A 1 85  ? 7.344  18.878 35.082 1.00 9.74  ? 85  VAL A C   1 
>ATOM   240  N N   . LYS A 1 30  ? 25.790 24.709 11.078 1.00 19.76 ? 30  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1044
>ATOM   668  O O   . VAL A 1 85  ? 6.680  19.404 35.985 1.00 9.28  ? 85  VAL A O   1 
>ATOM   241  C CA  . LYS A 1 30  ? 27.235 24.619 11.198 1.00 21.96 ? 30  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1045
>ATOM   669  C CB  . VAL A 1 85  ? 9.384  20.291 34.598 1.00 8.89  ? 85  VAL A CB  1 
>ATOM   242  C C   . LYS A 1 30  ? 27.706 25.418 12.417 1.00 20.91 ? 30  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1046
>ATOM   670  C CG1 . VAL A 1 85  ? 10.327 19.140 34.970 1.00 8.20  ? 85  VAL A CG1 1 
>ATOM   243  O O   . LYS A 1 30  ? 28.470 24.916 13.239 1.00 22.15 ? 30  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1047
>ATOM   671  C CG2 . VAL A 1 85  ? 10.062 21.227 33.612 1.00 8.48  ? 85  VAL A CG2 1 
>ATOM   244  C CB  . LYS A 1 30  ? 27.894 25.143 9.915  1.00 25.07 ? 30  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1048
>ATOM   672  N N   . LYS A 1 86  ? 7.504  17.563 34.971 1.00 9.96  ? 86  LYS A N   1 
>ATOM   245  C CG  . LYS A 1 30  ? 29.404 25.031 9.905  1.00 30.48 ? 30  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1049
>ATOM   673  C CA  . LYS A 1 86  ? 6.946  16.621 35.945 1.00 11.92 ? 86  LYS A CA  1 
>ATOM   246  C CD  . LYS A 1 30  ? 30.013 25.631 8.639  1.00 35.43 ? 30  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1050
>ATOM   674  C C   . LYS A 1 86  ? 8.003  15.558 36.247 1.00 11.88 ? 86  LYS A C   1 
>ATOM   247  C CE  . LYS A 1 30  ? 31.533 25.759 8.778  1.00 37.96 ? 30  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1051
>ATOM   675  O O   . LYS A 1 86  ? 8.917  15.340 35.453 1.00 11.00 ? 86  LYS A O   1 
>ATOM   248  N NZ  . LYS A 1 30  ? 32.180 26.388 7.584  1.00 41.61 ? 30  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1052
>ATOM   676  C CB  . LYS A 1 86  ? 5.700  15.911 35.385 1.00 12.40 ? 86  LYS A CB  1 
>ATOM   249  N N   . ILE A 1 31  ? 27.208 26.643 12.544 1.00 18.38 ? 31  ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1053
>ATOM   677  C CG  . LYS A 1 86  ? 4.538  16.819 35.058 1.00 16.01 ? 86  LYS A CG  1 
>ATOM   250  C CA  . ILE A 1 31  ? 27.557 27.527 13.652 1.00 16.41 ? 31  ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1054
>ATOM   678  C CD  . LYS A 1 86  ? 3.333  16.017 34.559 1.00 21.36 ? 86  LYS A CD  1 
>ATOM   251  C C   . ILE A 1 31  ? 27.105 26.932 14.989 1.00 15.39 ? 31  ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1055
>ATOM   679  C CE  . LYS A 1 86  ? 2.140  16.939 34.345 1.00 23.23 ? 86  LYS A CE  1 
>ATOM   252  O O   . ILE A 1 31  ? 27.888 26.855 15.930 1.00 14.90 ? 31  ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1056
>ATOM   680  N NZ  . LYS A 1 86  ? 0.919  16.212 33.929 1.00 28.41 ? 86  LYS A NZ  1 
>ATOM   253  C CB  . ILE A 1 31  ? 26.881 28.920 13.471 1.00 16.63 ? 31  ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1057
>ATOM   681  N N   . TRP A 1 87  ? 7.868  14.889 37.386 1.00 10.75 ? 87  TRP A N   1 
>ATOM   254  C CG1 . ILE A 1 31  ? 27.419 29.606 12.208 1.00 18.74 ? 31  ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1058
>ATOM   682  C CA  . TRP A 1 87  ? 8.775  13.811 37.738 1.00 9.53  ? 87  TRP A CA  1 
>ATOM   255  C CG2 . ILE A 1 31  ? 27.071 29.791 14.713 1.00 15.71 ? 31  ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1059
>ATOM   683  C C   . TRP A 1 87  ? 8.238  12.559 37.052 1.00 9.89  ? 87  TRP A C   1 
>ATOM   256  C CD1 . ILE A 1 31  ? 26.735 30.946 11.858 1.00 17.27 ? 31  ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1060
>ATOM   684  O O   . TRP A 1 87  ? 7.144  12.107 37.370 1.00 11.80 ? 87  TRP A O   1 
>ATOM   257  N N   . ALA A 1 32  ? 25.853 26.487 15.048 1.00 13.39 ? 32  ALA A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1061
>ATOM   685  C CB  . TRP A 1 87  ? 8.791  13.569 39.268 1.00 8.76  ? 87  TRP A CB  1 
>ATOM   258  C CA  . ALA A 1 32  ? 25.271 25.930 16.267 1.00 12.76 ? 32  ALA A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1062
>ATOM   686  C CG  . TRP A 1 87  ? 9.494  14.641 40.062 1.00 8.86  ? 87  TRP A CG  1 
>ATOM   259  C C   . ALA A 1 32  ? 25.994 24.685 16.775 1.00 12.11 ? 32  ALA A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1063
>ATOM   687  C CD1 . TRP A 1 87  ? 8.923  15.525 40.939 1.00 8.80  ? 87  TRP A CD1 1 
>ATOM   260  O O   . ALA A 1 32  ? 26.325 24.598 17.946 1.00 10.54 ? 32  ALA A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1064
>ATOM   688  C CD2 . TRP A 1 87  ? 10.889 14.990 39.992 1.00 9.42  ? 87  TRP A CD2 1 
>ATOM   261  C CB  . ALA A 1 32  ? 23.790 25.638 16.040 1.00 12.45 ? 32  ALA A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1065
>ATOM   689  N NE1 . TRP A 1 87  ? 9.872  16.410 41.400 1.00 8.01  ? 87  TRP A NE1 1 
>ATOM   262  N N   . VAL A 1 33  ? 26.252 23.731 15.886 1.00 11.95 ? 33  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1066
>ATOM   690  C CE2 . TRP A 1 87  ? 11.086 16.103 40.835 1.00 10.85 ? 87  TRP A CE2 1 
>ATOM   263  C CA  . VAL A 1 33  ? 26.932 22.490 16.256 1.00 13.80 ? 33  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1067
>ATOM   691  C CE3 . TRP A 1 87  ? 11.985 14.475 39.283 1.00 9.60  ? 87  TRP A CE3 1 
>ATOM   264  C C   . VAL A 1 33  ? 28.328 22.701 16.855 1.00 14.00 ? 33  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1068
>ATOM   692  C CZ2 . TRP A 1 87  ? 12.340 16.716 40.994 1.00 11.45 ? 87  TRP A CZ2 1 
>ATOM   265  O O   . VAL A 1 33  ? 28.693 22.048 17.832 1.00 14.07 ? 33  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1069
>ATOM   693  C CZ3 . TRP A 1 87  ? 13.230 15.084 39.438 1.00 10.72 ? 87  TRP A CZ3 1 
>ATOM   266  C CB  . VAL A 1 33  ? 27.016 21.504 15.044 1.00 13.56 ? 33  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1070
>ATOM   694  C CH2 . TRP A 1 87  ? 13.395 16.192 40.289 1.00 11.78 ? 87  TRP A CH2 1 
>ATOM   267  C CG1 . VAL A 1 33  ? 27.909 20.318 15.375 1.00 16.07 ? 33  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1071
>ATOM   695  N N   . GLU A 1 88  ? 8.954  12.040 36.064 1.00 9.93  ? 88  GLU A N   1 
>ATOM   268  C CG2 . VAL A 1 33  ? 25.621 21.006 14.684 1.00 14.96 ? 33  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1072
>ATOM   696  C CA  . GLU A 1 88  ? 8.526  10.807 35.416 1.00 11.30 ? 88  GLU A CA  1 
>ATOM   269  N N   . ALA A 1 34  ? 29.101 23.620 16.281 1.00 14.73 ? 34  ALA A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1073
>ATOM   697  C C   . GLU A 1 88  ? 8.826  9.726  36.448 1.00 11.75 ? 88  GLU A C   1 
>ATOM   270  C CA  . ALA A 1 34  ? 30.443 23.898 16.780 1.00 14.95 ? 34  ALA A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1074
>ATOM   698  O O   . GLU A 1 88  ? 8.068  8.784  36.623 1.00 12.78 ? 88  GLU A O   1 
>ATOM   271  C C   . ALA A 1 34  ? 30.381 24.505 18.178 1.00 15.59 ? 34  ALA A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1075
>ATOM   699  C CB  . GLU A 1 88  ? 9.337  10.541 34.156 1.00 13.50 ? 88  GLU A CB  1 
>ATOM   272  O O   . ALA A 1 34  ? 31.120 24.085 19.065 1.00 16.65 ? 34  ALA A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1076
>ATOM   700  C CG  . GLU A 1 88  ? 8.917  9.261  33.454 1.00 18.67 ? 88  GLU A CG  1 
>ATOM   273  C CB  . ALA A 1 34  ? 31.191 24.844 15.833 1.00 16.10 ? 34  ALA A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1077
>ATOM   701  C CD  . GLU A 1 88  ? 9.756  8.958  32.226 1.00 23.49 ? 88  GLU A CD  1 
>ATOM   274  N N   . ALA A 1 35  ? 29.495 25.480 18.375 1.00 13.20 ? 35  ALA A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1078
>ATOM   702  O OE1 . GLU A 1 88  ? 9.581  9.650  31.205 1.00 26.53 ? 88  GLU A OE1 1 
>ATOM   275  C CA  . ALA A 1 35  ? 29.371 26.134 19.671 1.00 13.04 ? 35  ALA A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1079
>ATOM   703  O OE2 . GLU A 1 88  ? 10.587 8.025  32.276 1.00 26.54 ? 88  GLU A OE2 1 
>ATOM   276  C C   . ALA A 1 35  ? 28.807 25.200 20.749 1.00 12.91 ? 35  ALA A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1080
>ATOM   704  N N   . SER A 1 89  ? 9.972  9.870  37.103 1.00 11.49 ? 89  SER A N   1 
>ATOM   277  O O   . ALA A 1 35  ? 29.245 25.239 21.895 1.00 12.32 ? 35  ALA A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1081
>ATOM   705  C CA  . SER A 1 89  ? 10.402 8.954  38.158 1.00 11.10 ? 89  SER A CA  1 
>ATOM   278  C CB  . ALA A 1 35  ? 28.517 27.387 19.552 1.00 12.14 ? 35  ALA A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1082
>ATOM   706  C C   . SER A 1 89  ? 11.206 9.776  39.163 1.00 11.14 ? 89  SER A C   1 
>ATOM   279  N N   . ALA A 1 36  ? 27.878 24.332 20.362 1.00 11.40 ? 36  ALA A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1083
>ATOM   707  O O   . SER A 1 89  ? 11.397 10.983 38.979 1.00 9.92  ? 89  SER A O   1 
>ATOM   280  C CA  . ALA A 1 36  ? 27.253 23.416 21.312 1.00 12.63 ? 36  ALA A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1084
>ATOM   708  C CB  . SER A 1 89  ? 11.221 7.778  37.604 1.00 12.43 ? 89  SER A CB  1 
>ATOM   281  C C   . ALA A 1 36  ? 28.128 22.256 21.770 1.00 13.40 ? 36  ALA A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1085
>ATOM   709  O OG  . SER A 1 89  ? 12.396 8.215  36.947 1.00 14.39 ? 89  SER A OG  1 
>ATOM   282  O O   . ALA A 1 36  ? 27.743 21.512 22.668 1.00 13.47 ? 36  ALA A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1086
>ATOM   710  N N   . GLU A 1 90  ? 11.674 9.130  40.227 1.00 10.17 ? 90  GLU A N   1 
>ATOM   283  C CB  . ALA A 1 36  ? 25.952 22.883 20.744 1.00 11.79 ? 36  ALA A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1087
>ATOM   711  C CA  . GLU A 1 90  ? 12.433 9.826  41.254 1.00 10.83 ? 90  GLU A CA  1 
>ATOM   284  N N   . SER A 1 37  ? 29.286 22.080 21.148 1.00 13.86 ? 37  SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1088
>ATOM   712  C C   . GLU A 1 90  ? 13.657 10.629 40.772 1.00 9.86  ? 90  GLU A C   1 
>ATOM   285  C CA  . SER A 1 37  ? 30.169 20.983 21.520 1.00 15.95 ? 37  SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1089
>ATOM   713  O O   . GLU A 1 90  ? 13.932 11.715 41.289 1.00 10.30 ? 90  GLU A O   1 
>ATOM   286  C C   . SER A 1 37  ? 30.938 21.245 22.818 1.00 16.46 ? 37  SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1090
>ATOM   714  C CB  . GLU A 1 90  ? 12.858 8.846  42.348 1.00 11.92 ? 90  GLU A CB  1 
>ATOM   287  O O   . SER A 1 37  ? 31.488 20.320 23.406 1.00 18.23 ? 37  SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1091
>ATOM   715  C CG  . GLU A 1 90  ? 13.536 9.572  43.487 1.00 16.53 ? 90  GLU A CG  1 
>ATOM   288  C CB  . SER A 1 37  ? 31.145 20.689 20.388 1.00 16.93 ? 37  SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1092
>ATOM   716  C CD  . GLU A 1 90  ? 13.912 8.671  44.644 1.00 19.80 ? 90  GLU A CD  1 
>ATOM   289  O OG  . SER A 1 37  ? 32.100 21.729 20.293 1.00 21.65 ? 37  SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1093
>ATOM   717  O OE1 . GLU A 1 90  ? 14.122 7.464  44.426 1.00 21.18 ? 90  GLU A OE1 1 
>ATOM   290  N N   . LYS A 1 38  ? 30.957 22.496 23.272 1.00 16.91 ? 38  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1094
>ATOM   718  O OE2 . GLU A 1 90  ? 14.012 9.187  45.774 1.00 22.91 ? 90  GLU A OE2 1 
>ATOM   291  C CA  . LYS A 1 38  ? 31.657 22.869 24.502 1.00 18.36 ? 38  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1095
>ATOM   719  N N   . ASN A 1 91  ? 14.376 10.102 39.783 1.00 8.79  ? 91  ASN A N   1 
>ATOM   292  C C   . LYS A 1 38  ? 30.817 23.809 25.382 1.00 15.90 ? 38  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1096
>ATOM   720  C CA  . ASN A 1 91  ? 15.578 10.767 39.274 1.00 10.50 ? 91  ASN A CA  1 
>ATOM   293  O O   . LYS A 1 38  ? 31.175 24.975 25.591 1.00 16.72 ? 38  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1097
>ATOM   721  C C   . ASN A 1 91  ? 15.455 11.289 37.855 1.00 9.69  ? 91  ASN A C   1 
>ATOM   294  C CB  . LYS A 1 38  ? 33.004 23.539 24.156 1.00 23.99 ? 38  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1098
>ATOM   722  O O   . ASN A 1 91  ? 16.467 11.627 37.246 1.00 7.10  ? 91  ASN A O   1 
>ATOM   295  C CG  . LYS A 1 38  ? 32.907 24.607 23.046 1.00 30.97 ? 38  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1099
>ATOM   723  C CB  . ASN A 1 91  ? 16.760 9.798  39.305 1.00 14.33 ? 91  ASN A CB  1 
>ATOM   296  C CD  . LYS A 1 38  ? 34.250 25.320 22.792 1.00 36.44 ? 38  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1100
>ATOM   724  C CG  . ASN A 1 91  ? 17.064 9.307  40.693 1.00 17.71 ? 91  ASN A CG  1 
>ATOM   297  C CE  . LYS A 1 38  ? 34.266 26.098 21.456 1.00 38.70 ? 38  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1101
>ATOM   725  O OD1 . ASN A 1 91  ? 17.445 10.087 41.560 1.00 20.87 ? 91  ASN A OD1 1 
>ATOM   298  N NZ  . LYS A 1 38  ? 33.193 27.131 21.321 1.00 39.37 ? 38  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1102
>ATOM   726  N ND2 . ASN A 1 91  ? 16.855 8.016  40.928 1.00 19.39 ? 91  ASN A ND2 1 
>ATOM   299  N N   . PRO A 1 39  ? 29.669 23.321 25.906 1.00 13.53 ? 39  PRO A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1103
>ATOM   727  N N   . LYS A 1 92  ? 14.230 11.387 37.352 1.00 8.60  ? 92  LYS A N   1 
>ATOM   300  C CA  . PRO A 1 39  ? 28.851 24.201 26.747 1.00 11.87 ? 39  PRO A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1104
>ATOM   728  C CA  . LYS A 1 92  ? 14.016 11.835 35.981 1.00 8.88  ? 92  LYS A CA  1 
>ATOM   301  C C   . PRO A 1 39  ? 29.292 24.248 28.211 1.00 12.05 ? 39  PRO A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1105
>ATOM   729  C C   . LYS A 1 92  ? 12.861 12.812 35.807 1.00 8.61  ? 92  LYS A C   1 
>ATOM   302  O O   . PRO A 1 39  ? 30.027 23.380 28.676 1.00 12.12 ? 39  PRO A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1106
>ATOM   730  O O   . LYS A 1 92  ? 11.721 12.511 36.168 1.00 8.95  ? 92  LYS A O   1 
>ATOM   303  C CB  . PRO A 1 39  ? 27.469 23.560 26.649 1.00 9.34  ? 39  PRO A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1107
>ATOM   731  C CB  . LYS A 1 92  ? 13.781 10.626 35.078 1.00 9.10  ? 92  LYS A CB  1 
>ATOM   304  C CG  . PRO A 1 39  ? 27.779 22.131 26.593 1.00 10.32 ? 39  PRO A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1108
>ATOM   732  C CG  . LYS A 1 92  ? 13.566 10.996 33.618 1.00 11.95 ? 92  LYS A CG  1 
>ATOM   305  C CD  . PRO A 1 39  ? 29.009 22.020 25.703 1.00 10.86 ? 39  PRO A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1109
>ATOM   733  C CD  . LYS A 1 92  ? 13.467 9.762  32.759 1.00 14.04 ? 92  LYS A CD  1 
>ATOM   306  N N   . ALA A 1 40  ? 28.921 25.316 28.898 1.00 11.52 ? 40  ALA A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1110
>ATOM   734  C CE  . LYS A 1 92  ? 13.333 10.124 31.299 1.00 16.33 ? 92  LYS A CE  1 
>ATOM   307  C CA  . ALA A 1 40  ? 29.192 25.423 30.329 1.00 11.84 ? 40  ALA A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1111
>ATOM   735  N NZ  . LYS A 1 92  ? 13.129 8.884  30.506 1.00 17.37 ? 92  LYS A NZ  1 
>ATOM   308  C C   . ALA A 1 40  ? 27.773 25.329 30.894 1.00 10.23 ? 40  ALA A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1112
>ATOM   736  N N   . MET A 1 93  ? 13.172 13.988 35.268 1.00 7.58  ? 93  MET A N   1 
>ATOM   309  O O   . ALA A 1 40  ? 26.894 26.080 30.478 1.00 10.42 ? 40  ALA A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1113
>ATOM   737  C CA  . MET A 1 93  ? 12.159 14.985 34.995 1.00 8.21  ? 93  MET A CA  1 
>ATOM   310  C CB  . ALA A 1 40  ? 29.830 26.767 30.673 1.00 11.40 ? 40  ALA A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1114
>ATOM   738  C C   . MET A 1 93  ? 11.915 15.038 33.496 1.00 9.18  ? 93  MET A C   1 
>ATOM   311  N N   . VAL A 1 41  ? 27.518 24.345 31.750 1.00 10.73 ? 41  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1115
>ATOM   739  O O   . MET A 1 93  ? 12.833 14.838 32.690 1.00 7.74  ? 93  MET A O   1 
>ATOM   312  C CA  . VAL A 1 41  ? 26.185 24.169 32.333 1.00 9.92  ? 41  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1116
>ATOM   740  C CB  . MET A 1 93  ? 12.565 16.359 35.523 1.00 9.68  ? 93  MET A CB  1 
>ATOM   313  C C   . VAL A 1 41  ? 26.226 24.295 33.854 1.00 11.64 ? 41  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1117
>ATOM   741  C CG  . MET A 1 93  ? 13.826 16.925 34.937 1.00 13.16 ? 93  MET A CG  1 
>ATOM   314  O O   . VAL A 1 41  ? 27.026 23.627 34.514 1.00 11.40 ? 41  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1118
>ATOM   742  S SD  . MET A 1 93  ? 14.238 18.543 35.628 1.00 17.49 ? 93  MET A SD  1 
>ATOM   315  C CB  . VAL A 1 41  ? 25.594 22.772 31.987 1.00 10.67 ? 41  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1119
>ATOM   743  C CE  . MET A 1 93  ? 15.009 18.106 37.076 1.00 18.53 ? 93  MET A CE  1 
>ATOM   316  C CG1 . VAL A 1 41  ? 24.204 22.596 32.612 1.00 11.34 ? 41  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1120
>ATOM   744  N N   . VAL A 1 94  ? 10.658 15.239 33.128 1.00 9.48  ? 94  VAL A N   1 
>ATOM   317  C CG2 . VAL A 1 41  ? 25.507 22.583 30.475 1.00 11.31 ? 41  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1121
>ATOM   745  C CA  . VAL A 1 94  ? 10.266 15.334 31.726 1.00 9.55  ? 94  VAL A CA  1 
>ATOM   318  N N   . GLU A 1 42  ? 25.364 25.147 34.399 1.00 10.94 ? 42  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1122
>ATOM   746  C C   . VAL A 1 94  ? 9.516  16.639 31.528 1.00 10.10 ? 94  VAL A C   1 
>ATOM   319  C CA  . GLU A 1 42  ? 25.271 25.327 35.845 1.00 12.40 ? 42  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1123
>ATOM   747  O O   . VAL A 1 94  ? 8.683  17.024 32.364 1.00 9.47  ? 94  VAL A O   1 
>ATOM   320  C C   . GLU A 1 42  ? 23.837 25.095 36.316 1.00 11.42 ? 42  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1124
>ATOM   748  C CB  . VAL A 1 94  ? 9.371  14.164 31.315 1.00 11.05 ? 94  VAL A CB  1 
>ATOM   321  O O   . GLU A 1 42  ? 22.898 25.720 35.825 1.00 10.46 ? 42  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1125
>ATOM   749  C CG1 . VAL A 1 94  ? 8.878  14.354 29.878 1.00 12.88 ? 94  VAL A CG1 1 
>ATOM   322  C CB  . GLU A 1 42  ? 25.711 26.721 36.270 1.00 16.26 ? 42  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1126
>ATOM   750  C CG2 . VAL A 1 94  ? 10.147 12.866 31.420 1.00 14.00 ? 94  VAL A CG2 1 
>ATOM   323  C CG  . GLU A 1 42  ? 25.495 26.947 37.768 1.00 23.78 ? 42  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1127
>ATOM   751  N N   . CYS A 1 95  ? 9.802  17.312 30.413 1.00 9.49  ? 95  CYS A N   1 
>ATOM   324  C CD  . GLU A 1 42  ? 25.944 28.311 38.242 1.00 27.94 ? 42  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1128
>ATOM   752  C CA  . CYS A 1 95  ? 9.169  18.582 30.094 1.00 8.82  ? 95  CYS A CA  1 
>ATOM   325  O OE1 . GLU A 1 42  ? 25.308 29.329 37.872 1.00 29.92 ? 42  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1129
>ATOM   753  C C   . CYS A 1 95  ? 8.431  18.559 28.758 1.00 11.70 ? 95  CYS A C   1 
>ATOM   326  O OE2 . GLU A 1 42  ? 26.935 28.351 39.002 1.00 32.64 ? 42  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1130
>ATOM   754  O O   . CYS A 1 95  ? 9.014  18.215 27.723 1.00 12.29 ? 95  CYS A O   1 
>ATOM   327  N N   . ILE A 1 43  ? 23.673 24.176 37.261 1.00 10.55 ? 43  ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1131
>ATOM   755  C CB  . CYS A 1 95  ? 10.229 19.679 30.059 1.00 8.79  ? 95  CYS A CB  1 
>ATOM   328  C CA  . ILE A 1 43  ? 22.362 23.864 37.794 1.00 10.69 ? 43  ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1132
>ATOM   756  S SG  . CYS A 1 95  ? 9.620  21.322 29.690 1.00 10.97 ? 95  CYS A SG  1 
>ATOM   329  C C   . ILE A 1 43  ? 22.360 24.120 39.300 1.00 11.07 ? 43  ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1133
>ATOM   757  N N   . GLU A 1 96  ? 7.149  18.902 28.791 1.00 10.87 ? 96  GLU A N   1 
>ATOM   330  O O   . ILE A 1 43  ? 23.307 23.764 39.992 1.00 10.83 ? 43  ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1134
>ATOM   758  C CA  . GLU A 1 96  ? 6.342  18.962 27.587 1.00 14.78 ? 96  GLU A CA  1 
>ATOM   331  C CB  . ILE A 1 43  ? 21.996 22.374 37.552 1.00 10.47 ? 43  ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1135
>ATOM   759  C C   . GLU A 1 96  ? 6.267  20.439 27.182 1.00 13.83 ? 96  GLU A C   1 
>ATOM   332  C CG1 . ILE A 1 43  ? 21.974 22.072 36.056 1.00 10.46 ? 43  ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1136
>ATOM   760  O O   . GLU A 1 96  ? 6.044  21.311 28.030 1.00 12.79 ? 96  GLU A O   1 
>ATOM   333  C CG2 . ILE A 1 43  ? 20.636 22.031 38.186 1.00 10.34 ? 43  ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1137
>ATOM   761  C CB  . GLU A 1 96  ? 4.957  18.397 27.885 1.00 20.21 ? 96  GLU A CB  1 
>ATOM   334  C CD1 . ILE A 1 43  ? 21.607 20.639 35.726 1.00 9.00  ? 43  ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1138
>ATOM   762  C CG  . GLU A 1 96  ? 3.981  18.432 26.726 1.00 32.46 ? 96  GLU A CG  1 
>ATOM   335  N N   . LYS A 1 44  ? 21.315 24.784 39.778 1.00 12.26 ? 44  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1139
>ATOM   763  C CD  . GLU A 1 96  ? 2.646  17.765 27.065 1.00 38.97 ? 96  GLU A CD  1 
>ATOM   336  C CA  . LYS A 1 44  ? 21.127 25.051 41.201 1.00 13.96 ? 44  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1140
>ATOM   764  O OE1 . GLU A 1 96  ? 2.053  18.108 28.128 1.00 42.61 ? 96  GLU A OE1 1 
>ATOM   337  C C   . LYS A 1 44  ? 19.729 24.528 41.516 1.00 14.16 ? 44  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1141
>ATOM   765  O OE2 . GLU A 1 96  ? 2.201  16.892 26.271 1.00 42.17 ? 96  GLU A OE2 1 
>ATOM   338  O O   . LYS A 1 44  ? 18.749 24.920 40.873 1.00 14.12 ? 44  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1142
>ATOM   766  N N   . GLN A 1 97  ? 6.513  20.725 25.903 1.00 13.39 ? 97  GLN A N   1 
>ATOM   339  C CB  . LYS A 1 44  ? 21.220 26.545 41.503 1.00 16.58 ? 44  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1143
>ATOM   767  C CA  . GLN A 1 97  ? 6.489  22.100 25.402 1.00 13.55 ? 97  GLN A CA  1 
>ATOM   340  C CG  . LYS A 1 44  ? 22.580 27.150 41.170 1.00 22.90 ? 44  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1144
>ATOM   768  C C   . GLN A 1 97  ? 5.357  22.334 24.400 1.00 15.88 ? 97  GLN A C   1 
>ATOM   341  C CD  . LYS A 1 44  ? 22.571 28.654 41.385 1.00 29.01 ? 44  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1145
>ATOM   769  O O   . GLN A 1 97  ? 5.013  21.455 23.591 1.00 16.25 ? 97  GLN A O   1 
>ATOM   342  C CE  . LYS A 1 44  ? 23.890 29.293 40.982 1.00 31.56 ? 44  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1146
>ATOM   770  C CB  . GLN A 1 97  ? 7.823  22.465 24.747 1.00 12.20 ? 97  GLN A CB  1 
>ATOM   343  N NZ  . LYS A 1 44  ? 23.818 30.781 41.111 1.00 34.70 ? 44  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1147
>ATOM   771  C CG  . GLN A 1 97  ? 9.033  22.324 25.650 1.00 12.55 ? 97  GLN A CG  1 
>ATOM   344  N N   . GLN A 1 45  ? 19.649 23.594 42.460 1.00 15.66 ? 45  GLN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1148
>ATOM   772  C CD  . GLN A 1 97  ? 10.321 22.613 24.927 1.00 14.20 ? 97  GLN A CD  1 
>ATOM   345  C CA  . GLN A 1 45  ? 18.377 22.993 42.852 1.00 16.03 ? 45  GLN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1149
>ATOM   773  O OE1 . GLN A 1 97  ? 10.478 22.288 23.749 1.00 12.94 ? 97  GLN A OE1 1 
>ATOM   346  C C   . GLN A 1 45  ? 18.098 23.182 44.342 1.00 17.60 ? 45  GLN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1150
>ATOM   774  N NE2 . GLN A 1 97  ? 11.260 23.235 25.627 1.00 14.75 ? 97  GLN A NE2 1 
>ATOM   347  O O   . GLN A 1 45  ? 18.989 23.024 45.164 1.00 17.17 ? 45  GLN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1151
>ATOM   775  N N   . LYS A 1 98  ? 4.801  23.541 24.450 1.00 17.30 ? 98  LYS A N   1 
>ATOM   348  C CB  . GLN A 1 45  ? 18.397 21.498 42.544 1.00 15.51 ? 45  GLN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1152
>ATOM   776  C CA  . LYS A 1 98  ? 3.696  23.952 23.582 1.00 19.78 ? 98  LYS A CA  1 
>ATOM   349  C CG  . GLN A 1 45  ? 17.168 20.744 43.015 1.00 13.62 ? 45  GLN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1153
>ATOM   777  C C   . LYS A 1 98  ? 3.990  25.340 23.019 1.00 18.56 ? 98  LYS A C   1 
>ATOM   350  C CD  . GLN A 1 45  ? 17.312 19.256 42.838 1.00 15.68 ? 45  GLN A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1154
>ATOM   778  O O   . LYS A 1 98  ? 4.162  26.293 23.771 1.00 17.70 ? 98  LYS A O   1 
>ATOM   351  O OE1 . GLN A 1 45  ? 18.348 18.769 42.397 1.00 18.84 ? 45  GLN A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1155
>ATOM   779  C CB  . LYS A 1 98  ? 2.389  23.953 24.389 1.00 23.30 ? 98  LYS A CB  1 
>ATOM   352  N NE2 . GLN A 1 45  ? 16.276 18.521 43.177 1.00 16.73 ? 45  GLN A NE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1156
>ATOM   780  C CG  . LYS A 1 98  ? 1.294  24.857 23.867 1.00 30.94 ? 98  LYS A CG  1 
>ATOM   353  N N   . GLU A 1 46  ? 16.868 23.551 44.670 1.00 18.48 ? 46  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1157
>ATOM   781  C CD  . LYS A 1 98  ? 0.210  25.047 24.934 1.00 37.10 ? 98  LYS A CD  1 
>ATOM   354  C CA  . GLU A 1 46  ? 16.441 23.718 46.062 1.00 21.26 ? 46  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1158
>ATOM   782  C CE  . LYS A 1 98  ? -0.849 26.072 24.520 1.00 39.73 ? 98  LYS A CE  1 
>ATOM   355  C C   . GLU A 1 46  ? 15.108 23.004 46.105 1.00 19.06 ? 46  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1159
>ATOM   783  N NZ  . LYS A 1 98  ? -0.326 27.476 24.541 1.00 42.46 ? 98  LYS A NZ  1 
>ATOM   356  O O   . GLU A 1 46  ? 14.080 23.589 45.784 1.00 20.08 ? 46  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1160
>ATOM   784  N N   . LEU A 1 99  ? 4.073  25.445 21.696 1.00 19.35 ? 99  LEU A N   1 
>ATOM   357  C CB  . GLU A 1 46  ? 16.239 25.194 46.408 1.00 26.45 ? 46  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1161
>ATOM   785  C CA  . LEU A 1 99  ? 4.357  26.721 21.041 1.00 21.32 ? 99  LEU A CA  1 
>ATOM   358  C CG  . GLU A 1 46  ? 17.284 25.787 47.361 1.00 37.46 ? 46  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1162
>ATOM   786  C C   . LEU A 1 99  ? 3.307  27.770 21.351 1.00 22.86 ? 99  LEU A C   1 
>ATOM   359  C CD  . GLU A 1 46  ? 17.093 25.374 48.832 1.00 42.24 ? 46  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1163
>ATOM   787  O O   . LEU A 1 99  ? 2.108  27.496 21.261 1.00 23.41 ? 99  LEU A O   1 
>ATOM   360  O OE1 . GLU A 1 46  ? 16.192 25.944 49.501 1.00 44.05 ? 46  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1164
>ATOM   788  C CB  . LEU A 1 99  ? 4.466  26.542 19.526 1.00 22.09 ? 99  LEU A CB  1 
>ATOM   361  O OE2 . GLU A 1 46  ? 17.867 24.507 49.320 1.00 44.14 ? 46  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1165
>ATOM   789  C CG  . LEU A 1 99  ? 5.692  25.792 18.997 1.00 22.72 ? 99  LEU A CG  1 
>ATOM   362  N N   . GLY A 1 47  ? 15.131 21.720 46.429 1.00 18.35 ? 47  GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1166
>ATOM   790  C CD1 . LEU A 1 99  ? 5.585  25.639 17.490 1.00 23.04 ? 99  LEU A CD1 1 
>ATOM   363  C CA  . GLY A 1 47  ? 13.893 20.970 46.463 1.00 18.96 ? 47  GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1167
>ATOM   791  C CD2 . LEU A 1 99  ? 6.951  26.548 19.372 1.00 23.61 ? 99  LEU A CD2 1 
>ATOM   364  C C   . GLY A 1 47  ? 13.382 20.755 45.053 1.00 18.27 ? 47  GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1168
>ATOM   792  N N   . LEU A 1 100 ? 3.767  28.962 21.722 1.00 24.11 ? 100 LEU A N   1 
>ATOM   365  O O   . GLY A 1 47  ? 14.067 20.157 44.238 1.00 18.05 ? 47  GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1169
>ATOM   793  C CA  . LEU A 1 100 ? 2.879  30.070 22.051 1.00 27.59 ? 100 LEU A CA  1 
>ATOM   366  N N   . ASP A 1 48  ? 12.194 21.262 44.755 1.00 16.66 ? 48  ASP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1170
>ATOM   794  C C   . LEU A 1 100 ? 2.130  30.545 20.815 1.00 30.94 ? 100 LEU A C   1 
>ATOM   367  C CA  . ASP A 1 48  ? 11.617 21.107 43.420 1.00 16.86 ? 48  ASP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1171
>ATOM   795  O O   . LEU A 1 100 ? 0.951  30.908 20.877 1.00 31.34 ? 100 LEU A O   1 
>ATOM   368  C C   . ASP A 1 48  ? 11.771 22.378 42.566 1.00 15.92 ? 48  ASP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1172
>ATOM   796  C CB  . LEU A 1 100 ? 3.680  31.227 22.640 1.00 25.50 ? 100 LEU A CB  1 
>ATOM   369  O O   . ASP A 1 48  ? 11.139 22.511 41.504 1.00 14.50 ? 48  ASP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1173
>ATOM   797  C CG  . LEU A 1 100 ? 4.254  30.947 24.020 1.00 24.80 ? 100 LEU A CG  1 
>ATOM   370  C CB  . ASP A 1 48  ? 10.136 20.694 43.513 1.00 19.00 ? 48  ASP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1174
>ATOM   798  C CD1 . LEU A 1 100 ? 4.960  32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 
>ATOM   371  C CG  . ASP A 1 48  ? 9.943  19.221 43.897 1.00 21.49 ? 48  ASP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1175
>ATOM   799  C CD2 . LEU A 1 100 ? 3.141  30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 
>ATOM   372  O OD1 . ASP A 1 48  ? 10.901 18.406 43.840 1.00 23.51 ? 48  ASP A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1176
>ATOM   800  N N   . LYS A 1 101 ? 2.835  30.531 19.689 1.00 34.60 ? 101 LYS A N   1 
>ATOM   373  O OD2 . ASP A 1 48  ? 8.802  18.868 44.243 1.00 25.04 ? 48  ASP A OD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1177
>ATOM   801  C CA  . LYS A 1 101 ? 2.282  30.961 18.413 1.00 37.81 ? 101 LYS A CA  1 
>ATOM   374  N N   . THR A 1 49  ? 12.610 23.299 43.042 1.00 13.75 ? 49  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1178
>ATOM   802  C C   . LYS A 1 101 ? 2.847  30.088 17.292 1.00 37.39 ? 101 LYS A C   1 
>ATOM   375  C CA  . THR A 1 49  ? 12.870 24.551 42.348 1.00 13.82 ? 49  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1179
>ATOM   803  O O   . LYS A 1 101 ? 4.019  29.687 17.319 1.00 37.22 ? 101 LYS A O   1 
>ATOM   376  C C   . THR A 1 49  ? 14.231 24.460 41.678 1.00 13.22 ? 49  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1180
>ATOM   804  C CB  . LYS A 1 101 ? 2.653  32.429 18.147 1.00 40.57 ? 101 LYS A CB  1 
>ATOM   377  O O   . THR A 1 49  ? 15.235 24.152 42.322 1.00 12.56 ? 49  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1181
>ATOM   805  C CG  . LYS A 1 101 ? 2.182  33.426 19.212 1.00 45.13 ? 101 LYS A CG  1 
>ATOM   378  C CB  . THR A 1 49  ? 12.847 25.741 43.316 1.00 16.10 ? 49  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1182
>ATOM   806  C CD  . LYS A 1 101 ? 2.955  34.741 19.125 1.00 48.57 ? 101 LYS A CD  1 
>ATOM   379  O OG1 . THR A 1 49  ? 11.556 25.815 43.941 1.00 17.94 ? 49  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1183
>ATOM   807  C CE  . LYS A 1 101 ? 4.479  34.527 19.248 1.00 51.31 ? 101 LYS A CE  1 
>ATOM   380  C CG2 . THR A 1 49  ? 13.100 27.037 42.571 1.00 16.15 ? 49  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1184
>ATOM   808  N NZ  . LYS A 1 101 ? 4.917  33.952 20.559 1.00 51.14 ? 101 LYS A NZ  1 
>ATOM   381  N N   . PHE A 1 50  ? 14.266 24.794 40.392 1.00 12.20 ? 50  PHE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1185
>ATOM   809  N N   . GLY A 1 102 ? 1.997  29.786 16.318 1.00 37.21 ? 102 GLY A N   1 
>ATOM   382  C CA  . PHE A 1 50  ? 15.485 24.704 39.602 1.00 10.82 ? 50  PHE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1186
>ATOM   810  C CA  . GLY A 1 102 ? 2.423  28.993 15.184 1.00 36.82 ? 102 GLY A CA  1 
>ATOM   383  C C   . PHE A 1 50  ? 15.842 25.979 38.855 1.00 10.40 ? 50  PHE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1187
>ATOM   811  C C   . GLY A 1 102 ? 2.333  27.494 15.344 1.00 36.36 ? 102 GLY A C   1 
>ATOM   384  O O   . PHE A 1 50  ? 14.968 26.758 38.460 1.00 9.90  ? 50  PHE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1188
>ATOM   812  O O   . GLY A 1 102 ? 1.690  26.977 16.265 1.00 35.74 ? 102 GLY A O   1 
>ATOM   385  C CB  . PHE A 1 50  ? 15.338 23.591 38.547 1.00 10.78 ? 50  PHE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1189
>ATOM   813  N N   . GLU A 1 103 ? 2.954  26.803 14.395 1.00 35.74 ? 103 GLU A N   1 
>ATOM   386  C CG  . PHE A 1 50  ? 15.316 22.192 39.107 1.00 13.13 ? 50  PHE A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1190
>ATOM   814  C CA  . GLU A 1 103 ? 2.988  25.348 14.377 1.00 35.50 ? 103 GLU A CA  1 
>ATOM   387  C CD1 . PHE A 1 50  ? 14.146 21.653 39.634 1.00 11.97 ? 50  PHE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1191
>ATOM   815  C C   . GLU A 1 103 ? 4.418  24.880 14.140 1.00 31.92 ? 103 GLU A C   1 
>ATOM   388  C CD2 . PHE A 1 50  ? 16.464 21.401 39.079 1.00 14.34 ? 50  PHE A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1192
>ATOM   816  O O   . GLU A 1 103 ? 5.281  25.654 13.723 1.00 31.61 ? 103 GLU A O   1 
>ATOM   389  C CE1 . PHE A 1 50  ? 14.113 20.367 40.120 1.00 12.69 ? 50  PHE A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1193
>ATOM   817  C CB  . GLU A 1 103 ? 2.077  24.784 13.274 1.00 39.37 ? 103 GLU A CB  1 
>ATOM   390  C CE2 . PHE A 1 50  ? 16.439 20.098 39.569 1.00 14.64 ? 50  PHE A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1194
>ATOM   818  C CG  . GLU A 1 103 ? 0.652  24.422 13.712 1.00 45.52 ? 103 GLU A CG  1 
>ATOM   391  C CZ  . PHE A 1 50  ? 15.258 19.582 40.092 1.00 13.15 ? 50  PHE A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1195
>ATOM   819  C CD  . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD  1 
>ATOM   392  N N   . TYR A 1 51  ? 17.147 26.165 38.678 1.00 10.37 ? 51  TYR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1196
>ATOM   820  O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 
>ATOM   393  C CA  . TYR A 1 51  ? 17.709 27.258 37.910 1.00 10.95 ? 51  TYR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1197
>ATOM   821  O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 
>ATOM   394  C C   . TYR A 1 51  ? 18.714 26.513 37.039 1.00 9.84  ? 51  TYR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1198
>ATOM   822  N N   . GLY A 1 104 ? 4.653  23.604 14.414 1.00 28.97 ? 104 GLY A N   1 
>ATOM   395  O O   . TYR A 1 51  ? 19.540 25.761 37.547 1.00 9.78  ? 51  TYR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1199
>ATOM   823  C CA  . GLY A 1 104 ? 5.967  23.024 14.231 1.00 25.41 ? 104 GLY A CA  1 
>ATOM   396  C CB  . TYR A 1 51  ? 18.436 28.284 38.790 1.00 12.57 ? 51  TYR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1200
>ATOM   824  C C   . GLY A 1 104 ? 6.012  21.648 14.863 1.00 22.09 ? 104 GLY A C   1 
>ATOM   397  C CG  . TYR A 1 51  ? 19.396 29.178 38.014 1.00 12.91 ? 51  TYR A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1201
>ATOM   825  O O   . GLY A 1 104 ? 4.987  21.160 15.347 1.00 21.89 ? 104 GLY A O   1 
>ATOM   398  C CD1 . TYR A 1 51  ? 18.939 30.302 37.327 1.00 15.83 ? 51  TYR A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1202
>ATOM   826  N N   . PRO A 1 105 ? 7.176  20.976 14.832 1.00 19.50 ? 105 PRO A N   1 
>ATOM   399  C CD2 . TYR A 1 51  ? 20.762 28.896 37.974 1.00 14.05 ? 51  TYR A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1203
>ATOM   827  C CA  . PRO A 1 105 ? 7.338  19.640 15.418 1.00 17.92 ? 105 PRO A CA  1 
>ATOM   400  C CE1 . TYR A 1 51  ? 19.822 31.126 36.621 1.00 16.52 ? 51  TYR A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1204
>ATOM   828  C C   . PRO A 1 105 ? 7.020  19.664 16.914 1.00 15.61 ? 105 PRO A C   1 
>ATOM   401  C CE2 . TYR A 1 51  ? 21.655 29.705 37.275 1.00 14.62 ? 51  TYR A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1205
>ATOM   829  O O   . PRO A 1 105 ? 7.170  20.696 17.567 1.00 14.42 ? 105 PRO A O   1 
>ATOM   402  C CZ  . TYR A 1 51  ? 21.179 30.818 36.604 1.00 16.59 ? 51  TYR A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1206
>ATOM   830  C CB  . PRO A 1 105 ? 8.828  19.348 15.202 1.00 18.86 ? 105 PRO A CB  1 
>ATOM   403  O OH  . TYR A 1 51  ? 22.060 31.633 35.932 1.00 17.52 ? 51  TYR A OH  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1207
>ATOM   831  C CG  . PRO A 1 105 ? 9.188  20.164 14.005 1.00 18.76 ? 105 PRO A CG  1 
>ATOM   404  N N   . ILE A 1 52  ? 18.610 26.676 35.726 1.00 10.57 ? 52  ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1208
>ATOM   832  C CD  . PRO A 1 105 ? 8.423  21.440 14.199 1.00 18.40 ? 105 PRO A CD  1 
>ATOM   405  C CA  . ILE A 1 52  ? 19.520 26.004 34.801 1.00 9.09  ? 52  ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1209
>ATOM   833  N N   . LYS A 1 106 ? 6.552  18.541 17.444 1.00 16.02 ? 106 LYS A N   1 
>ATOM   406  C C   . ILE A 1 52  ? 20.066 27.020 33.801 1.00 8.55  ? 52  ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1210
>ATOM   834  C CA  . LYS A 1 106 ? 6.255  18.453 18.868 1.00 16.93 ? 106 LYS A CA  1 
>ATOM   407  O O   . ILE A 1 52  ? 19.296 27.652 33.086 1.00 10.49 ? 52  ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1211
>ATOM   835  C C   . LYS A 1 106 ? 7.609  18.305 19.554 1.00 15.49 ? 106 LYS A C   1 
>ATOM   408  C CB  . ILE A 1 52  ? 18.807 24.859 34.026 1.00 8.96  ? 52  ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1212
>ATOM   836  O O   . LYS A 1 106 ? 8.397  17.437 19.183 1.00 14.76 ? 106 LYS A O   1 
>ATOM   409  C CG1 . ILE A 1 52  ? 18.242 23.814 35.013 1.00 9.15  ? 52  ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1213
>ATOM   837  C CB  . LYS A 1 106 ? 5.387  17.229 19.174 1.00 20.98 ? 106 LYS A CB  1 
>ATOM   410  C CG2 . ILE A 1 52  ? 19.792 24.189 33.070 1.00 10.39 ? 52  ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1214
>ATOM   838  C CG  . LYS A 1 106 ? 5.015  17.097 20.662 1.00 27.98 ? 106 LYS A CG  1 
>ATOM   411  C CD1 . ILE A 1 52  ? 17.585 22.616 34.366 1.00 8.10  ? 52  ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1215
>ATOM   839  C CD  . LYS A 1 106 ? 4.463  18.433 21.229 1.00 33.23 ? 106 LYS A CD  1 
>ATOM   412  N N   . LYS A 1 53  ? 21.388 27.197 33.791 1.00 8.61  ? 53  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1216
>ATOM   840  C CE  . LYS A 1 106 ? 4.250  18.417 22.764 1.00 35.21 ? 106 LYS A CE  1 
>ATOM   413  C CA  . LYS A 1 53  ? 22.049 28.115 32.868 1.00 9.66  ? 53  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1217
>ATOM   841  N NZ  . LYS A 1 106 ? 5.519  18.251 23.566 1.00 33.75 ? 106 LYS A NZ  1 
>ATOM   414  C C   . LYS A 1 53  ? 22.939 27.319 31.924 1.00 8.71  ? 53  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1218
>ATOM   842  N N   . THR A 1 107 ? 7.907  19.167 20.515 1.00 13.91 ? 107 THR A N   1 
>ATOM   415  O O   . LYS A 1 53  ? 23.815 26.583 32.362 1.00 7.58  ? 53  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1219
>ATOM   843  C CA  . THR A 1 107 ? 9.203  19.086 21.190 1.00 12.14 ? 107 THR A CA  1 
>ATOM   416  C CB  . LYS A 1 53  ? 22.909 29.120 33.611 1.00 10.60 ? 53  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1220
>ATOM   844  C C   . THR A 1 107 ? 9.083  18.819 22.681 1.00 11.66 ? 107 THR A C   1 
>ATOM   417  C CG  . LYS A 1 53  ? 23.580 30.135 32.688 1.00 14.21 ? 53  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1221
>ATOM   845  O O   . THR A 1 107 ? 8.061  19.120 23.295 1.00 10.59 ? 107 THR A O   1 
>ATOM   418  C CD  . LYS A 1 53  ? 24.496 31.006 33.505 1.00 20.27 ? 53  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1222
>ATOM   846  C CB  . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB  1 
>ATOM   419  C CE  . LYS A 1 53  ? 24.831 32.319 32.828 1.00 26.91 ? 53  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1223
>ATOM   847  O OG1 . THR A 1 107 ? 9.263  21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 
>ATOM   420  N NZ  . LYS A 1 53  ? 25.878 33.009 33.659 1.00 29.12 ? 53  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1224
>ATOM   848  C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 
>ATOM   421  N N   . THR A 1 54  ? 22.686 27.445 30.625 1.00 8.49  ? 54  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1225
>ATOM   849  N N   . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N   1 
>ATOM   422  C CA  . THR A 1 54  ? 23.478 26.747 29.628 1.00 7.98  ? 54  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1226
>ATOM   850  C CA  . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98  ? 108 SER A CA  1 
>ATOM   423  C C   . THR A 1 54  ? 24.118 27.820 28.764 1.00 8.23  ? 54  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1227
>ATOM   851  C C   . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90  ? 108 SER A C   1 
>ATOM   424  O O   . THR A 1 54  ? 23.433 28.584 28.087 1.00 8.40  ? 54  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1228
>ATOM   852  O O   . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48  ? 108 SER A O   1 
>ATOM   425  C CB  . THR A 1 54  ? 22.621 25.817 28.789 1.00 8.33  ? 54  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1229
>ATOM   853  C CB  . SER A 1 108 ? 9.370  16.729 25.024 1.00 9.84  ? 108 SER A CB  1 
>ATOM   426  O OG1 . THR A 1 54  ? 21.896 24.946 29.660 1.00 9.95  ? 54  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1230
>ATOM   854  O OG  . SER A 1 108 ? 9.844  15.601 24.313 1.00 13.87 ? 108 SER A OG  1 
>ATOM   427  C CG2 . THR A 1 54  ? 23.505 24.976 27.873 1.00 4.95  ? 54  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1231
>ATOM   855  N N   . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96  ? 109 TRP A N   1 
>ATOM   428  N N   . SER A 1 55  ? 25.444 27.840 28.758 1.00 8.75  ? 55  SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1232
>ATOM   856  C CA  . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85  ? 109 TRP A CA  1 
>ATOM   429  C CA  . SER A 1 55  ? 26.171 28.865 28.047 1.00 10.50 ? 55  SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1233
>ATOM   857  C C   . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56  ? 109 TRP A C   1 
>ATOM   430  C C   . SER A 1 55  ? 27.116 28.382 26.950 1.00 9.24  ? 55  SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1234
>ATOM   858  O O   . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14  ? 109 TRP A O   1 
>ATOM   431  O O   . SER A 1 55  ? 27.802 27.370 27.101 1.00 8.98  ? 55  SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1235
>ATOM   859  C CB  . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25  ? 109 TRP A CB  1 
>ATOM   432  C CB  . SER A 1 55  ? 26.934 29.694 29.082 1.00 13.09 ? 55  SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1236
>ATOM   860  C CG  . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07  ? 109 TRP A CG  1 
>ATOM   433  O OG  . SER A 1 55  ? 27.781 30.646 28.473 1.00 23.11 ? 55  SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1237
>ATOM   861  C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28  ? 109 TRP A CD1 1 
>ATOM   434  N N   . THR A 1 56  ? 27.091 29.094 25.825 1.00 8.86  ? 56  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1238
>ATOM   862  C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31  ? 109 TRP A CD2 1 
>ATOM   435  C CA  . THR A 1 56  ? 27.978 28.831 24.684 1.00 8.05  ? 56  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1239
>ATOM   863  N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69  ? 109 TRP A NE1 1 
>ATOM   436  C C   . THR A 1 56  ? 28.393 30.215 24.138 1.00 8.09  ? 56  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1240
>ATOM   864  C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04  ? 109 TRP A CE2 1 
>ATOM   437  O O   . THR A 1 56  ? 27.834 31.237 24.525 1.00 7.17  ? 56  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1241
>ATOM   865  C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92  ? 109 TRP A CE3 1 
>ATOM   438  C CB  . THR A 1 56  ? 27.296 28.024 23.534 1.00 6.70  ? 56  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1242
>ATOM   866  C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72  ? 109 TRP A CZ2 1 
>ATOM   439  O OG1 . THR A 1 56  ? 26.294 28.829 22.909 1.00 9.76  ? 56  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1243
>ATOM   867  C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 
>ATOM   440  C CG2 . THR A 1 56  ? 26.653 26.751 24.049 1.00 7.76  ? 56  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1244
>ATOM   868  C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 
>ATOM   441  N N   . THR A 1 57  ? 29.381 30.242 23.249 1.00 9.17  ? 57  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1245
>ATOM   869  N N   . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39  ? 110 THR A N   1 
>ATOM   442  C CA  . THR A 1 57  ? 29.871 31.485 22.644 1.00 8.49  ? 57  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1246
>ATOM   870  C CA  . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23  ? 110 THR A CA  1 
>ATOM   443  C C   . THR A 1 57  ? 28.820 32.222 21.802 1.00 7.50  ? 57  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1247
>ATOM   871  C C   . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40  ? 110 THR A C   1 
>ATOM   444  O O   . THR A 1 57  ? 28.952 33.412 21.565 1.00 9.40  ? 57  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1248
>ATOM   872  O O   . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43  ? 110 THR A O   1 
>ATOM   445  C CB  . THR A 1 57  ? 31.091 31.205 21.716 1.00 9.12  ? 57  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1249
>ATOM   873  C CB  . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17  ? 110 THR A CB  1 
>ATOM   446  O OG1 . THR A 1 57  ? 30.758 30.171 20.786 1.00 9.41  ? 57  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1250
>ATOM   874  O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49  ? 110 THR A OG1 1 
>ATOM   447  C CG2 . THR A 1 57  ? 32.297 30.775 22.516 1.00 11.48 ? 57  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1251
>ATOM   875  C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64  ? 110 THR A CG2 1 
>ATOM   448  N N   . VAL A 1 58  ? 27.786 31.510 21.356 1.00 8.04  ? 58  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1252
>ATOM   876  N N   . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72  ? 111 ARG A N   1 
>ATOM   449  C CA  . VAL A 1 58  ? 26.733 32.090 20.500 1.00 9.09  ? 58  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1253
>ATOM   877  C CA  . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27  ? 111 ARG A CA  1 
>ATOM   450  C C   . VAL A 1 58  ? 25.328 32.224 21.102 1.00 8.67  ? 58  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1254
>ATOM   878  C C   . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89  ? 111 ARG A C   1 
>ATOM   451  O O   . VAL A 1 58  ? 24.466 32.892 20.531 1.00 6.97  ? 58  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1255
>ATOM   879  O O   . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35  ? 111 ARG A O   1 
>ATOM   452  C CB  . VAL A 1 58  ? 26.602 31.287 19.155 1.00 9.96  ? 58  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1256
>ATOM   880  C CB  . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20  ? 111 ARG A CB  1 
>ATOM   453  C CG1 . VAL A 1 58  ? 27.976 31.161 18.454 1.00 11.08 ? 58  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1257
>ATOM   881  C CG  . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38  ? 111 ARG A CG  1 
>ATOM   454  C CG2 . VAL A 1 58  ? 26.010 29.890 19.404 1.00 9.41  ? 58  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1258
>ATOM   882  C CD  . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70  ? 111 ARG A CD  1 
>ATOM   455  N N   . ARG A 1 59  ? 25.100 31.620 22.266 1.00 8.88  ? 59  ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1259
>ATOM   883  N NE  . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83  ? 111 ARG A NE  1 
>ATOM   456  C CA  . ARG A 1 59  ? 23.783 31.655 22.882 1.00 9.95  ? 59  ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1260
>ATOM   884  C CZ  . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ  1 
>ATOM   457  C C   . ARG A 1 59  ? 23.843 31.140 24.303 1.00 10.14 ? 59  ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1261
>ATOM   885  N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 
>ATOM   458  O O   . ARG A 1 59  ? 24.440 30.108 24.556 1.00 10.10 ? 59  ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1262
>ATOM   886  N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 
>ATOM   459  C CB  . ARG A 1 59  ? 22.837 30.751 22.074 1.00 13.11 ? 59  ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1263
>ATOM   887  N N   . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64  ? 112 GLU A N   1 
>ATOM   460  C CG  . ARG A 1 59  ? 21.417 30.569 22.623 1.00 16.80 ? 59  ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1264
>ATOM   888  C CA  . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA  1 
>ATOM   461  C CD  . ARG A 1 59  ? 20.521 29.961 21.535 1.00 18.74 ? 59  ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1265
>ATOM   889  C C   . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93  ? 112 GLU A C   1 
>ATOM   462  N NE  . ARG A 1 59  ? 19.250 29.440 22.032 1.00 20.63 ? 59  ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1266
>ATOM   890  O O   . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92  ? 112 GLU A O   1 
>ATOM   463  C CZ  . ARG A 1 59  ? 18.147 30.165 22.193 1.00 22.94 ? 59  ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1267
>ATOM   891  C CB  . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB  1 
>ATOM   464  N NH1 . ARG A 1 59  ? 18.138 31.462 21.894 1.00 22.55 ? 59  ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1268
>ATOM   892  C CG  . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG  1 
>ATOM   465  N NH2 . ARG A 1 59  ? 17.051 29.594 22.686 1.00 23.68 ? 59  ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1269
>ATOM   893  C CD  . GLU A 1 112 ? 17.484 9.325  32.177 1.00 25.09 ? 112 GLU A CD  1 
>ATOM   466  N N   . THR A 1 60  ? 23.183 31.849 25.211 1.00 11.23 ? 60  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1270
>ATOM   894  O OE1 . GLU A 1 112 ? 17.223 8.308  32.883 1.00 22.36 ? 112 GLU A OE1 1 
>ATOM   467  C CA  . THR A 1 60  ? 23.120 31.458 26.611 1.00 11.84 ? 60  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1271
>ATOM   895  O OE2 . GLU A 1 112 ? 17.175 9.443  30.955 1.00 25.10 ? 112 GLU A OE2 1 
>ATOM   468  C C   . THR A 1 60  ? 21.650 31.500 27.005 1.00 11.73 ? 60  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1272
>ATOM   896  N N   . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96  ? 113 LEU A N   1 
>ATOM   469  O O   . THR A 1 60  ? 20.934 32.423 26.620 1.00 13.69 ? 60  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1273
>ATOM   897  C CA  . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA  1 
>ATOM   470  C CB  . THR A 1 60  ? 23.916 32.451 27.519 1.00 10.13 ? 60  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1274
>ATOM   898  C C   . LEU A 1 113 ? 20.789 9.991  37.081 1.00 12.06 ? 113 LEU A C   1 
>ATOM   471  O OG1 . THR A 1 60  ? 25.320 32.302 27.276 1.00 10.55 ? 60  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1275
>ATOM   899  O O   . LEU A 1 113 ? 19.906 9.270  37.559 1.00 12.08 ? 113 LEU A O   1 
>ATOM   472  C CG2 . THR A 1 60  ? 23.632 32.181 29.003 1.00 11.01 ? 60  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1276
>ATOM   900  C CB  . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB  1 
>ATOM   473  N N   . THR A 1 61  ? 21.183 30.470 27.706 1.00 11.78 ? 61  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1277
>ATOM   901  C CG  . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG  1 
>ATOM   474  C CA  . THR A 1 61  ? 19.797 30.413 28.175 1.00 11.54 ? 61  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1278
>ATOM   902  C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 
>ATOM   475  C C   . THR A 1 61  ? 19.831 30.214 29.686 1.00 10.88 ? 61  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1279
>ATOM   903  C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 
>ATOM   476  O O   . THR A 1 61  ? 20.734 29.570 30.205 1.00 9.63  ? 61  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1280
>ATOM   904  N N   . THR A 1 114 ? 21.895 9.502  36.535 1.00 11.06 ? 114 THR A N   1 
>ATOM   477  C CB  . THR A 1 61  ? 18.965 29.229 27.539 1.00 12.65 ? 61  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1281
>ATOM   905  C CA  . THR A 1 114 ? 22.110 8.062  36.452 1.00 11.74 ? 114 THR A CA  1 
>ATOM   478  O OG1 . THR A 1 61  ? 19.563 27.976 27.874 1.00 14.13 ? 61  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1282
>ATOM   906  C C   . THR A 1 114 ? 22.816 7.522  37.686 1.00 11.41 ? 114 THR A C   1 
>ATOM   479  C CG2 . THR A 1 61  ? 18.889 29.336 26.012 1.00 14.15 ? 61  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1283
>ATOM   907  O O   . THR A 1 114 ? 23.327 8.282  38.501 1.00 11.47 ? 114 THR A O   1 
>ATOM   480  N N   . GLU A 1 62  ? 18.878 30.828 30.382 1.00 12.14 ? 62  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1284
>ATOM   908  C CB  . THR A 1 114 ? 22.894 7.700  35.188 1.00 12.89 ? 114 THR A CB  1 
>ATOM   481  C CA  . GLU A 1 62  ? 18.749 30.698 31.833 1.00 12.88 ? 62  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1285
>ATOM   909  O OG1 . THR A 1 114 ? 24.109 8.451  35.164 1.00 15.50 ? 114 THR A OG1 1 
>ATOM   482  C C   . GLU A 1 62  ? 17.283 30.444 32.100 1.00 12.21 ? 62  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1286
>ATOM   910  C CG2 . THR A 1 114 ? 22.075 8.037  33.951 1.00 14.75 ? 114 THR A CG2 1 
>ATOM   483  O O   . GLU A 1 62  ? 16.450 31.270 31.745 1.00 13.95 ? 62  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1287
>ATOM   911  N N   . ASN A 1 115 ? 22.834 6.202  37.808 1.00 13.23 ? 115 ASN A N   1 
>ATOM   484  C CB  . GLU A 1 62  ? 19.151 31.990 32.538 1.00 16.15 ? 62  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1288
>ATOM   912  C CA  . ASN A 1 115 ? 23.441 5.538  38.951 1.00 16.19 ? 115 ASN A CA  1 
>ATOM   485  C CG  . GLU A 1 62  ? 20.585 32.344 32.326 1.00 23.65 ? 62  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1289
>ATOM   913  C C   . ASN A 1 115 ? 24.930 5.761  39.139 1.00 14.24 ? 115 ASN A C   1 
>ATOM   486  C CD  . GLU A 1 62  ? 20.961 33.649 32.979 1.00 29.90 ? 62  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1290
>ATOM   914  O O   . ASN A 1 115 ? 25.432 5.626  40.256 1.00 14.74 ? 115 ASN A O   1 
>ATOM   487  O OE1 . GLU A 1 62  ? 20.969 33.703 34.229 1.00 31.84 ? 62  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1291
>ATOM   915  C CB  . ASN A 1 115 ? 23.123 4.047  38.918 1.00 21.89 ? 115 ASN A CB  1 
>ATOM   488  O OE2 . GLU A 1 62  ? 21.258 34.616 32.236 1.00 33.89 ? 62  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1292
>ATOM   916  C CG  . ASN A 1 115 ? 21.703 3.754  39.357 1.00 29.77 ? 115 ASN A CG  1 
>ATOM   489  N N   . ILE A 1 63  ? 16.943 29.292 32.657 1.00 10.43 ? 63  ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1293
>ATOM   917  O OD1 . ASN A 1 115 ? 20.955 3.046  38.669 1.00 34.83 ? 115 ASN A OD1 1 
>ATOM   490  C CA  . ILE A 1 63  ? 15.548 29.021 32.946 1.00 11.02 ? 63  ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1294
>ATOM   918  N ND2 . ASN A 1 115 ? 21.313 4.310  40.516 1.00 32.90 ? 115 ASN A ND2 1 
>ATOM   491  C C   . ILE A 1 63  ? 15.352 28.816 34.446 1.00 11.60 ? 63  ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1295
>ATOM   919  N N   . ASP A 1 116 ? 25.626 6.095  38.055 1.00 12.05 ? 116 ASP A N   1 
>ATOM   492  O O   . ILE A 1 63  ? 16.286 28.434 35.144 1.00 9.20  ? 63  ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1296
>ATOM   920  C CA  . ASP A 1 116 ? 27.061 6.364  38.094 1.00 11.99 ? 116 ASP A CA  1 
>ATOM   493  C CB  . ILE A 1 63  ? 14.976 27.816 32.125 1.00 11.28 ? 63  ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1297
>ATOM   921  C C   . ASP A 1 116 ? 27.424 7.821  38.397 1.00 11.45 ? 116 ASP A C   1 
>ATOM   494  C CG1 . ILE A 1 63  ? 15.717 26.519 32.431 1.00 10.60 ? 63  ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1298
>ATOM   922  O O   . ASP A 1 116 ? 28.592 8.184  38.393 1.00 12.23 ? 116 ASP A O   1 
>ATOM   495  C CG2 . ILE A 1 63  ? 15.020 28.129 30.638 1.00 11.62 ? 63  ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1299
>ATOM   923  C CB  . ASP A 1 116 ? 27.764 5.875  36.806 1.00 13.89 ? 116 ASP A CB  1 
>ATOM   496  C CD1 . ILE A 1 63  ? 15.126 25.293 31.720 1.00 13.40 ? 63  ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1300
>ATOM   924  C CG  . ASP A 1 116 ? 27.177 6.474  35.512 1.00 16.58 ? 116 ASP A CG  1 
>ATOM   497  N N   . ASN A 1 64  ? 14.184 29.219 34.933 1.00 12.13 ? 64  ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1301
>ATOM   925  O OD1 . ASP A 1 116 ? 26.263 7.303  35.569 1.00 19.66 ? 116 ASP A OD1 1 
>ATOM   498  C CA  . ASN A 1 64  ? 13.824 29.083 36.343 1.00 14.79 ? 64  ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1302
>ATOM   926  O OD2 . ASP A 1 116 ? 27.651 6.113  34.422 1.00 20.14 ? 116 ASP A OD2 1 
>ATOM   499  C C   . ASN A 1 64  ? 12.451 28.441 36.375 1.00 13.29 ? 64  ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1303
>ATOM   927  N N   . GLY A 1 117 ? 26.420 8.647  38.675 1.00 10.58 ? 117 GLY A N   1 
>ATOM   500  O O   . ASN A 1 64  ? 11.490 28.976 35.802 1.00 13.29 ? 64  ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1304
>ATOM   928  C CA  . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83  ? 117 GLY A CA  1 
>ATOM   501  C CB  . ASN A 1 64  ? 13.732 30.450 37.054 1.00 16.87 ? 64  ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1305
>ATOM   929  C C   . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97  ? 117 GLY A C   1 
>ATOM   502  C CG  . ASN A 1 64  ? 15.079 31.089 37.279 1.00 20.91 ? 64  ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1306
>ATOM   930  O O   . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O   1 
>ATOM   503  O OD1 . ASN A 1 64  ? 15.775 30.764 38.238 1.00 22.91 ? 64  ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1307
>ATOM   931  N N   . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43  ? 118 GLU A N   1 
>ATOM   504  N ND2 . ASN A 1 64  ? 15.459 32.007 36.393 1.00 22.20 ? 64  ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1308
>ATOM   932  C CA  . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79  ? 118 GLU A CA  1 
>ATOM   505  N N   . PHE A 1 65  ? 12.347 27.301 37.044 1.00 12.90 ? 65  PHE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1309
>ATOM   933  C C   . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60  ? 118 GLU A C   1 
>ATOM   506  C CA  . PHE A 1 65  ? 11.058 26.641 37.132 1.00 12.63 ? 65  PHE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1310
>ATOM   934  O O   . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05  ? 118 GLU A O   1 
>ATOM   507  C C   . PHE A 1 65  ? 10.858 25.841 38.410 1.00 13.07 ? 65  PHE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1311
>ATOM   935  C CB  . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86  ? 118 GLU A CB  1 
>ATOM   508  O O   . PHE A 1 65  ? 11.811 25.531 39.121 1.00 12.50 ? 65  PHE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1312
>ATOM   936  C CG  . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64  ? 118 GLU A CG  1 
>ATOM   509  C CB  . PHE A 1 65  ? 10.829 25.731 35.922 1.00 11.31 ? 65  PHE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1313
>ATOM   937  C CD  . GLU A 1 118 ? 28.770 9.370  33.310 1.00 13.39 ? 118 GLU A CD  1 
>ATOM   510  C CG  . PHE A 1 65  ? 11.794 24.586 35.825 1.00 12.32 ? 65  PHE A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1314
>ATOM   938  O OE1 . GLU A 1 118 ? 28.036 9.043  32.355 1.00 11.90 ? 118 GLU A OE1 1 
>ATOM   511  C CD1 . PHE A 1 65  ? 11.549 23.386 36.494 1.00 10.31 ? 65  PHE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1315
>ATOM   939  O OE2 . GLU A 1 118 ? 29.956 8.998  33.405 1.00 16.59 ? 118 GLU A OE2 1 
>ATOM   512  C CD2 . PHE A 1 65  ? 12.947 24.706 35.070 1.00 11.23 ? 65  PHE A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1316
>ATOM   940  N N   . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57  ? 119 LEU A N   1 
>ATOM   513  C CE1 . PHE A 1 65  ? 12.441 22.329 36.413 1.00 11.00 ? 65  PHE A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1317
>ATOM   941  C CA  . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94  ? 119 LEU A CA  1 
>ATOM   514  C CE2 . PHE A 1 65  ? 13.847 23.645 34.984 1.00 11.69 ? 65  PHE A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1318
>ATOM   942  C C   . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29  ? 119 LEU A C   1 
>ATOM   515  C CZ  . PHE A 1 65  ? 13.593 22.461 35.655 1.00 12.20 ? 65  PHE A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1319
>ATOM   943  O O   . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23  ? 119 LEU A O   1 
>ATOM   516  N N   . LYS A 1 66  ? 9.599  25.560 38.713 1.00 13.15 ? 66  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1320
>ATOM   944  C CB  . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83  ? 119 LEU A CB  1 
>ATOM   517  C CA  . LYS A 1 66  ? 9.251  24.735 39.849 1.00 13.41 ? 66  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1321
>ATOM   945  C CG  . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54  ? 119 LEU A CG  1 
>ATOM   518  C C   . LYS A 1 66  ? 8.555  23.552 39.178 1.00 12.17 ? 66  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1322
>ATOM   946  C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 
>ATOM   519  O O   . LYS A 1 66  ? 7.763  23.747 38.251 1.00 12.93 ? 66  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1323
>ATOM   947  C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 
>ATOM   520  C CB  . LYS A 1 66  ? 8.313  25.498 40.800 1.00 16.68 ? 66  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1324
>ATOM   948  N N   . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17  ? 120 ILE A N   1 
>ATOM   521  C CG  . LYS A 1 66  ? 7.722  24.639 41.907 1.00 24.60 ? 66  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1325
>ATOM   949  C CA  . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22  ? 120 ILE A CA  1 
>ATOM   522  C CD  . LYS A 1 66  ? 7.391  25.453 43.165 1.00 28.53 ? 66  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1326
>ATOM   950  C C   . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47  ? 120 ILE A C   1 
>ATOM   523  C CE  . LYS A 1 66  ? 6.664  24.585 44.213 1.00 32.17 ? 66  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1327
>ATOM   951  O O   . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54  ? 120 ILE A O   1 
>ATOM   524  N NZ  . LYS A 1 66  ? 7.393  23.332 44.604 1.00 32.54 ? 66  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1328
>ATOM   952  C CB  . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19  ? 120 ILE A CB  1 
>ATOM   525  N N   . VAL A 1 67  ? 8.918  22.329 39.562 1.00 11.82 ? 67  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1329
>ATOM   953  C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26  ? 120 ILE A CG1 1 
>ATOM   526  C CA  . VAL A 1 67  ? 8.295  21.141 38.975 1.00 10.93 ? 67  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1330
>ATOM   954  C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54  ? 120 ILE A CG2 1 
>ATOM   527  C C   . VAL A 1 67  ? 6.783  21.174 39.226 1.00 11.97 ? 67  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1331
>ATOM   955  C CD1 . ILE A 1 120 ? 21.668 8.658  30.600 1.00 9.35  ? 120 ILE A CD1 1 
>ATOM   528  O O   . VAL A 1 67  ? 6.343  21.480 40.342 1.00 13.54 ? 67  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1332
>ATOM   956  N N   . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41  ? 121 LEU A N   1 
>ATOM   529  C CB  . VAL A 1 67  ? 8.908  19.827 39.541 1.00 10.09 ? 67  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1333
>ATOM   957  C CA  . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25  ? 121 LEU A CA  1 
>ATOM   530  C CG1 . VAL A 1 67  ? 8.271  18.617 38.883 1.00 10.96 ? 67  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1334
>ATOM   958  C C   . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41  ? 121 LEU A C   1 
>ATOM   531  C CG2 . VAL A 1 67  ? 10.410 19.808 39.320 1.00 10.21 ? 67  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1335
>ATOM   959  O O   . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01  ? 121 LEU A O   1 
>ATOM   532  N N   . GLY A 1 68  ? 6.006  20.965 38.160 1.00 9.80  ? 68  GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1336
>ATOM   960  C CB  . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37  ? 121 LEU A CB  1 
>ATOM   533  C CA  . GLY A 1 68  ? 4.557  20.962 38.265 1.00 9.33  ? 68  GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1337
>ATOM   961  C CG  . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96  ? 121 LEU A CG  1 
>ATOM   534  C C   . GLY A 1 68  ? 3.887  22.298 38.031 1.00 10.60 ? 68  GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1338
>ATOM   962  C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91  ? 121 LEU A CD1 1 
>ATOM   535  O O   . GLY A 1 68  ? 2.653  22.389 38.039 1.00 11.93 ? 68  GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1339
>ATOM   963  C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96  ? 121 LEU A CD2 1 
>ATOM   536  N N   . GLU A 1 69  ? 4.688  23.337 37.809 1.00 11.12 ? 69  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1340
>ATOM   964  N N   . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71  ? 122 THR A N   1 
>ATOM   537  C CA  . GLU A 1 69  ? 4.165  24.682 37.553 1.00 12.64 ? 69  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1341
>ATOM   965  C CA  . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80  ? 122 THR A CA  1 
>ATOM   538  C C   . GLU A 1 69  ? 4.604  25.185 36.184 1.00 13.09 ? 69  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1342
>ATOM   966  C C   . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58  ? 122 THR A C   1 
>ATOM   539  O O   . GLU A 1 69  ? 5.774  25.107 35.820 1.00 12.17 ? 69  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1343
>ATOM   967  O O   . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21  ? 122 THR A O   1 
>ATOM   540  C CB  . GLU A 1 69  ? 4.578  25.642 38.668 1.00 12.20 ? 69  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1344
>ATOM   968  C CB  . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51  ? 122 THR A CB  1 
>ATOM   541  C CG  . GLU A 1 69  ? 3.857  25.282 39.964 1.00 17.44 ? 69  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1345
>ATOM   969  O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27  ? 122 THR A OG1 1 
>ATOM   542  C CD  . GLU A 1 69  ? 4.116  26.211 41.138 1.00 21.02 ? 69  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1346
>ATOM   970  C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86  ? 122 THR A CG2 1 
>ATOM   543  O OE1 . GLU A 1 69  ? 4.496  27.384 40.945 1.00 21.43 ? 69  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1347
>ATOM   971  N N   . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87  ? 123 MET A N   1 
>ATOM   544  O OE2 . GLU A 1 69  ? 3.902  25.753 42.282 1.00 23.44 ? 69  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1348
>ATOM   972  C CA  . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22  ? 123 MET A CA  1 
>ATOM   545  N N   . GLU A 1 70  ? 3.633  25.622 35.397 1.00 14.53 ? 70  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1349
>ATOM   973  C C   . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66  ? 123 MET A C   1 
>ATOM   546  C CA  . GLU A 1 70  ? 3.912  26.102 34.059 1.00 15.80 ? 70  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1350
>ATOM   974  O O   . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09  ? 123 MET A O   1 
>ATOM   547  C C   . GLU A 1 70  ? 4.816  27.329 34.007 1.00 13.72 ? 70  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1351
>ATOM   975  C CB  . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37  ? 123 MET A CB  1 
>ATOM   548  O O   . GLU A 1 70  ? 4.761  28.208 34.863 1.00 13.66 ? 70  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1352
>ATOM   976  C CG  . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG  1 
>ATOM   549  C CB  . GLU A 1 70  ? 2.606  26.359 33.320 1.00 19.99 ? 70  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1353
>ATOM   977  S SD  . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD  1 
>ATOM   550  C CG  . GLU A 1 70  ? 2.814  26.634 31.851 1.00 28.23 ? 70  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1354
>ATOM   978  C CE  . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE  1 
>ATOM   551  C CD  . GLU A 1 70  ? 1.518  26.678 31.097 1.00 32.73 ? 70  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1355
>ATOM   979  N N   . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20  ? 124 THR A N   1 
>ATOM   552  O OE1 . GLU A 1 70  ? 0.975  25.589 30.789 1.00 35.76 ? 70  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1356
>ATOM   980  C CA  . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54  ? 124 THR A CA  1 
>ATOM   553  O OE2 . GLU A 1 70  ? 1.045  27.802 30.823 1.00 35.75 ? 70  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1357
>ATOM   981  C C   . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C   1 
>ATOM   554  N N   . PHE A 1 71  ? 5.713  27.340 33.028 1.00 12.80 ? 71  PHE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1358
>ATOM   982  O O   . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54  ? 124 THR A O   1 
>ATOM   555  C CA  . PHE A 1 71  ? 6.638  28.448 32.837 1.00 12.36 ? 71  PHE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1359
>ATOM   983  C CB  . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB  1 
>ATOM   556  C C   . PHE A 1 71  ? 6.856  28.678 31.350 1.00 12.97 ? 71  PHE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1360
>ATOM   984  O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 
>ATOM   557  O O   . PHE A 1 71  ? 6.382  27.917 30.516 1.00 12.54 ? 71  PHE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1361
>ATOM   985  C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 
>ATOM   558  C CB  . PHE A 1 71  ? 7.975  28.243 33.589 1.00 10.02 ? 71  PHE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1362
>ATOM   986  N N   . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N   1 
>ATOM   559  C CG  . PHE A 1 71  ? 8.851  27.148 33.033 1.00 10.48 ? 71  PHE A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1363
>ATOM   987  C CA  . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA  1 
>ATOM   560  C CD1 . PHE A 1 71  ? 8.549  25.815 33.256 1.00 9.95  ? 71  PHE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1364
>ATOM   988  C C   . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C   1 
>ATOM   561  C CD2 . PHE A 1 71  ? 10.006 27.459 32.331 1.00 9.29  ? 71  PHE A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1365
>ATOM   989  O O   . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O   1 
>ATOM   562  C CE1 . PHE A 1 71  ? 9.380  24.811 32.793 1.00 9.74  ? 71  PHE A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1366
>ATOM   990  C CB  . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB  1 
>ATOM   563  C CE2 . PHE A 1 71  ? 10.832 26.464 31.868 1.00 9.51  ? 71  PHE A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1367
>ATOM   991  N N   . ASP A 1 126 ? 9.664  15.754 17.216 1.00 14.63 ? 126 ASP A N   1 
>ATOM   564  C CZ  . PHE A 1 71  ? 10.518 25.136 32.102 1.00 8.47  ? 71  PHE A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1368
>ATOM   992  C CA  . ASP A 1 126 ? 8.901  14.721 16.536 1.00 17.86 ? 126 ASP A CA  1 
>ATOM   565  N N   . GLU A 1 72  ? 7.581  29.733 31.028 1.00 15.04 ? 72  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1369
>ATOM   993  C C   . ASP A 1 126 ? 9.512  13.364 16.905 1.00 18.66 ? 126 ASP A C   1 
>ATOM   566  C CA  . GLU A 1 72  ? 7.826  30.063 29.644 1.00 17.19 ? 72  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1370
>ATOM   994  O O   . ASP A 1 126 ? 9.519  13.006 18.080 1.00 19.38 ? 126 ASP A O   1 
>ATOM   567  C C   . GLU A 1 72  ? 9.323  30.036 29.357 1.00 15.53 ? 72  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1371
>ATOM   995  C CB  . ASP A 1 126 ? 8.835  14.982 15.023 1.00 18.40 ? 126 ASP A CB  1 
>ATOM   568  O O   . GLU A 1 72  ? 10.130 30.511 30.158 1.00 16.16 ? 72  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1372
>ATOM   996  C CG  . ASP A 1 126 ? 7.786  16.032 14.660 1.00 22.34 ? 126 ASP A CG  1 
>ATOM   569  C CB  . GLU A 1 72  ? 7.248  31.448 29.379 1.00 22.03 ? 72  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1373
>ATOM   997  O OD1 . ASP A 1 126 ? 6.800  16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 
>ATOM   570  C CG  . GLU A 1 72  ? 6.700  31.658 28.002 1.00 30.80 ? 72  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1374
>ATOM   998  O OD2 . ASP A 1 126 ? 7.940  16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 
>ATOM   571  C CD  . GLU A 1 72  ? 6.157  33.060 27.827 1.00 34.75 ? 72  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1375
>ATOM   999  N N   . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N   1 
>ATOM   572  O OE1 . GLU A 1 72  ? 5.014  33.309 28.276 1.00 35.88 ? 72  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1376
>ATOM   1000 C CA  . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA  1 
>ATOM   573  O OE2 . GLU A 1 72  ? 6.885  33.912 27.255 1.00 38.91 ? 72  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1377
>ATOM   1001 C C   . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C   1 
>ATOM   574  N N   . GLU A 1 73  ? 9.691  29.378 28.263 1.00 13.46 ? 73  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1378
>ATOM   1002 O O   . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O   1 
>ATOM   575  C CA  . GLU A 1 73  ? 11.088 29.302 27.836 1.00 13.89 ? 73  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1379
>ATOM   1003 C CB  . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB  1 
>ATOM   576  C C   . GLU A 1 73  ? 11.083 29.318 26.301 1.00 13.70 ? 73  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1380
>ATOM   1004 C CG  . ASP A 1 127 ? 9.043  9.450  15.880 1.00 33.21 ? 127 ASP A CG  1 
>ATOM   577  O O   . GLU A 1 73  ? 10.159 29.859 25.690 1.00 13.63 ? 73  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1381
>ATOM   1005 O OD1 . ASP A 1 127 ? 7.892  9.959  15.934 1.00 36.08 ? 127 ASP A OD1 1 
>ATOM   578  C CB  . GLU A 1 73  ? 11.780 28.032 28.379 1.00 12.63 ? 73  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1382
>ATOM   1006 O OD2 . ASP A 1 127 ? 9.318  8.308  16.318 1.00 38.35 ? 127 ASP A OD2 1 
>ATOM   579  C CG  . GLU A 1 73  ? 11.145 26.706 27.986 1.00 10.55 ? 73  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1383
>ATOM   1007 N N   . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N   1 
>ATOM   580  C CD  . GLU A 1 73  ? 11.997 25.499 28.366 1.00 8.94  ? 73  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1384
>ATOM   1008 C CA  . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA  1 
>ATOM   581  O OE1 . GLU A 1 73  ? 13.191 25.650 28.642 1.00 12.29 ? 73  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1385
>ATOM   1009 C C   . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C   1 
>ATOM   582  O OE2 . GLU A 1 73  ? 11.485 24.374 28.363 1.00 10.37 ? 73  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1386
>ATOM   1010 O O   . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74  ? 128 VAL A O   1 
>ATOM   583  N N   . GLN A 1 74  ? 12.115 28.751 25.685 1.00 13.09 ? 74  GLN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1387
>ATOM   1011 C CB  . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB  1 
>ATOM   584  C CA  . GLN A 1 74  ? 12.187 28.691 24.239 1.00 13.16 ? 74  GLN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1388
>ATOM   1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 
>ATOM   585  C C   . GLN A 1 74  ? 12.618 27.315 23.806 1.00 12.86 ? 74  GLN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1389
>ATOM   1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 
>ATOM   586  O O   . GLN A 1 74  ? 13.290 26.596 24.552 1.00 13.17 ? 74  GLN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1390
>ATOM   1014 N N   . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29  ? 129 VAL A N   1 
>ATOM   587  C CB  . GLN A 1 74  ? 13.218 29.685 23.706 1.00 15.91 ? 74  GLN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1391
>ATOM   1015 C CA  . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95  ? 129 VAL A CA  1 
>ATOM   588  C CG  . GLN A 1 74  ? 12.803 31.133 23.779 1.00 19.68 ? 74  GLN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1392
>ATOM   1016 C C   . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49  ? 129 VAL A C   1 
>ATOM   589  C CD  . GLN A 1 74  ? 13.827 32.066 23.159 1.00 21.00 ? 74  GLN A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1393
>ATOM   1017 O O   . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73  ? 129 VAL A O   1 
>ATOM   590  O OE1 . GLN A 1 74  ? 15.010 31.730 23.024 1.00 22.37 ? 74  GLN A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1394
>ATOM   1018 C CB  . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43  ? 129 VAL A CB  1 
>ATOM   591  N NE2 . GLN A 1 74  ? 13.373 33.247 22.774 1.00 24.07 ? 74  GLN A NE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1395
>ATOM   1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09  ? 129 VAL A CG1 1 
>ATOM   592  N N   . THR A 1 75  ? 12.229 26.935 22.600 1.00 10.98 ? 75  THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1396
>ATOM   1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45  ? 129 VAL A CG2 1 
>ATOM   593  C CA  . THR A 1 75  ? 12.664 25.656 22.056 1.00 11.83 ? 75  THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1397
>ATOM   1021 N N   . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54  ? 130 CYS A N   1 
>ATOM   594  C C   . THR A 1 75  ? 14.162 25.828 21.729 1.00 11.24 ? 75  THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1398
>ATOM   1022 C CA  . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47  ? 130 CYS A CA  1 
>ATOM   595  O O   . THR A 1 75  ? 14.681 26.951 21.764 1.00 9.95  ? 75  THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1399
>ATOM   1023 C C   . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61  ? 130 CYS A C   1 
>ATOM   596  C CB  . THR A 1 75  ? 11.895 25.325 20.757 1.00 11.93 ? 75  THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1400
>ATOM   1024 O O   . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53  ? 130 CYS A O   1 
>ATOM   597  O OG1 . THR A 1 75  ? 12.123 26.366 19.795 1.00 13.31 ? 75  THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1401
>ATOM   1025 C CB  . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05  ? 130 CYS A CB  1 
>ATOM   598  C CG2 . THR A 1 75  ? 10.396 25.202 21.042 1.00 13.29 ? 75  THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1402
>ATOM   1026 S SG  . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82  ? 130 CYS A SG  1 
>ATOM   599  N N   . VAL A 1 76  ? 14.841 24.731 21.377 1.00 13.77 ? 76  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1403
>ATOM   1027 N N   . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58  ? 131 THR A N   1 
>ATOM   600  C CA  . VAL A 1 76  ? 16.278 24.762 21.049 1.00 14.39 ? 76  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1404
>ATOM   1028 C CA  . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93  ? 131 THR A CA  1 
>ATOM   601  C C   . VAL A 1 76  ? 16.612 25.734 19.914 1.00 12.97 ? 76  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1405
>ATOM   1029 C C   . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18  ? 131 THR A C   1 
>ATOM   602  O O   . VAL A 1 76  ? 17.639 26.407 19.956 1.00 13.75 ? 76  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1406
>ATOM   1030 O O   . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77  ? 131 THR A O   1 
>ATOM   603  C CB  . VAL A 1 76  ? 16.827 23.351 20.680 1.00 15.44 ? 76  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1407
>ATOM   1031 C CB  . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63  ? 131 THR A CB  1 
>ATOM   604  C CG1 . VAL A 1 76  ? 18.332 23.314 20.844 1.00 17.74 ? 76  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1408
>ATOM   1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60  ? 131 THR A OG1 1 
>ATOM   605  C CG2 . VAL A 1 76  ? 16.218 22.293 21.548 1.00 19.99 ? 76  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1409
>ATOM   1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76  ? 131 THR A CG2 1 
>ATOM   606  N N   . ASP A 1 77  ? 15.730 25.824 18.921 1.00 13.67 ? 77  ASP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1410
>ATOM   1034 N N   . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29  ? 132 ARG A N   1 
>ATOM   607  C CA  . ASP A 1 77  ? 15.933 26.727 17.789 1.00 14.47 ? 77  ASP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1411
>ATOM   1035 C CA  . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67  ? 132 ARG A CA  1 
>ATOM   608  C C   . ASP A 1 77  ? 15.486 28.172 18.061 1.00 15.23 ? 77  ASP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1412
>ATOM   1036 C C   . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19  ? 132 ARG A C   1 
>ATOM   609  O O   . ASP A 1 77  ? 15.461 29.002 17.153 1.00 14.90 ? 77  ASP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1413
>ATOM   1037 O O   . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65  ? 132 ARG A O   1 
>ATOM   610  C CB  . ASP A 1 77  ? 15.301 26.158 16.503 1.00 15.63 ? 77  ASP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1414
>ATOM   1038 C CB  . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67  ? 132 ARG A CB  1 
>ATOM   611  C CG  . ASP A 1 77  ? 13.790 26.007 16.585 1.00 15.92 ? 77  ASP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1415
>ATOM   1039 C CG  . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG  1 
>ATOM   612  O OD1 . ASP A 1 77  ? 13.260 25.470 17.586 1.00 14.64 ? 77  ASP A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1416
>ATOM   1040 C CD  . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD  1 
>ATOM   613  O OD2 . ASP A 1 77  ? 13.123 26.409 15.613 1.00 17.79 ? 77  ASP A OD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1417
>ATOM   1041 N NE  . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE  1 
>ATOM   614  N N   . GLY A 1 78  ? 15.095 28.445 19.312 1.00 15.17 ? 78  GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1418
>ATOM   1042 C CZ  . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ  1 
>ATOM   615  C CA  . GLY A 1 78  ? 14.709 29.790 19.726 1.00 15.90 ? 78  GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1419
>ATOM   1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 
>ATOM   616  C C   . GLY A 1 78  ? 13.268 30.281 19.701 1.00 16.89 ? 78  GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1420
>ATOM   1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 
>ATOM   617  O O   . GLY A 1 78  ? 13.038 31.489 19.790 1.00 19.37 ? 78  GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1421
>ATOM   1045 N N   . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99  ? 133 VAL A N   1 
>ATOM   618  N N   . ARG A 1 79  ? 12.292 29.389 19.620 1.00 16.76 ? 79  ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1422
>ATOM   1046 C CA  . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92  ? 133 VAL A CA  1 
>ATOM   619  C CA  . ARG A 1 79  ? 10.896 29.822 19.587 1.00 18.08 ? 79  ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1423
>ATOM   1047 C C   . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85  ? 133 VAL A C   1 
>ATOM   620  C C   . ARG A 1 79  ? 10.229 29.768 20.961 1.00 16.55 ? 79  ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1424
>ATOM   1048 O O   . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50  ? 133 VAL A O   1 
>ATOM   621  O O   . ARG A 1 79  ? 10.379 28.787 21.680 1.00 16.57 ? 79  ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1425
>ATOM   1049 C CB  . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37  ? 133 VAL A CB  1 
>ATOM   622  C CB  . ARG A 1 79  ? 10.112 28.961 18.604 1.00 20.74 ? 79  ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1426
>ATOM   1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95  ? 133 VAL A CG1 1 
>ATOM   623  C CG  . ARG A 1 79  ? 10.667 28.997 17.194 1.00 25.89 ? 79  ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1427
>ATOM   1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46  ? 133 VAL A CG2 1 
>ATOM   624  C CD  . ARG A 1 79  ? 9.986  27.976 16.310 1.00 29.77 ? 79  ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1428
>ATOM   1052 N N   . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35  ? 134 TYR A N   1 
>ATOM   625  N NE  . ARG A 1 79  ? 10.144 26.626 16.842 1.00 34.52 ? 79  ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1429
>ATOM   1053 C CA  . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57  ? 134 TYR A CA  1 
>ATOM   626  C CZ  . ARG A 1 79  ? 10.128 25.516 16.109 1.00 35.90 ? 79  ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1430
>ATOM   1054 C C   . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30  ? 134 TYR A C   1 
>ATOM   627  N NH1 . ARG A 1 79  ? 9.971  25.580 14.789 1.00 37.70 ? 79  ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1431
>ATOM   1055 O O   . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92  ? 134 TYR A O   1 
>ATOM   628  N NH2 . ARG A 1 79  ? 10.266 24.337 16.702 1.00 35.58 ? 79  ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1432
>ATOM   1056 C CB  . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84  ? 134 TYR A CB  1 
>ATOM   629  N N   . PRO A 1 80  ? 9.501  30.830 21.352 1.00 15.98 ? 80  PRO A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1433
>ATOM   1057 C CG  . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89  ? 134 TYR A CG  1 
>ATOM   630  C CA  . PRO A 1 80  ? 8.819  30.867 22.651 1.00 15.47 ? 80  PRO A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1434
>ATOM   1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 
>ATOM   631  C C   . PRO A 1 80  ? 7.825  29.725 22.833 1.00 14.23 ? 80  PRO A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1435
>ATOM   1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 
>ATOM   632  O O   . PRO A 1 80  ? 7.058  29.393 21.926 1.00 14.56 ? 80  PRO A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1436
>ATOM   1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 
>ATOM   633  C CB  . PRO A 1 80  ? 8.100  32.220 22.628 1.00 15.48 ? 80  PRO A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1437
>ATOM   1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 
>ATOM   634  C CG  . PRO A 1 80  ? 9.010  33.057 21.846 1.00 18.18 ? 80  PRO A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1438
>ATOM   1062 C CZ  . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ  1 
>ATOM   635  C CD  . PRO A 1 80  ? 9.418  32.145 20.696 1.00 17.08 ? 80  PRO A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1439
>ATOM   1063 O OH  . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH  1 
>ATOM   636  N N   . CYS A 1 81  ? 7.817  29.148 24.028 1.00 13.52 ? 81  CYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1440
>ATOM   1064 N N   . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63  ? 135 VAL A N   1 
>ATOM   637  C CA  . CYS A 1 81  ? 6.914  28.055 24.331 1.00 12.41 ? 81  CYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1441
>ATOM   1065 C CA  . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42  ? 135 VAL A CA  1 
>ATOM   638  C C   . CYS A 1 81  ? 6.548  28.054 25.811 1.00 12.52 ? 81  CYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1442
>ATOM   1066 C C   . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05  ? 135 VAL A C   1 
>ATOM   639  O O   . CYS A 1 81  ? 7.202  28.718 26.624 1.00 11.74 ? 81  CYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1443
>ATOM   1067 O O   . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02  ? 135 VAL A O   1 
>ATOM   640  C CB  . CYS A 1 81  ? 7.563  26.705 23.950 1.00 11.59 ? 81  CYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1444
>ATOM   1068 C CB  . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05  ? 135 VAL A CB  1 
>ATOM   641  S SG  . CYS A 1 81  ? 9.063  26.255 24.894 1.00 12.86 ? 81  CYS A SG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1445
>ATOM   1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27  ? 135 VAL A CG1 1 
>ATOM   642  N N   . LYS A 1 82  ? 5.448  27.379 26.121 1.00 13.86 ? 82  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1446
>ATOM   1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 
>ATOM   643  C CA  . LYS A 1 82  ? 4.988  27.197 27.492 1.00 14.38 ? 82  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1447
>ATOM   1071 N N   . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57  ? 136 ARG A N   1 
>ATOM   644  C C   . LYS A 1 82  ? 5.436  25.779 27.839 1.00 13.51 ? 82  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1448
>ATOM   1072 C CA  . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA  1 
>ATOM   645  O O   . LYS A 1 82  ? 5.227  24.842 27.063 1.00 12.69 ? 82  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1449
>ATOM   1073 C C   . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C   1 
>ATOM   646  C CB  . LYS A 1 82  ? 3.473  27.299 27.589 1.00 18.36 ? 82  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1450
>ATOM   1074 O O   . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O   1 
>ATOM   647  C CG  . LYS A 1 82  ? 2.940  28.716 27.584 1.00 26.02 ? 82  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1451
>ATOM   1075 C CB  . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB  1 
>ATOM   648  C CD  . LYS A 1 82  ? 3.353  29.506 28.826 1.00 31.13 ? 82  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1452
>ATOM   1076 C CG  . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG  1 
>ATOM   649  C CE  . LYS A 1 82  ? 2.686  30.894 28.832 1.00 35.39 ? 82  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1453
>ATOM   1077 C CD  . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD  1 
>ATOM   650  N NZ  . LYS A 1 82  ? 2.868  31.652 30.120 1.00 37.63 ? 82  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1454
>ATOM   1078 N NE  . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE  1 
>ATOM   651  N N   . SER A 1 83  ? 6.110  25.638 28.974 1.00 11.15 ? 83  SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1455
>ATOM   1079 C CZ  . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ  1 
>ATOM   652  C CA  . SER A 1 83  ? 6.624  24.352 29.397 1.00 10.10 ? 83  SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1456
>ATOM   1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 
>ATOM   653  C C   . SER A 1 83  ? 6.083  23.931 30.752 1.00 11.16 ? 83  SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1457
>ATOM   1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 
>ATOM   654  O O   . SER A 1 83  ? 5.721  24.769 31.575 1.00 10.21 ? 83  SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1458
>ATOM   1082 N N   . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N   1 
>ATOM   655  C CB  . SER A 1 83  ? 8.149  24.418 29.446 1.00 10.30 ? 83  SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1459
>ATOM   1083 C CA  . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA  1 
>ATOM   656  O OG  . SER A 1 83  ? 8.686  24.518 28.132 1.00 11.50 ? 83  SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1460
>ATOM   1084 C C   . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C   1 
>ATOM   657  N N   . LEU A 1 84  ? 6.028  22.620 30.954 1.00 11.17 ? 84  LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1461
>ATOM   1085 O O   . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O   1 
>ATOM   658  C CA  . LEU A 1 84  ? 5.557  22.016 32.192 1.00 11.84 ? 84  LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1462
>ATOM   1086 C CB  . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB  1 
>ATOM   659  C C   . LEU A 1 84  ? 6.427  20.793 32.470 1.00 10.42 ? 84  LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1463
>ATOM   1087 C CG  . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG  1 
>ATOM   660  O O   . LEU A 1 84  ? 6.444  19.846 31.684 1.00 11.20 ? 84  LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1464
>ATOM   1088 C CD  . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD  1 
>ATOM   661  C CB  . LEU A 1 84  ? 4.091  21.576 32.067 1.00 13.44 ? 84  LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1465
>ATOM   1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 
>ATOM   662  C CG  . LEU A 1 84  ? 3.552  20.784 33.270 1.00 15.74 ? 84  LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1466
>ATOM   1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 
>ATOM   663  C CD1 . LEU A 1 84  ? 3.515  21.683 34.484 1.00 16.96 ? 84  LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1467
>ATOM   1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 
>ATOM   664  C CD2 . LEU A 1 84  ? 2.178  20.231 32.982 1.00 18.76 ? 84  LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1468
>HETATM 1092 C C1  . REA B 2 .   ? 21.972 29.831 16.739 1.00 15.25 ? 200 REA A C1  1 
>ATOM   665  N N   . VAL A 1 85  ? 7.146  20.828 33.589 1.00 9.60  ? 85  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1469
>HETATM 1093 C C2  . REA B 2 .   ? 20.921 30.524 15.841 1.00 15.61 ? 200 REA A C2  1 
>ATOM   666  C CA  . VAL A 1 85  ? 8.028  19.738 34.006 1.00 9.50  ? 85  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1470
>HETATM 1094 C C3  . REA B 2 .   ? 20.245 29.635 14.848 1.00 16.19 ? 200 REA A C3  1 
>ATOM   667  C C   . VAL A 1 85  ? 7.344  18.878 35.082 1.00 9.74  ? 85  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1471
>HETATM 1095 C C4  . REA B 2 .   ? 19.555 28.479 15.488 1.00 14.59 ? 200 REA A C4  1 
>ATOM   668  O O   . VAL A 1 85  ? 6.680  19.404 35.985 1.00 9.28  ? 85  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1472
>HETATM 1096 C C5  . REA B 2 .   ? 20.389 27.812 16.587 1.00 14.10 ? 200 REA A C5  1 
>ATOM   669  C CB  . VAL A 1 85  ? 9.384  20.291 34.598 1.00 8.89  ? 85  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1473
>HETATM 1097 C C6  . REA B 2 .   ? 21.425 28.446 17.218 1.00 14.42 ? 200 REA A C6  1 
>ATOM   670  C CG1 . VAL A 1 85  ? 10.327 19.140 34.970 1.00 8.20  ? 85  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1474
>HETATM 1098 C C7  . REA B 2 .   ? 22.242 27.851 18.297 1.00 13.89 ? 200 REA A C7  1 
>ATOM   671  C CG2 . VAL A 1 85  ? 10.062 21.227 33.612 1.00 8.48  ? 85  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1475
>HETATM 1099 C C8  . REA B 2 .   ? 21.868 26.977 19.240 1.00 11.86 ? 200 REA A C8  1 
>ATOM   672  N N   . LYS A 1 86  ? 7.504  17.563 34.971 1.00 9.96  ? 86  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1476
>HETATM 1100 C C9  . REA B 2 .   ? 22.705 26.434 20.286 1.00 10.87 ? 200 REA A C9  1 
>ATOM   673  C CA  . LYS A 1 86  ? 6.946  16.621 35.945 1.00 11.92 ? 86  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1477
>HETATM 1101 C C10 . REA B 2 .   ? 22.159 25.536 21.131 1.00 9.19  ? 200 REA A C10 1 
>ATOM   674  C C   . LYS A 1 86  ? 8.003  15.558 36.247 1.00 11.88 ? 86  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1478
>HETATM 1102 C C11 . REA B 2 .   ? 22.875 24.924 22.234 1.00 10.35 ? 200 REA A C11 1 
>ATOM   675  O O   . LYS A 1 86  ? 8.917  15.340 35.453 1.00 11.00 ? 86  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1479
>HETATM 1103 C C12 . REA B 2 .   ? 22.237 24.026 22.990 1.00 10.53 ? 200 REA A C12 1 
>ATOM   676  C CB  . LYS A 1 86  ? 5.700  15.911 35.385 1.00 12.40 ? 86  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1480
>HETATM 1104 C C13 . REA B 2 .   ? 22.856 23.377 24.125 1.00 10.91 ? 200 REA A C13 1 
>ATOM   677  C CG  . LYS A 1 86  ? 4.538  16.819 35.058 1.00 16.01 ? 86  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1481
>HETATM 1105 C C14 . REA B 2 .   ? 22.135 22.473 24.834 1.00 11.88 ? 200 REA A C14 1 
>ATOM   678  C CD  . LYS A 1 86  ? 3.333  16.017 34.559 1.00 21.36 ? 86  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1482
>HETATM 1106 C C15 . REA B 2 .   ? 22.563 21.710 26.016 1.00 14.86 ? 200 REA A C15 1 
>ATOM   679  C CE  . LYS A 1 86  ? 2.140  16.939 34.345 1.00 23.23 ? 86  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1483
>HETATM 1107 C C16 . REA B 2 .   ? 22.238 30.737 17.948 1.00 15.47 ? 200 REA A C16 1 
>ATOM   680  N NZ  . LYS A 1 86  ? 0.919  16.212 33.929 1.00 28.41 ? 86  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1484
>HETATM 1108 C C17 . REA B 2 .   ? 23.292 29.620 15.948 1.00 13.42 ? 200 REA A C17 1 
>ATOM   681  N N   . TRP A 1 87  ? 7.868  14.889 37.386 1.00 10.75 ? 87  TRP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1485
>HETATM 1109 C C18 . REA B 2 .   ? 19.791 26.449 16.947 1.00 12.61 ? 200 REA A C18 1 
>ATOM   682  C CA  . TRP A 1 87  ? 8.775  13.811 37.738 1.00 9.53  ? 87  TRP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1486
>HETATM 1110 C C19 . REA B 2 .   ? 24.181 26.841 20.385 1.00 10.08 ? 200 REA A C19 1 
>ATOM   683  C C   . TRP A 1 87  ? 8.238  12.559 37.052 1.00 9.89  ? 87  TRP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1487
>HETATM 1111 C C20 . REA B 2 .   ? 24.303 23.747 24.489 1.00 10.10 ? 200 REA A C20 1 
>ATOM   684  O O   . TRP A 1 87  ? 7.144  12.107 37.370 1.00 11.80 ? 87  TRP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1488
>HETATM 1112 O O1  . REA B 2 .   ? 23.640 21.075 25.978 1.00 13.29 ? 200 REA A O1  1 
>ATOM   685  C CB  . TRP A 1 87  ? 8.791  13.569 39.268 1.00 8.76  ? 87  TRP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1489
>HETATM 1113 O O2  . REA B 2 .   ? 21.840 21.712 27.037 1.00 10.99 ? 200 REA A O2  1 
>ATOM   686  C CG  . TRP A 1 87  ? 9.494  14.641 40.062 1.00 8.86  ? 87  TRP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1490
>HETATM 1114 O O   . HOH C 3 .   ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O   1 
>ATOM   687  C CD1 . TRP A 1 87  ? 8.923  15.525 40.939 1.00 8.80  ? 87  TRP A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1491
>HETATM 1115 O O   . HOH C 3 .   ? 7.617  26.892 37.107 1.00 12.66 ? 301 HOH A O   1 
>ATOM   688  C CD2 . TRP A 1 87  ? 10.889 14.990 39.992 1.00 9.42  ? 87  TRP A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1492
>HETATM 1116 O O   . HOH C 3 .   ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O   1 
>ATOM   689  N NE1 . TRP A 1 87  ? 9.872  16.410 41.400 1.00 8.01  ? 87  TRP A NE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1493
>HETATM 1117 O O   . HOH C 3 .   ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O   1 
>ATOM   690  C CE2 . TRP A 1 87  ? 11.086 16.103 40.835 1.00 10.85 ? 87  TRP A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1494
>HETATM 1118 O O   . HOH C 3 .   ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O   1 
>ATOM   691  C CE3 . TRP A 1 87  ? 11.985 14.475 39.283 1.00 9.60  ? 87  TRP A CE3 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1495
>HETATM 1119 O O   . HOH C 3 .   ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O   1 
>ATOM   692  C CZ2 . TRP A 1 87  ? 12.340 16.716 40.994 1.00 11.45 ? 87  TRP A CZ2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1496
>HETATM 1120 O O   . HOH C 3 .   ? 19.459 26.601 30.320 1.00 9.81  ? 306 HOH A O   1 
>ATOM   693  C CZ3 . TRP A 1 87  ? 13.230 15.084 39.438 1.00 10.72 ? 87  TRP A CZ3 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1497
>HETATM 1121 O O   . HOH C 3 .   ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O   1 
>ATOM   694  C CH2 . TRP A 1 87  ? 13.395 16.192 40.289 1.00 11.78 ? 87  TRP A CH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1498
>HETATM 1122 O O   . HOH C 3 .   ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O   1 
>ATOM   695  N N   . GLU A 1 88  ? 8.954  12.040 36.064 1.00 9.93  ? 88  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1499
>HETATM 1123 O O   . HOH C 3 .   ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O   1 
>ATOM   696  C CA  . GLU A 1 88  ? 8.526  10.807 35.416 1.00 11.30 ? 88  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1500
>HETATM 1124 O O   . HOH C 3 .   ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O   1 
>ATOM   697  C C   . GLU A 1 88  ? 8.826  9.726  36.448 1.00 11.75 ? 88  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1501
>HETATM 1125 O O   . HOH C 3 .   ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O   1 
>ATOM   698  O O   . GLU A 1 88  ? 8.068  8.784  36.623 1.00 12.78 ? 88  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1502
>HETATM 1126 O O   . HOH C 3 .   ? 7.344  23.059 35.600 1.00 8.82  ? 312 HOH A O   1 
>ATOM   699  C CB  . GLU A 1 88  ? 9.337  10.541 34.156 1.00 13.50 ? 88  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1503
>HETATM 1127 O O   . HOH C 3 .   ? 6.876  22.668 20.375 1.00 29.74 ? 313 HOH A O   1 
>ATOM   700  C CG  . GLU A 1 88  ? 8.917  9.261  33.454 1.00 18.67 ? 88  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1504
>HETATM 1128 O O   . HOH C 3 .   ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O   1 
>ATOM   701  C CD  . GLU A 1 88  ? 9.756  8.958  32.226 1.00 23.49 ? 88  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1505
>HETATM 1129 O O   . HOH C 3 .   ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O   1 
>ATOM   702  O OE1 . GLU A 1 88  ? 9.581  9.650  31.205 1.00 26.53 ? 88  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1506
>HETATM 1130 O O   . HOH C 3 .   ? 28.721 7.425  30.043 1.00 14.94 ? 316 HOH A O   1 
>ATOM   703  O OE2 . GLU A 1 88  ? 10.587 8.025  32.276 1.00 26.54 ? 88  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1507
>HETATM 1131 O O   . HOH C 3 .   ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O   1 
>ATOM   704  N N   . SER A 1 89  ? 9.972  9.870  37.103 1.00 11.49 ? 89  SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1508
>HETATM 1132 O O   . HOH C 3 .   ? 6.094  9.777  39.151 1.00 13.98 ? 318 HOH A O   1 
>ATOM   705  C CA  . SER A 1 89  ? 10.402 8.954  38.158 1.00 11.10 ? 89  SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1509
>HETATM 1133 O O   . HOH C 3 .   ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O   1 
>ATOM   706  C C   . SER A 1 89  ? 11.206 9.776  39.163 1.00 11.14 ? 89  SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1510
>HETATM 1134 O O   . HOH C 3 .   ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O   1 
>ATOM   707  O O   . SER A 1 89  ? 11.397 10.983 38.979 1.00 9.92  ? 89  SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1511
>HETATM 1135 O O   . HOH C 3 .   ? 25.244 34.269 18.193 1.00 9.65  ? 321 HOH A O   1 
>ATOM   708  C CB  . SER A 1 89  ? 11.221 7.778  37.604 1.00 12.43 ? 89  SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1512
>HETATM 1136 O O   . HOH C 3 .   ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O   1 
>ATOM   709  O OG  . SER A 1 89  ? 12.396 8.215  36.947 1.00 14.39 ? 89  SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1513
>HETATM 1137 O O   . HOH C 3 .   ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O   1 
>ATOM   710  N N   . GLU A 1 90  ? 11.674 9.130  40.227 1.00 10.17 ? 90  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1514
>HETATM 1138 O O   . HOH C 3 .   ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O   1 
>ATOM   711  C CA  . GLU A 1 90  ? 12.433 9.826  41.254 1.00 10.83 ? 90  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1515
>HETATM 1139 O O   . HOH C 3 .   ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O   1 
>ATOM   712  C C   . GLU A 1 90  ? 13.657 10.629 40.772 1.00 9.86  ? 90  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1516
>HETATM 1140 O O   . HOH C 3 .   ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O   1 
>ATOM   713  O O   . GLU A 1 90  ? 13.932 11.715 41.289 1.00 10.30 ? 90  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1517
>HETATM 1141 O O   . HOH C 3 .   ? 4.514  21.426 18.685 1.00 45.94 ? 327 HOH A O   1 
>ATOM   714  C CB  . GLU A 1 90  ? 12.858 8.846  42.348 1.00 11.92 ? 90  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1518
>HETATM 1142 O O   . HOH C 3 .   ? 8.081  23.201 17.690 1.00 30.16 ? 328 HOH A O   1 
>ATOM   715  C CG  . GLU A 1 90  ? 13.536 9.572  43.487 1.00 16.53 ? 90  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1519
>HETATM 1143 O O   . HOH C 3 .   ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O   1 
>ATOM   716  C CD  . GLU A 1 90  ? 13.912 8.671  44.644 1.00 19.80 ? 90  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1520
>HETATM 1144 O O   . HOH C 3 .   ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O   1 
>ATOM   717  O OE1 . GLU A 1 90  ? 14.122 7.464  44.426 1.00 21.18 ? 90  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1521
>HETATM 1145 O O   . HOH C 3 .   ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O   1 
>ATOM   718  O OE2 . GLU A 1 90  ? 14.012 9.187  45.774 1.00 22.91 ? 90  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1522
>HETATM 1146 O O   . HOH C 3 .   ? 5.189  16.418 31.375 1.00 35.78 ? 332 HOH A O   1 
>ATOM   719  N N   . ASN A 1 91  ? 14.376 10.102 39.783 1.00 8.79  ? 91  ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1523
>HETATM 1147 O O   . HOH C 3 .   ? 0.738  25.633 36.349 1.00 29.00 ? 333 HOH A O   1 
>ATOM   720  C CA  . ASN A 1 91  ? 15.578 10.767 39.274 1.00 10.50 ? 91  ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1524
>HETATM 1148 O O   . HOH C 3 .   ? 2.976  28.966 37.321 1.00 40.14 ? 334 HOH A O   1 
>ATOM   721  C C   . ASN A 1 91  ? 15.455 11.289 37.855 1.00 9.69  ? 91  ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1525
>HETATM 1149 O O   . HOH C 3 .   ? 6.424  28.750 38.849 1.00 32.17 ? 335 HOH A O   1 
>ATOM   722  O O   . ASN A 1 91  ? 16.467 11.627 37.246 1.00 7.10  ? 91  ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1526
>HETATM 1150 O O   . HOH C 3 .   ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O   1 
>ATOM   723  C CB  . ASN A 1 91  ? 16.760 9.798  39.305 1.00 14.33 ? 91  ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1527
>HETATM 1151 O O   . HOH C 3 .   ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O   1 
>ATOM   724  C CG  . ASN A 1 91  ? 17.064 9.307  40.693 1.00 17.71 ? 91  ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1528
>HETATM 1152 O O   . HOH C 3 .   ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O   1 
>ATOM   725  O OD1 . ASN A 1 91  ? 17.445 10.087 41.560 1.00 20.87 ? 91  ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1529
>HETATM 1153 O O   . HOH C 3 .   ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O   1 
>ATOM   726  N ND2 . ASN A 1 91  ? 16.855 8.016  40.928 1.00 19.39 ? 91  ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1530
>HETATM 1154 O O   . HOH C 3 .   ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O   1 
>ATOM   727  N N   . LYS A 1 92  ? 14.230 11.387 37.352 1.00 8.60  ? 92  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1531
>HETATM 1155 O O   . HOH C 3 .   ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O   1 
>ATOM   728  C CA  . LYS A 1 92  ? 14.016 11.835 35.981 1.00 8.88  ? 92  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1532
>HETATM 1156 O O   . HOH C 3 .   ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O   1 
>ATOM   729  C C   . LYS A 1 92  ? 12.861 12.812 35.807 1.00 8.61  ? 92  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1533
>HETATM 1157 O O   . HOH C 3 .   ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O   1 
>ATOM   730  O O   . LYS A 1 92  ? 11.721 12.511 36.168 1.00 8.95  ? 92  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1534
>HETATM 1158 O O   . HOH C 3 .   ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O   1 
>ATOM   731  C CB  . LYS A 1 92  ? 13.781 10.626 35.078 1.00 9.10  ? 92  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1535
>HETATM 1159 O O   . HOH C 3 .   ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O   1 
>ATOM   732  C CG  . LYS A 1 92  ? 13.566 10.996 33.618 1.00 11.95 ? 92  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1536
>HETATM 1160 O O   . HOH C 3 .   ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O   1 
>ATOM   733  C CD  . LYS A 1 92  ? 13.467 9.762  32.759 1.00 14.04 ? 92  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1537
>HETATM 1161 O O   . HOH C 3 .   ? 3.502  22.911 43.083 1.00 30.15 ? 347 HOH A O   1 
>ATOM   734  C CE  . LYS A 1 92  ? 13.333 10.124 31.299 1.00 16.33 ? 92  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1538
>HETATM 1162 O O   . HOH C 3 .   ? 20.610 7.668  40.212 1.00 49.06 ? 348 HOH A O   1 
>ATOM   735  N NZ  . LYS A 1 92  ? 13.129 8.884  30.506 1.00 17.37 ? 92  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1539
>HETATM 1163 O O   . HOH C 3 .   ? 24.813 2.899  36.403 1.00 48.98 ? 349 HOH A O   1 
>ATOM   736  N N   . MET A 1 93  ? 13.172 13.988 35.268 1.00 7.58  ? 93  MET A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1540
>HETATM 1164 O O   . HOH C 3 .   ? 29.900 5.163  26.918 1.00 23.60 ? 350 HOH A O   1 
>ATOM   737  C CA  . MET A 1 93  ? 12.159 14.985 34.995 1.00 8.21  ? 93  MET A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1541
>HETATM 1165 O O   . HOH C 3 .   ? 14.333 5.466  42.757 1.00 22.90 ? 351 HOH A O   1 
>ATOM   738  C C   . MET A 1 93  ? 11.915 15.038 33.496 1.00 9.18  ? 93  MET A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1542
>HETATM 1166 O O   . HOH C 3 .   ? 8.914  5.771  35.515 1.00 35.92 ? 352 HOH A O   1 
>ATOM   739  O O   . MET A 1 93  ? 12.833 14.838 32.690 1.00 7.74  ? 93  MET A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1543
>HETATM 1167 O O   . HOH C 3 .   ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O   1 
>ATOM   740  C CB  . MET A 1 93  ? 12.565 16.359 35.523 1.00 9.68  ? 93  MET A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1544
>HETATM 1168 O O   . HOH C 3 .   ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O   1 
>ATOM   741  C CG  . MET A 1 93  ? 13.826 16.925 34.937 1.00 13.16 ? 93  MET A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1545
>HETATM 1169 O O   . HOH C 3 .   ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O   1 
>ATOM   742  S SD  . MET A 1 93  ? 14.238 18.543 35.628 1.00 17.49 ? 93  MET A SD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1546
>HETATM 1170 O O   . HOH C 3 .   ? 12.491 24.840 7.594  1.00 39.45 ? 356 HOH A O   1 
>ATOM   743  C CE  . MET A 1 93  ? 15.009 18.106 37.076 1.00 18.53 ? 93  MET A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1547
>HETATM 1171 O O   . HOH C 3 .   ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O   1 
>ATOM   744  N N   . VAL A 1 94  ? 10.658 15.239 33.128 1.00 9.48  ? 94  VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1548
>HETATM 1172 O O   . HOH C 3 .   ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O   1 
>ATOM   745  C CA  . VAL A 1 94  ? 10.266 15.334 31.726 1.00 9.55  ? 94  VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1549
>HETATM 1173 O O   . HOH C 3 .   ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O   1 
>ATOM   746  C C   . VAL A 1 94  ? 9.516  16.639 31.528 1.00 10.10 ? 94  VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1550
>HETATM 1174 O O   . HOH C 3 .   ? 11.358 8.880  19.119 1.00 24.31 ? 360 HOH A O   1 
>ATOM   747  O O   . VAL A 1 94  ? 8.683  17.024 32.364 1.00 9.47  ? 94  VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1551
>HETATM 1175 O O   . HOH C 3 .   ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O   1 
>ATOM   748  C CB  . VAL A 1 94  ? 9.371  14.164 31.315 1.00 11.05 ? 94  VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1552
>HETATM 1176 O O   . HOH C 3 .   ? 22.049 27.870 4.565  1.00 25.37 ? 362 HOH A O   1 
>ATOM   749  C CG1 . VAL A 1 94  ? 8.878  14.354 29.878 1.00 12.88 ? 94  VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1553
>HETATM 1177 O O   . HOH C 3 .   ? 11.533 6.689  34.501 1.00 29.92 ? 363 HOH A O   1 
>ATOM   750  C CG2 . VAL A 1 94  ? 10.147 12.866 31.420 1.00 14.00 ? 94  VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1554
>HETATM 1178 O O   . HOH C 3 .   ? 13.269 4.551  36.338 1.00 45.75 ? 364 HOH A O   1 
>ATOM   751  N N   . CYS A 1 95  ? 9.802  17.312 30.413 1.00 9.49  ? 95  CYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1555
>HETATM 1179 O O   . HOH C 3 .   ? 23.149 9.493  41.173 1.00 30.10 ? 365 HOH A O   1 
>ATOM   752  C CA  . CYS A 1 95  ? 9.169  18.582 30.094 1.00 8.82  ? 95  CYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1556
>HETATM 1180 O O   . HOH C 3 .   ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O   1 
>ATOM   753  C C   . CYS A 1 95  ? 8.431  18.559 28.758 1.00 11.70 ? 95  CYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1557
>HETATM 1181 O O   . HOH C 3 .   ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O   1 
>ATOM   754  O O   . CYS A 1 95  ? 9.014  18.215 27.723 1.00 12.29 ? 95  CYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1558
>HETATM 1182 O O   . HOH C 3 .   ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O   1 
>ATOM   755  C CB  . CYS A 1 95  ? 10.229 19.679 30.059 1.00 8.79  ? 95  CYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1559
>HETATM 1183 O O   . HOH C 3 .   ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O   1 
>ATOM   756  S SG  . CYS A 1 95  ? 9.620  21.322 29.690 1.00 10.97 ? 95  CYS A SG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1560
>HETATM 1184 O O   . HOH C 3 .   ? 31.928 9.444  23.294 1.00 46.07 ? 370 HOH A O   1 
>ATOM   757  N N   . GLU A 1 96  ? 7.149  18.902 28.791 1.00 10.87 ? 96  GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1561
>HETATM 1185 O O   . HOH C 3 .   ? 25.699 10.933 9.557  1.00 44.12 ? 371 HOH A O   1 
>ATOM   758  C CA  . GLU A 1 96  ? 6.342  18.962 27.587 1.00 14.78 ? 96  GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1562
>HETATM 1186 O O   . HOH C 3 .   ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O   1 
>ATOM   759  C C   . GLU A 1 96  ? 6.267  20.439 27.182 1.00 13.83 ? 96  GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1563
>HETATM 1187 O O   . HOH C 3 .   ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O   1 
>ATOM   760  O O   . GLU A 1 96  ? 6.044  21.311 28.030 1.00 12.79 ? 96  GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1564
>HETATM 1188 O O   . HOH C 3 .   ? 20.596 32.070 6.807  1.00 36.38 ? 374 HOH A O   1 
>ATOM   761  C CB  . GLU A 1 96  ? 4.957  18.397 27.885 1.00 20.21 ? 96  GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1565
>HETATM 1189 O O   . HOH C 3 .   ? 17.126 28.421 9.515  1.00 23.81 ? 375 HOH A O   1 
>ATOM   762  C CG  . GLU A 1 96  ? 3.981  18.432 26.726 1.00 32.46 ? 96  GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1566
>HETATM 1190 O O   . HOH C 3 .   ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O   1 
>ATOM   763  C CD  . GLU A 1 96  ? 2.646  17.765 27.065 1.00 38.97 ? 96  GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1567
>HETATM 1191 O O   . HOH C 3 .   ? 6.046  30.510 19.639 1.00 29.02 ? 377 HOH A O   1 
>ATOM   764  O OE1 . GLU A 1 96  ? 2.053  18.108 28.128 1.00 42.61 ? 96  GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1568
>HETATM 1192 O O   . HOH C 3 .   ? 9.543  16.072 11.145 1.00 50.91 ? 378 HOH A O   1 
>ATOM   765  O OE2 . GLU A 1 96  ? 2.201  16.892 26.271 1.00 42.17 ? 96  GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1569
>HETATM 1193 O O   . HOH C 3 .   ? 8.174  14.289 20.240 1.00 54.21 ? 379 HOH A O   1 
>ATOM   766  N N   . GLN A 1 97  ? 6.513  20.725 25.903 1.00 13.39 ? 97  GLN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1570
>HETATM 1194 O O   . HOH C 3 .   ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O   1 
>ATOM   767  C CA  . GLN A 1 97  ? 6.489  22.100 25.402 1.00 13.55 ? 97  GLN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1571
>HETATM 1195 O O   . HOH C 3 .   ? 5.486  15.385 24.922 1.00 50.19 ? 381 HOH A O   1 
>ATOM   768  C C   . GLN A 1 97  ? 5.357  22.334 24.400 1.00 15.88 ? 97  GLN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1572
>HETATM 1196 O O   . HOH C 3 .   ? 6.038  21.424 43.276 1.00 46.64 ? 382 HOH A O   1 
>ATOM   769  O O   . GLN A 1 97  ? 5.013  21.455 23.591 1.00 16.25 ? 97  GLN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1573
>HETATM 1197 O O   . HOH C 3 .   ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O   1 
>ATOM   770  C CB  . GLN A 1 97  ? 7.823  22.465 24.747 1.00 12.20 ? 97  GLN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1574
>HETATM 1198 O O   . HOH C 3 .   ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O   1 
>ATOM   771  C CG  . GLN A 1 97  ? 9.033  22.324 25.650 1.00 12.55 ? 97  GLN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1575
>HETATM 1199 O O   . HOH C 3 .   ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O   1 
>ATOM   772  C CD  . GLN A 1 97  ? 10.321 22.613 24.927 1.00 14.20 ? 97  GLN A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1576
>HETATM 1200 O O   . HOH C 3 .   ? 31.446 7.504  31.389 1.00 28.93 ? 386 HOH A O   1 
>ATOM   773  O OE1 . GLN A 1 97  ? 10.478 22.288 23.749 1.00 12.94 ? 97  GLN A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1577
>HETATM 1201 O O   . HOH C 3 .   ? 18.212 20.893 5.892  1.00 29.90 ? 387 HOH A O   1 
>ATOM   774  N NE2 . GLN A 1 97  ? 11.260 23.235 25.627 1.00 14.75 ? 97  GLN A NE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1578
>HETATM 1202 O O   . HOH C 3 .   ? 15.148 27.608 7.685  1.00 30.91 ? 388 HOH A O   1 
>ATOM   775  N N   . LYS A 1 98  ? 4.801  23.541 24.450 1.00 17.30 ? 98  LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1579
>HETATM 1203 O O   . HOH C 3 .   ? 2.656  23.148 20.117 1.00 35.98 ? 389 HOH A O   1 
>ATOM   776  C CA  . LYS A 1 98  ? 3.696  23.952 23.582 1.00 19.78 ? 98  LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1580
>HETATM 1204 O O   . HOH C 3 .   ? 3.100  22.690 28.640 1.00 31.31 ? 390 HOH A O   1 
>ATOM   777  C C   . LYS A 1 98  ? 3.990  25.340 23.019 1.00 18.56 ? 98  LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1581
>HETATM 1205 O O   . HOH C 3 .   ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O   1 
>ATOM   778  O O   . LYS A 1 98  ? 4.162  26.293 23.771 1.00 17.70 ? 98  LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1582
>HETATM 1206 O O   . HOH C 3 .   ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O   1 
>ATOM   779  C CB  . LYS A 1 98  ? 2.389  23.953 24.389 1.00 23.30 ? 98  LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1583
>HETATM 1207 O O   . HOH C 3 .   ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O   1 
>ATOM   780  C CG  . LYS A 1 98  ? 1.294  24.857 23.867 1.00 30.94 ? 98  LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1584
>HETATM 1208 O O   . HOH C 3 .   ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O   1 
>ATOM   781  C CD  . LYS A 1 98  ? 0.210  25.047 24.934 1.00 37.10 ? 98  LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1585
>HETATM 1209 O O   . HOH C 3 .   ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O   1 
>ATOM   782  C CE  . LYS A 1 98  ? -0.849 26.072 24.520 1.00 39.73 ? 98  LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1586
>HETATM 1210 O O   . HOH C 3 .   ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O   1 
>ATOM   783  N NZ  . LYS A 1 98  ? -0.326 27.476 24.541 1.00 42.46 ? 98  LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1587
>HETATM 1211 O O   . HOH C 3 .   ? 1.988  27.992 43.589 1.00 33.97 ? 397 HOH A O   1 
>ATOM   784  N N   . LEU A 1 99  ? 4.073  25.445 21.696 1.00 19.35 ? 99  LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1588
>HETATM 1212 O O   . HOH C 3 .   ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O   1 
>ATOM   785  C CA  . LEU A 1 99  ? 4.357  26.721 21.041 1.00 21.32 ? 99  LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1589
>HETATM 1213 O O   . HOH C 3 .   ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O   1 
>ATOM   786  C C   . LEU A 1 99  ? 3.307  27.770 21.351 1.00 22.86 ? 99  LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1590
># 
>ATOM   787  O O   . LEU A 1 99  ? 2.108  27.496 21.261 1.00 23.41 ? 99  LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1591
>loop_
>ATOM   788  C CB  . LEU A 1 99  ? 4.466  26.542 19.526 1.00 22.09 ? 99  LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1592
>_pdbx_entity_nonpoly.entity_id 
>ATOM   789  C CG  . LEU A 1 99  ? 5.692  25.792 18.997 1.00 22.72 ? 99  LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1593
>_pdbx_entity_nonpoly.name 
>ATOM   790  C CD1 . LEU A 1 99  ? 5.585  25.639 17.490 1.00 23.04 ? 99  LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1594
>_pdbx_entity_nonpoly.comp_id 
>ATOM   791  C CD2 . LEU A 1 99  ? 6.951  26.548 19.372 1.00 23.61 ? 99  LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1595
>2 'RETINOIC ACID' REA 
>ATOM   792  N N   . LEU A 1 100 ? 3.767  28.962 21.722 1.00 24.11 ? 100 LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1596
>3 water           HOH 
>ATOM   793  C CA  . LEU A 1 100 ? 2.879  30.070 22.051 1.00 27.59 ? 100 LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1597
># 
>ATOM   794  C C   . LEU A 1 100 ? 2.130  30.545 20.815 1.00 30.94 ? 100 LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1598
>loop_
>ATOM   795  O O   . LEU A 1 100 ? 0.951  30.908 20.877 1.00 31.34 ? 100 LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1599
>_pdbx_validate_torsion.id 
>ATOM   796  C CB  . LEU A 1 100 ? 3.680  31.227 22.640 1.00 25.50 ? 100 LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1600
>_pdbx_validate_torsion.PDB_model_num 
>ATOM   797  C CG  . LEU A 1 100 ? 4.254  30.947 24.020 1.00 24.80 ? 100 LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1601
>_pdbx_validate_torsion.auth_comp_id 
>ATOM   798  C CD1 . LEU A 1 100 ? 4.960  32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1602
>_pdbx_validate_torsion.auth_asym_id 
>ATOM   799  C CD2 . LEU A 1 100 ? 3.141  30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1603
>_pdbx_validate_torsion.auth_seq_id 
>ATOM   800  N N   . LYS A 1 101 ? 2.835  30.531 19.689 1.00 34.60 ? 101 LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1604
>_pdbx_validate_torsion.PDB_ins_code 
>ATOM   801  C CA  . LYS A 1 101 ? 2.282  30.961 18.413 1.00 37.81 ? 101 LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1605
>_pdbx_validate_torsion.label_alt_id 
>ATOM   802  C C   . LYS A 1 101 ? 2.847  30.088 17.292 1.00 37.39 ? 101 LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1606
>_pdbx_validate_torsion.phi 
>ATOM   803  O O   . LYS A 1 101 ? 4.019  29.687 17.319 1.00 37.22 ? 101 LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1607
>_pdbx_validate_torsion.psi 
>ATOM   804  C CB  . LYS A 1 101 ? 2.653  32.429 18.147 1.00 40.57 ? 101 LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1608
>1 1 GLU A 73  ? ? -144.94 -154.28 
>ATOM   805  C CG  . LYS A 1 101 ? 2.182  33.426 19.212 1.00 45.13 ? 101 LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1609
>2 1 ASP A 126 ? ? 55.69   -115.96 
>ATOM   806  C CD  . LYS A 1 101 ? 2.955  34.741 19.125 1.00 48.57 ? 101 LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1610
># 
>ATOM   807  C CE  . LYS A 1 101 ? 4.479  34.527 19.248 1.00 51.31 ? 101 LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1611
>loop_
>ATOM   808  N NZ  . LYS A 1 101 ? 4.917  33.952 20.559 1.00 51.14 ? 101 LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1612
>_pdbx_audit_revision_group.ordinal 
>ATOM   809  N N   . GLY A 1 102 ? 1.997  29.786 16.318 1.00 37.21 ? 102 GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1613
>_pdbx_audit_revision_group.revision_ordinal 
>ATOM   810  C CA  . GLY A 1 102 ? 2.423  28.993 15.184 1.00 36.82 ? 102 GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1614
>_pdbx_audit_revision_group.data_content_type 
>ATOM   811  C C   . GLY A 1 102 ? 2.333  27.494 15.344 1.00 36.36 ? 102 GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1615
>_pdbx_audit_revision_group.group 
>ATOM   812  O O   . GLY A 1 102 ? 1.690  26.977 16.265 1.00 35.74 ? 102 GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1616
>1 2 'Structure model' 'Version format compliance' 
>ATOM   813  N N   . GLU A 1 103 ? 2.954  26.803 14.395 1.00 35.74 ? 103 GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1617
>2 3 'Structure model' 'Version format compliance' 
>ATOM   814  C CA  . GLU A 1 103 ? 2.988  25.348 14.377 1.00 35.50 ? 103 GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1618
># 
>ATOM   815  C C   . GLU A 1 103 ? 4.418  24.880 14.140 1.00 31.92 ? 103 GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1619
>_pdbx_audit_revision_details.ordinal             1 
>ATOM   816  O O   . GLU A 1 103 ? 5.281  25.654 13.723 1.00 31.61 ? 103 GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1620
>_pdbx_audit_revision_details.revision_ordinal    1 
>ATOM   817  C CB  . GLU A 1 103 ? 2.077  24.784 13.274 1.00 39.37 ? 103 GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1621
>_pdbx_audit_revision_details.data_content_type   'Structure model' 
>ATOM   818  C CG  . GLU A 1 103 ? 0.652  24.422 13.712 1.00 45.52 ? 103 GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1622
>_pdbx_audit_revision_details.provider            repository 
>ATOM   819  C CD  . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1623
>_pdbx_audit_revision_details.type                'Initial release' 
>ATOM   820  O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1624
>_pdbx_audit_revision_details.description         ? 
>ATOM   821  O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1625
># 
>ATOM   822  N N   . GLY A 1 104 ? 4.653  23.604 14.414 1.00 28.97 ? 104 GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1626
>loop_
>ATOM   823  C CA  . GLY A 1 104 ? 5.967  23.024 14.231 1.00 25.41 ? 104 GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1627
>_pdbx_audit_revision_history.ordinal 
>ATOM   824  C C   . GLY A 1 104 ? 6.012  21.648 14.863 1.00 22.09 ? 104 GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1628
>_pdbx_audit_revision_history.data_content_type 
>ATOM   825  O O   . GLY A 1 104 ? 4.987  21.160 15.347 1.00 21.89 ? 104 GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1629
>_pdbx_audit_revision_history.major_revision 
>ATOM   826  N N   . PRO A 1 105 ? 7.176  20.976 14.832 1.00 19.50 ? 105 PRO A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1630
>_pdbx_audit_revision_history.minor_revision 
>ATOM   827  C CA  . PRO A 1 105 ? 7.338  19.640 15.418 1.00 17.92 ? 105 PRO A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1631
>_pdbx_audit_revision_history.revision_date 
>ATOM   828  C C   . PRO A 1 105 ? 7.020  19.664 16.914 1.00 15.61 ? 105 PRO A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1632
>1 'Structure model' 1 0 1995-01-26 
>ATOM   829  O O   . PRO A 1 105 ? 7.170  20.696 17.567 1.00 14.42 ? 105 PRO A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1633
>2 'Structure model' 1 1 2008-03-24 
>ATOM   830  C CB  . PRO A 1 105 ? 8.828  19.348 15.202 1.00 18.86 ? 105 PRO A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1634
>3 'Structure model' 1 2 2011-07-13 
>ATOM   831  C CG  . PRO A 1 105 ? 9.188  20.164 14.005 1.00 18.76 ? 105 PRO A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1635
># 
>ATOM   832  C CD  . PRO A 1 105 ? 8.423  21.440 14.199 1.00 18.40 ? 105 PRO A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1636
>_pdbx_struct_oper_list.id                   1 
>ATOM   833  N N   . LYS A 1 106 ? 6.552  18.541 17.444 1.00 16.02 ? 106 LYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1637
>_pdbx_struct_oper_list.type                 'identity operation' 
>ATOM   834  C CA  . LYS A 1 106 ? 6.255  18.453 18.868 1.00 16.93 ? 106 LYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1638
>_pdbx_struct_oper_list.name                 1_555 
>ATOM   835  C C   . LYS A 1 106 ? 7.609  18.305 19.554 1.00 15.49 ? 106 LYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1639
>_pdbx_struct_oper_list.symmetry_operation   x,y,z 
>ATOM   836  O O   . LYS A 1 106 ? 8.397  17.437 19.183 1.00 14.76 ? 106 LYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1640
>_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
>ATOM   837  C CB  . LYS A 1 106 ? 5.387  17.229 19.174 1.00 20.98 ? 106 LYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1641
>_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
>ATOM   838  C CG  . LYS A 1 106 ? 5.015  17.097 20.662 1.00 27.98 ? 106 LYS A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1642
>_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
>ATOM   839  C CD  . LYS A 1 106 ? 4.463  18.433 21.229 1.00 33.23 ? 106 LYS A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1643
>_pdbx_struct_oper_list.vector[1]            0.0000000000 
>ATOM   840  C CE  . LYS A 1 106 ? 4.250  18.417 22.764 1.00 35.21 ? 106 LYS A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1644
>_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
>ATOM   841  N NZ  . LYS A 1 106 ? 5.519  18.251 23.566 1.00 33.75 ? 106 LYS A NZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1645
>_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
>ATOM   842  N N   . THR A 1 107 ? 7.907  19.167 20.515 1.00 13.91 ? 107 THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1646
>_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
>ATOM   843  C CA  . THR A 1 107 ? 9.203  19.086 21.190 1.00 12.14 ? 107 THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1647
>_pdbx_struct_oper_list.vector[2]            0.0000000000 
>ATOM   844  C C   . THR A 1 107 ? 9.083  18.819 22.681 1.00 11.66 ? 107 THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1648
>_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
>ATOM   845  O O   . THR A 1 107 ? 8.061  19.120 23.295 1.00 10.59 ? 107 THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1649
>_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
>ATOM   846  C CB  . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1650
>_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
>ATOM   847  O OG1 . THR A 1 107 ? 9.263  21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1651
>_pdbx_struct_oper_list.vector[3]            0.0000000000 
>ATOM   848  C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1652
># 
>ATOM   849  N N   . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1653
>_pdbx_struct_assembly_gen.assembly_id       1 
>ATOM   850  C CA  . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98  ? 108 SER A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1654
>_pdbx_struct_assembly_gen.oper_expression   1 
>ATOM   851  C C   . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90  ? 108 SER A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1655
>_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
>ATOM   852  O O   . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48  ? 108 SER A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1656
># 
>ATOM   853  C CB  . SER A 1 108 ? 9.370  16.729 25.024 1.00 9.84  ? 108 SER A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1657
>_pdbx_struct_assembly.id                   1 
>ATOM   854  O OG  . SER A 1 108 ? 9.844  15.601 24.313 1.00 13.87 ? 108 SER A OG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1658
>_pdbx_struct_assembly.details              author_defined_assembly 
>ATOM   855  N N   . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96  ? 109 TRP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1659
>_pdbx_struct_assembly.method_details       ? 
>ATOM   856  C CA  . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85  ? 109 TRP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1660
>_pdbx_struct_assembly.oligomeric_details   monomeric 
>ATOM   857  C C   . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56  ? 109 TRP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1661
>_pdbx_struct_assembly.oligomeric_count     1 
>ATOM   858  O O   . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14  ? 109 TRP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1662
># 
>ATOM   859  C CB  . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25  ? 109 TRP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1663
>loop_
>ATOM   860  C CG  . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07  ? 109 TRP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1664
>_atom_type.symbol 
>ATOM   861  C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28  ? 109 TRP A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1665
>C 
>ATOM   862  C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31  ? 109 TRP A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1666
>N 
>ATOM   863  N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69  ? 109 TRP A NE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1667
>O 
>ATOM   864  C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04  ? 109 TRP A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1668
>S 
>ATOM   865  C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92  ? 109 TRP A CE3 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1669
># 
>ATOM   866  C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72  ? 109 TRP A CZ2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1670
>_atom_sites.entry_id                    1CBS 
>ATOM   867  C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1671
>_atom_sites.fract_transf_matrix[1][1]   0.021906 
>ATOM   868  C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1672
>_atom_sites.fract_transf_matrix[1][2]   0.000000 
>ATOM   869  N N   . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39  ? 110 THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1673
>_atom_sites.fract_transf_matrix[1][3]   0.000000 
>ATOM   870  C CA  . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23  ? 110 THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1674
>_atom_sites.fract_transf_matrix[2][1]   0.000000 
>ATOM   871  C C   . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40  ? 110 THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1675
>_atom_sites.fract_transf_matrix[2][2]   0.021026 
>ATOM   872  O O   . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43  ? 110 THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1676
>_atom_sites.fract_transf_matrix[2][3]   0.000000 
>ATOM   873  C CB  . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17  ? 110 THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1677
>_atom_sites.fract_transf_matrix[3][1]   0.000000 
>ATOM   874  O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49  ? 110 THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1678
>_atom_sites.fract_transf_matrix[3][2]   0.000000 
>ATOM   875  C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64  ? 110 THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1679
>_atom_sites.fract_transf_matrix[3][3]   0.012885 
>ATOM   876  N N   . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72  ? 111 ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1680
>_atom_sites.fract_transf_vector[1]      0.00000 
>ATOM   877  C CA  . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27  ? 111 ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1681
>_atom_sites.fract_transf_vector[2]      0.00000 
>ATOM   878  C C   . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89  ? 111 ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1682
>_atom_sites.fract_transf_vector[3]      0.00000 
>ATOM   879  O O   . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35  ? 111 ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1683
># 
>ATOM   880  C CB  . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20  ? 111 ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1684
>_database_PDB_matrix.entry_id          1CBS 
>ATOM   881  C CG  . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38  ? 111 ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1685
>_database_PDB_matrix.origx[1][1]       1.000000 
>ATOM   882  C CD  . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70  ? 111 ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1686
>_database_PDB_matrix.origx[1][2]       0.000000 
>ATOM   883  N NE  . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83  ? 111 ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1687
>_database_PDB_matrix.origx[1][3]       0.000000 
>ATOM   884  C CZ  . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1688
>_database_PDB_matrix.origx[2][1]       0.000000 
>ATOM   885  N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1689
>_database_PDB_matrix.origx[2][2]       1.000000 
>ATOM   886  N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1690
>_database_PDB_matrix.origx[2][3]       0.000000 
>ATOM   887  N N   . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64  ? 112 GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1691
>_database_PDB_matrix.origx[3][1]       0.000000 
>ATOM   888  C CA  . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1692
>_database_PDB_matrix.origx[3][2]       0.000000 
>ATOM   889  C C   . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93  ? 112 GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1693
>_database_PDB_matrix.origx[3][3]       1.000000 
>ATOM   890  O O   . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92  ? 112 GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1694
>_database_PDB_matrix.origx_vector[1]   0.00000 
>ATOM   891  C CB  . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1695
>_database_PDB_matrix.origx_vector[2]   0.00000 
>ATOM   892  C CG  . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1696
>_database_PDB_matrix.origx_vector[3]   0.00000 
>ATOM   893  C CD  . GLU A 1 112 ? 17.484 9.325  32.177 1.00 25.09 ? 112 GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1697
># 
>ATOM   894  O OE1 . GLU A 1 112 ? 17.223 8.308  32.883 1.00 22.36 ? 112 GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1698
>loop_
>ATOM   895  O OE2 . GLU A 1 112 ? 17.175 9.443  30.955 1.00 25.10 ? 112 GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1699
>_struct_site_gen.id 
>ATOM   896  N N   . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96  ? 113 LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1700
>_struct_site_gen.site_id 
>ATOM   897  C CA  . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1701
>_struct_site_gen.pdbx_num_res 
>ATOM   898  C C   . LEU A 1 113 ? 20.789 9.991  37.081 1.00 12.06 ? 113 LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1702
>_struct_site_gen.label_comp_id 
>ATOM   899  O O   . LEU A 1 113 ? 19.906 9.270  37.559 1.00 12.08 ? 113 LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1703
>_struct_site_gen.label_asym_id 
>ATOM   900  C CB  . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1704
>_struct_site_gen.label_seq_id 
>ATOM   901  C CG  . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1705
>_struct_site_gen.pdbx_auth_ins_code 
>ATOM   902  C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1706
>_struct_site_gen.auth_comp_id 
>ATOM   903  C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1707
>_struct_site_gen.auth_asym_id 
>ATOM   904  N N   . THR A 1 114 ? 21.895 9.502  36.535 1.00 11.06 ? 114 THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1708
>_struct_site_gen.auth_seq_id 
>ATOM   905  C CA  . THR A 1 114 ? 22.110 8.062  36.452 1.00 11.74 ? 114 THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1709
>_struct_site_gen.label_atom_id 
>ATOM   906  C C   . THR A 1 114 ? 22.816 7.522  37.686 1.00 11.41 ? 114 THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1710
>_struct_site_gen.label_alt_id 
>ATOM   907  O O   . THR A 1 114 ? 23.327 8.282  38.501 1.00 11.47 ? 114 THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1711
>_struct_site_gen.symmetry 
>ATOM   908  C CB  . THR A 1 114 ? 22.894 7.700  35.188 1.00 12.89 ? 114 THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1712
>_struct_site_gen.details 
>ATOM   909  O OG1 . THR A 1 114 ? 24.109 8.451  35.164 1.00 15.50 ? 114 THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1713
>1  AC1 10 GLU A 13  ? GLU A 13  . ? 3_655 ? 
>ATOM   910  C CG2 . THR A 1 114 ? 22.075 8.037  33.951 1.00 14.75 ? 114 THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1714
>2  AC1 10 ALA A 32  ? ALA A 32  . ? 1_555 ? 
>ATOM   911  N N   . ASN A 1 115 ? 22.834 6.202  37.808 1.00 13.23 ? 115 ASN A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1715
>3  AC1 10 THR A 54  ? THR A 54  . ? 1_555 ? 
>ATOM   912  C CA  . ASN A 1 115 ? 23.441 5.538  38.951 1.00 16.19 ? 115 ASN A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1716
>4  AC1 10 VAL A 58  ? VAL A 58  . ? 1_555 ? 
>ATOM   913  C C   . ASN A 1 115 ? 24.930 5.761  39.139 1.00 14.24 ? 115 ASN A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1717
>5  AC1 10 VAL A 76  ? VAL A 76  . ? 1_555 ? 
>ATOM   914  O O   . ASN A 1 115 ? 25.432 5.626  40.256 1.00 14.74 ? 115 ASN A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1718
>6  AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? 
>ATOM   915  C CB  . ASN A 1 115 ? 23.123 4.047  38.918 1.00 21.89 ? 115 ASN A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1719
>7  AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? 
>ATOM   916  C CG  . ASN A 1 115 ? 21.703 3.754  39.357 1.00 29.77 ? 115 ASN A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1720
>8  AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? 
>ATOM   917  O OD1 . ASN A 1 115 ? 20.955 3.046  38.669 1.00 34.83 ? 115 ASN A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1721
>9  AC1 10 HOH C .   ? HOH A 309 . ? 1_555 ? 
>ATOM   918  N ND2 . ASN A 1 115 ? 21.313 4.310  40.516 1.00 32.90 ? 115 ASN A ND2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1722
>10 AC1 10 HOH C .   ? HOH A 343 . ? 1_555 ? 
>ATOM   919  N N   . ASP A 1 116 ? 25.626 6.095  38.055 1.00 12.05 ? 116 ASP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1723
># 
>ATOM   920  C CA  . ASP A 1 116 ? 27.061 6.364  38.094 1.00 11.99 ? 116 ASP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1724
>_struct_site.id                   AC1 
>ATOM   921  C C   . ASP A 1 116 ? 27.424 7.821  38.397 1.00 11.45 ? 116 ASP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1725
>_struct_site.pdbx_evidence_code   Software 
>ATOM   922  O O   . ASP A 1 116 ? 28.592 8.184  38.393 1.00 12.23 ? 116 ASP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1726
>_struct_site.pdbx_auth_asym_id    ? 
>ATOM   923  C CB  . ASP A 1 116 ? 27.764 5.875  36.806 1.00 13.89 ? 116 ASP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1727
>_struct_site.pdbx_auth_comp_id    ? 
>ATOM   924  C CG  . ASP A 1 116 ? 27.177 6.474  35.512 1.00 16.58 ? 116 ASP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1728
>_struct_site.pdbx_auth_seq_id     ? 
>ATOM   925  O OD1 . ASP A 1 116 ? 26.263 7.303  35.569 1.00 19.66 ? 116 ASP A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1729
>_struct_site.pdbx_auth_ins_code   ? 
>ATOM   926  O OD2 . ASP A 1 116 ? 27.651 6.113  34.422 1.00 20.14 ? 116 ASP A OD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1730
>_struct_site.pdbx_num_residues    10 
>ATOM   927  N N   . GLY A 1 117 ? 26.420 8.647  38.675 1.00 10.58 ? 117 GLY A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1731
>_struct_site.details              'BINDING SITE FOR RESIDUE REA A 200' 
>ATOM   928  C CA  . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83  ? 117 GLY A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1732
># 
>ATOM   929  C C   . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97  ? 117 GLY A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1733
>loop_
>ATOM   930  O O   . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1734
>_pdbx_struct_sheet_hbond.sheet_id 
>ATOM   931  N N   . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43  ? 118 GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1735
>_pdbx_struct_sheet_hbond.range_id_1 
>ATOM   932  C CA  . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79  ? 118 GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1736
>_pdbx_struct_sheet_hbond.range_id_2 
>ATOM   933  C C   . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60  ? 118 GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1737
>_pdbx_struct_sheet_hbond.range_1_label_atom_id 
>ATOM   934  O O   . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05  ? 118 GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1738
>_pdbx_struct_sheet_hbond.range_1_label_comp_id 
>ATOM   935  C CB  . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86  ? 118 GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1739
>_pdbx_struct_sheet_hbond.range_1_label_asym_id 
>ATOM   936  C CG  . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64  ? 118 GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1740
>_pdbx_struct_sheet_hbond.range_1_label_seq_id 
>ATOM   937  C CD  . GLU A 1 118 ? 28.770 9.370  33.310 1.00 13.39 ? 118 GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1741
>_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
>ATOM   938  O OE1 . GLU A 1 118 ? 28.036 9.043  32.355 1.00 11.90 ? 118 GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1742
>_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
>ATOM   939  O OE2 . GLU A 1 118 ? 29.956 8.998  33.405 1.00 16.59 ? 118 GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1743
>_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
>ATOM   940  N N   . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57  ? 119 LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1744
>_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
>ATOM   941  C CA  . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94  ? 119 LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1745
>_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
>ATOM   942  C C   . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29  ? 119 LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1746
>_pdbx_struct_sheet_hbond.range_2_label_atom_id 
>ATOM   943  O O   . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23  ? 119 LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1747
>_pdbx_struct_sheet_hbond.range_2_label_comp_id 
>ATOM   944  C CB  . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83  ? 119 LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1748
>_pdbx_struct_sheet_hbond.range_2_label_asym_id 
>ATOM   945  C CG  . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54  ? 119 LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1749
>_pdbx_struct_sheet_hbond.range_2_label_seq_id 
>ATOM   946  C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1750
>_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
>ATOM   947  C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1751
>_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
>ATOM   948  N N   . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17  ? 120 ILE A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1752
>_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
>ATOM   949  C CA  . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22  ? 120 ILE A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1753
>_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
>ATOM   950  C C   . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47  ? 120 ILE A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1754
>_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
>ATOM   951  O O   . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54  ? 120 ILE A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1755
>A 1 2  O PHE A 65  ? O PHE A 65  N PHE A 50  ? N PHE A 50  
>ATOM   952  C CB  . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19  ? 120 ILE A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1756
>A 2 3  N SER A 55  ? N SER A 55  O ALA A 40  ? O ALA A 40  
>ATOM   953  C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26  ? 120 ILE A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1757
>A 3 4  N ILE A 43  ? N ILE A 43  O GLY A 5   ? O GLY A 5   
>ATOM   954  C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54  ? 120 ILE A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1758
>A 4 5  N GLU A 13  ? N GLU A 13  O THR A 131 ? O THR A 131 
>ATOM   955  C CD1 . ILE A 1 120 ? 21.668 8.658  30.600 1.00 9.35  ? 120 ILE A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1759
>A 5 6  N TYR A 134 ? N TYR A 134 O LEU A 119 ? O LEU A 119 
>ATOM   956  N N   . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41  ? 121 LEU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1760
>A 6 7  N THR A 124 ? N THR A 124 O SER A 108 ? O SER A 108 
>ATOM   957  C CA  . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25  ? 121 LEU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1761
>A 7 8  O ARG A 111 ? O ARG A 111 N MET A 93  ? N MET A 93  
>ATOM   958  C C   . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41  ? 121 LEU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1762
>A 8 9  O LYS A 98  ? O LYS A 98  N LYS A 82  ? N LYS A 82  
>ATOM   959  O O   . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01  ? 121 LEU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1763
>A 9 10 N SER A 83  ? N SER A 83  O PHE A 71  ? O PHE A 71  
>ATOM   960  C CB  . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37  ? 121 LEU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1764
># 
>ATOM   961  C CG  . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96  ? 121 LEU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1765
>loop_
>ATOM   962  C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91  ? 121 LEU A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1766
>_struct_sheet_range.sheet_id 
>ATOM   963  C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96  ? 121 LEU A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1767
>_struct_sheet_range.id 
>ATOM   964  N N   . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71  ? 122 THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1768
>_struct_sheet_range.beg_label_comp_id 
>ATOM   965  C CA  . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80  ? 122 THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1769
>_struct_sheet_range.beg_label_asym_id 
>ATOM   966  C C   . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58  ? 122 THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1770
>_struct_sheet_range.beg_label_seq_id 
>ATOM   967  O O   . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21  ? 122 THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1771
>_struct_sheet_range.pdbx_beg_PDB_ins_code 
>ATOM   968  C CB  . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51  ? 122 THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1772
>_struct_sheet_range.end_label_comp_id 
>ATOM   969  O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27  ? 122 THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1773
>_struct_sheet_range.end_label_asym_id 
>ATOM   970  C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86  ? 122 THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1774
>_struct_sheet_range.end_label_seq_id 
>ATOM   971  N N   . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87  ? 123 MET A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1775
>_struct_sheet_range.pdbx_end_PDB_ins_code 
>ATOM   972  C CA  . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22  ? 123 MET A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1776
>_struct_sheet_range.beg_auth_comp_id 
>ATOM   973  C C   . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66  ? 123 MET A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1777
>_struct_sheet_range.beg_auth_asym_id 
>ATOM   974  O O   . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09  ? 123 MET A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1778
>_struct_sheet_range.beg_auth_seq_id 
>ATOM   975  C CB  . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37  ? 123 MET A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1779
>_struct_sheet_range.end_auth_comp_id 
>ATOM   976  C CG  . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1780
>_struct_sheet_range.end_auth_asym_id 
>ATOM   977  S SD  . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1781
>_struct_sheet_range.end_auth_seq_id 
>ATOM   978  C CE  . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1782
>A 1  THR A 60  ? LYS A 66  ? THR A 60  LYS A 66  
>ATOM   979  N N   . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20  ? 124 THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1783
>A 2  THR A 49  ? SER A 55  ? THR A 49  SER A 55  
>ATOM   980  C CA  . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54  ? 124 THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1784
>A 3  ALA A 40  ? GLU A 46  ? ALA A 40  GLU A 46  
>ATOM   981  C C   . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1785
>A 4  GLY A 5   ? GLU A 13  ? GLY A 5   GLU A 13  
>ATOM   982  O O   . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54  ? 124 THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1786
>A 5  VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 
>ATOM   983  C CB  . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1787
>A 6  LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 
>ATOM   984  O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1788
>A 7  THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 
>ATOM   985  C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1789
>A 8  LYS A 92  ? LEU A 99  ? LYS A 92  LEU A 99  
>ATOM   986  N N   . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1790
>A 9  PRO A 80  ? SER A 89  ? PRO A 80  SER A 89  
>ATOM   987  C CA  . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1791
>A 10 PHE A 71  ? GLN A 74  ? PHE A 71  GLN A 74  
>ATOM   988  C C   . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1792
># 
>ATOM   989  O O   . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1793
>loop_
>ATOM   990  C CB  . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1794
>_struct_sheet_order.sheet_id 
>ATOM   991  N N   . ASP A 1 126 ? 9.664  15.754 17.216 1.00 14.63 ? 126 ASP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1795
>_struct_sheet_order.range_id_1 
>ATOM   992  C CA  . ASP A 1 126 ? 8.901  14.721 16.536 1.00 17.86 ? 126 ASP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1796
>_struct_sheet_order.range_id_2 
>ATOM   993  C C   . ASP A 1 126 ? 9.512  13.364 16.905 1.00 18.66 ? 126 ASP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1797
>_struct_sheet_order.offset 
>ATOM   994  O O   . ASP A 1 126 ? 9.519  13.006 18.080 1.00 19.38 ? 126 ASP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1798
>_struct_sheet_order.sense 
>ATOM   995  C CB  . ASP A 1 126 ? 8.835  14.982 15.023 1.00 18.40 ? 126 ASP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1799
>A 1 2  ? anti-parallel 
>ATOM   996  C CG  . ASP A 1 126 ? 7.786  16.032 14.660 1.00 22.34 ? 126 ASP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1800
>A 2 3  ? anti-parallel 
>ATOM   997  O OD1 . ASP A 1 126 ? 6.800  16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1801
>A 3 4  ? anti-parallel 
>ATOM   998  O OD2 . ASP A 1 126 ? 7.940  16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1802
>A 4 5  ? anti-parallel 
>ATOM   999  N N   . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1803
>A 5 6  ? anti-parallel 
>ATOM   1000 C CA  . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1804
>A 6 7  ? anti-parallel 
>ATOM   1001 C C   . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1805
>A 7 8  ? anti-parallel 
>ATOM   1002 O O   . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1806
>A 8 9  ? anti-parallel 
>ATOM   1003 C CB  . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1807
>A 9 10 ? anti-parallel 
>ATOM   1004 C CG  . ASP A 1 127 ? 9.043  9.450  15.880 1.00 33.21 ? 127 ASP A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1808
># 
>ATOM   1005 O OD1 . ASP A 1 127 ? 7.892  9.959  15.934 1.00 36.08 ? 127 ASP A OD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1809
>_struct_sheet.id               A 
>ATOM   1006 O OD2 . ASP A 1 127 ? 9.318  8.308  16.318 1.00 38.35 ? 127 ASP A OD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1810
>_struct_sheet.type             ? 
>ATOM   1007 N N   . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1811
>_struct_sheet.number_strands   10 
>ATOM   1008 C CA  . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1812
>_struct_sheet.details          ? 
>ATOM   1009 C C   . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1813
># 
>ATOM   1010 O O   . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74  ? 128 VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1814
>_struct_biol.id   1 
>ATOM   1011 C CB  . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1815
># 
>ATOM   1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1816
>loop_
>ATOM   1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1817
>_struct_asym.id 
>ATOM   1014 N N   . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29  ? 129 VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1818
>_struct_asym.pdbx_blank_PDB_chainid_flag 
>ATOM   1015 C CA  . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95  ? 129 VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1819
>_struct_asym.pdbx_modified 
>ATOM   1016 C C   . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49  ? 129 VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1820
>_struct_asym.entity_id 
>ATOM   1017 O O   . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73  ? 129 VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1821
>_struct_asym.details 
>ATOM   1018 C CB  . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43  ? 129 VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1822
>A N N 1 ? 
>ATOM   1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09  ? 129 VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1823
>B N N 2 ? 
>ATOM   1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45  ? 129 VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1824
>C N N 3 ? 
>ATOM   1021 N N   . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54  ? 130 CYS A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1825
># 
>ATOM   1022 C CA  . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47  ? 130 CYS A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1826
>_struct_keywords.entry_id        1CBS 
>ATOM   1023 C C   . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61  ? 130 CYS A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1827
>_struct_keywords.pdbx_keywords   'RETINOIC-ACID TRANSPORT' 
>ATOM   1024 O O   . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53  ? 130 CYS A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1828
>_struct_keywords.text            'RETINOIC-ACID TRANSPORT' 
>ATOM   1025 C CB  . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05  ? 130 CYS A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1829
># 
>ATOM   1026 S SG  . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82  ? 130 CYS A SG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1830
>_struct.entry_id                  1CBS 
>ATOM   1027 N N   . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58  ? 131 THR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1831
>_struct.title                     
>ATOM   1028 C CA  . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93  ? 131 THR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1832
>;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID
>ATOM   1029 C C   . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18  ? 131 THR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1833
>;
>ATOM   1030 O O   . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77  ? 131 THR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1834
>_struct.pdbx_descriptor           
>ATOM   1031 C CB  . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63  ? 131 THR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1835
>'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' 
>ATOM   1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60  ? 131 THR A OG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1836
>_struct.pdbx_model_details        ? 
>ATOM   1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76  ? 131 THR A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1837
>_struct.pdbx_CASP_flag            ? 
>ATOM   1034 N N   . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29  ? 132 ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1838
>_struct.pdbx_model_type_details   ? 
>ATOM   1035 C CA  . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67  ? 132 ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1839
># 
>ATOM   1036 C C   . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19  ? 132 ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1840
>loop_
>ATOM   1037 O O   . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65  ? 132 ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1841
>_refine_ls_restr.type 
>ATOM   1038 C CB  . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67  ? 132 ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1842
>_refine_ls_restr.dev_ideal 
>ATOM   1039 C CG  . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1843
>_refine_ls_restr.dev_ideal_target 
>ATOM   1040 C CD  . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1844
>_refine_ls_restr.weight 
>ATOM   1041 N NE  . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1845
>_refine_ls_restr.number 
>ATOM   1042 C CZ  . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1846
>_refine_ls_restr.pdbx_refine_id 
>ATOM   1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1847
>_refine_ls_restr.pdbx_restraint_function 
>ATOM   1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1848
>x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1045 N N   . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99  ? 133 VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1849
>x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1046 C CA  . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92  ? 133 VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1850
>x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1047 C C   . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85  ? 133 VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1851
>x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1048 O O   . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50  ? 133 VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1852
>x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1049 C CB  . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37  ? 133 VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1853
>x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95  ? 133 VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1854
>x_angle_deg             1.51  ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46  ? 133 VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1855
>x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1052 N N   . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35  ? 134 TYR A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1856
>x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1053 C CA  . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57  ? 134 TYR A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1857
>x_dihedral_angle_d      27.4  ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1054 C C   . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30  ? 134 TYR A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1858
>x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1055 O O   . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92  ? 134 TYR A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1859
>x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1056 C CB  . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84  ? 134 TYR A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1860
>x_improper_angle_d      1.32  ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1057 C CG  . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89  ? 134 TYR A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1861
>x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1862
>x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1863
>x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1864
>x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1865
>x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1062 C CZ  . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1866
>x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
>ATOM   1063 O OH  . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1867
># 
>ATOM   1064 N N   . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63  ? 135 VAL A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1868
>_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
>ATOM   1065 C CA  . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42  ? 135 VAL A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1869
>_refine_hist.cycle_id                         LAST 
>ATOM   1066 C C   . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05  ? 135 VAL A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1870
>_refine_hist.pdbx_number_atoms_protein        1091 
>ATOM   1067 O O   . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02  ? 135 VAL A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1871
>_refine_hist.pdbx_number_atoms_nucleic_acid   0 
>ATOM   1068 C CB  . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05  ? 135 VAL A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1872
>_refine_hist.pdbx_number_atoms_ligand         22 
>ATOM   1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27  ? 135 VAL A CG1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1873
>_refine_hist.number_atoms_solvent             100 
>ATOM   1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1874
>_refine_hist.number_atoms_total               1213 
>ATOM   1071 N N   . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57  ? 136 ARG A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1875
>_refine_hist.d_res_high                       1.8 
>ATOM   1072 C CA  . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1876
>_refine_hist.d_res_low                        8.0 
>ATOM   1073 C C   . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1877
># 
>ATOM   1074 O O   . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1878
>_refine_analyze.entry_id                        1CBS 
>ATOM   1075 C CB  . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1879
>_refine_analyze.Luzzati_coordinate_error_obs    0.2 
>ATOM   1076 C CG  . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1880
>_refine_analyze.Luzzati_sigma_a_obs             ? 
>ATOM   1077 C CD  . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1881
>_refine_analyze.Luzzati_d_res_low_obs           ? 
>ATOM   1078 N NE  . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1882
>_refine_analyze.Luzzati_coordinate_error_free   ? 
>ATOM   1079 C CZ  . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1883
>_refine_analyze.Luzzati_sigma_a_free            ? 
>ATOM   1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1884
>_refine_analyze.Luzzati_d_res_low_free          ? 
>ATOM   1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1885
>_refine_analyze.number_disordered_residues      ? 
>ATOM   1082 N N   . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1886
>_refine_analyze.occupancy_sum_hydrogen          ? 
>ATOM   1083 C CA  . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1887
>_refine_analyze.occupancy_sum_non_hydrogen      ? 
>ATOM   1084 C C   . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1888
>_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
>ATOM   1085 O O   . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1889
># 
>ATOM   1086 C CB  . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1890
>_refine.entry_id                                 1CBS 
>ATOM   1087 C CG  . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1891
>_refine.ls_number_reflns_obs                     14312 
>ATOM   1088 C CD  . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1892
>_refine.ls_number_reflns_all                     ? 
>ATOM   1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1893
>_refine.pdbx_ls_sigma_I                          ? 
>ATOM   1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1894
>_refine.pdbx_ls_sigma_F                          2. 
>ATOM   1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1895
>_refine.pdbx_data_cutoff_high_absF               ? 
>HETATM 1092 C C1  . REA B 2 .   ? 21.972 29.831 16.739 1.00 15.25 ? 200 REA A C1  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1896
>_refine.pdbx_data_cutoff_low_absF                ? 
>HETATM 1093 C C2  . REA B 2 .   ? 20.921 30.524 15.841 1.00 15.61 ? 200 REA A C2  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1897
>_refine.pdbx_data_cutoff_high_rms_absF           ? 
>HETATM 1094 C C3  . REA B 2 .   ? 20.245 29.635 14.848 1.00 16.19 ? 200 REA A C3  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1898
>_refine.ls_d_res_low                             8.0 
>HETATM 1095 C C4  . REA B 2 .   ? 19.555 28.479 15.488 1.00 14.59 ? 200 REA A C4  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1899
>_refine.ls_d_res_high                            1.8 
>HETATM 1096 C C5  . REA B 2 .   ? 20.389 27.812 16.587 1.00 14.10 ? 200 REA A C5  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1900
>_refine.ls_percent_reflns_obs                    90.3 
>HETATM 1097 C C6  . REA B 2 .   ? 21.425 28.446 17.218 1.00 14.42 ? 200 REA A C6  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1901
>_refine.ls_R_factor_obs                          0.2000000 
>HETATM 1098 C C7  . REA B 2 .   ? 22.242 27.851 18.297 1.00 13.89 ? 200 REA A C7  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1902
>_refine.ls_R_factor_all                          ? 
>HETATM 1099 C C8  . REA B 2 .   ? 21.868 26.977 19.240 1.00 11.86 ? 200 REA A C8  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1903
>_refine.ls_R_factor_R_work                       0.2000000 
>HETATM 1100 C C9  . REA B 2 .   ? 22.705 26.434 20.286 1.00 10.87 ? 200 REA A C9  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1904
>_refine.ls_R_factor_R_free                       0.2370000 
>HETATM 1101 C C10 . REA B 2 .   ? 22.159 25.536 21.131 1.00 9.19  ? 200 REA A C10 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1905
>_refine.ls_R_factor_R_free_error                 ? 
>HETATM 1102 C C11 . REA B 2 .   ? 22.875 24.924 22.234 1.00 10.35 ? 200 REA A C11 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1906
>_refine.ls_R_factor_R_free_error_details         ? 
>HETATM 1103 C C12 . REA B 2 .   ? 22.237 24.026 22.990 1.00 10.53 ? 200 REA A C12 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1907
>_refine.ls_percent_reflns_R_free                 ? 
>HETATM 1104 C C13 . REA B 2 .   ? 22.856 23.377 24.125 1.00 10.91 ? 200 REA A C13 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1908
>_refine.ls_number_reflns_R_free                  ? 
>HETATM 1105 C C14 . REA B 2 .   ? 22.135 22.473 24.834 1.00 11.88 ? 200 REA A C14 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1909
>_refine.ls_number_parameters                     ? 
>HETATM 1106 C C15 . REA B 2 .   ? 22.563 21.710 26.016 1.00 14.86 ? 200 REA A C15 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1910
>_refine.ls_number_restraints                     ? 
>HETATM 1107 C C16 . REA B 2 .   ? 22.238 30.737 17.948 1.00 15.47 ? 200 REA A C16 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1911
>_refine.occupancy_min                            ? 
>HETATM 1108 C C17 . REA B 2 .   ? 23.292 29.620 15.948 1.00 13.42 ? 200 REA A C17 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1912
>_refine.occupancy_max                            ? 
>HETATM 1109 C C18 . REA B 2 .   ? 19.791 26.449 16.947 1.00 12.61 ? 200 REA A C18 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1913
>_refine.B_iso_mean                               16.6 
>HETATM 1110 C C19 . REA B 2 .   ? 24.181 26.841 20.385 1.00 10.08 ? 200 REA A C19 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1914
>_refine.aniso_B[1][1]                            ? 
>HETATM 1111 C C20 . REA B 2 .   ? 24.303 23.747 24.489 1.00 10.10 ? 200 REA A C20 1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1915
>_refine.aniso_B[2][2]                            ? 
>HETATM 1112 O O1  . REA B 2 .   ? 23.640 21.075 25.978 1.00 13.29 ? 200 REA A O1  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1916
>_refine.aniso_B[3][3]                            ? 
>HETATM 1113 O O2  . REA B 2 .   ? 21.840 21.712 27.037 1.00 10.99 ? 200 REA A O2  1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1917
>_refine.aniso_B[1][2]                            ? 
>HETATM 1114 O O   . HOH C 3 .   ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1918
>_refine.aniso_B[1][3]                            ? 
>HETATM 1115 O O   . HOH C 3 .   ? 7.617  26.892 37.107 1.00 12.66 ? 301 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1919
>_refine.aniso_B[2][3]                            ? 
>HETATM 1116 O O   . HOH C 3 .   ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1920
>_refine.solvent_model_details                    ? 
>HETATM 1117 O O   . HOH C 3 .   ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1921
>_refine.solvent_model_param_ksol                 ? 
>HETATM 1118 O O   . HOH C 3 .   ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1922
>_refine.solvent_model_param_bsol                 ? 
>HETATM 1119 O O   . HOH C 3 .   ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1923
>_refine.pdbx_ls_cross_valid_method               ? 
>HETATM 1120 O O   . HOH C 3 .   ? 19.459 26.601 30.320 1.00 9.81  ? 306 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1924
>_refine.details                                  ? 
>HETATM 1121 O O   . HOH C 3 .   ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1925
>_refine.pdbx_starting_model                      ? 
>HETATM 1122 O O   . HOH C 3 .   ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1926
>_refine.pdbx_method_to_determine_struct          ? 
>HETATM 1123 O O   . HOH C 3 .   ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1927
>_refine.pdbx_isotropic_thermal_model             ? 
>HETATM 1124 O O   . HOH C 3 .   ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1928
>_refine.pdbx_stereochemistry_target_values       ? 
>HETATM 1125 O O   . HOH C 3 .   ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1929
>_refine.pdbx_stereochem_target_val_spec_case     ? 
>HETATM 1126 O O   . HOH C 3 .   ? 7.344  23.059 35.600 1.00 8.82  ? 312 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1930
>_refine.pdbx_R_Free_selection_details            ? 
>HETATM 1127 O O   . HOH C 3 .   ? 6.876  22.668 20.375 1.00 29.74 ? 313 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1931
>_refine.pdbx_overall_ESU_R                       ? 
>HETATM 1128 O O   . HOH C 3 .   ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1932
>_refine.pdbx_overall_ESU_R_Free                  ? 
>HETATM 1129 O O   . HOH C 3 .   ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1933
>_refine.overall_SU_ML                            ? 
>HETATM 1130 O O   . HOH C 3 .   ? 28.721 7.425  30.043 1.00 14.94 ? 316 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1934
>_refine.overall_SU_B                             ? 
>HETATM 1131 O O   . HOH C 3 .   ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1935
>_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
>HETATM 1132 O O   . HOH C 3 .   ? 6.094  9.777  39.151 1.00 13.98 ? 318 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1936
>_refine.pdbx_diffrn_id                           1 
>HETATM 1133 O O   . HOH C 3 .   ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1937
>_refine.pdbx_TLS_residual_ADP_flag               ? 
>HETATM 1134 O O   . HOH C 3 .   ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1938
>_refine.correlation_coeff_Fo_to_Fc               ? 
>HETATM 1135 O O   . HOH C 3 .   ? 25.244 34.269 18.193 1.00 9.65  ? 321 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1939
>_refine.correlation_coeff_Fo_to_Fc_free          ? 
>HETATM 1136 O O   . HOH C 3 .   ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1940
>_refine.pdbx_solvent_vdw_probe_radii             ? 
>HETATM 1137 O O   . HOH C 3 .   ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1941
>_refine.pdbx_solvent_ion_probe_radii             ? 
>HETATM 1138 O O   . HOH C 3 .   ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1942
>_refine.pdbx_solvent_shrinkage_radii             ? 
>HETATM 1139 O O   . HOH C 3 .   ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1943
>_refine.pdbx_overall_phase_error                 ? 
>HETATM 1140 O O   . HOH C 3 .   ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1944
>_refine.overall_SU_R_Cruickshank_DPI             ? 
>HETATM 1141 O O   . HOH C 3 .   ? 4.514  21.426 18.685 1.00 45.94 ? 327 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1945
>_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
>HETATM 1142 O O   . HOH C 3 .   ? 8.081  23.201 17.690 1.00 30.16 ? 328 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1946
>_refine.pdbx_overall_SU_R_Blow_DPI               ? 
>HETATM 1143 O O   . HOH C 3 .   ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1947
>_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
>HETATM 1144 O O   . HOH C 3 .   ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1948
># 
>HETATM 1145 O O   . HOH C 3 .   ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1949
>_reflns.entry_id                     1CBS 
>HETATM 1146 O O   . HOH C 3 .   ? 5.189  16.418 31.375 1.00 35.78 ? 332 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1950
>_reflns.observed_criterion_sigma_I   3. 
>HETATM 1147 O O   . HOH C 3 .   ? 0.738  25.633 36.349 1.00 29.00 ? 333 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1951
>_reflns.observed_criterion_sigma_F   ? 
>HETATM 1148 O O   . HOH C 3 .   ? 2.976  28.966 37.321 1.00 40.14 ? 334 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1952
>_reflns.d_resolution_low             ? 
>HETATM 1149 O O   . HOH C 3 .   ? 6.424  28.750 38.849 1.00 32.17 ? 335 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1953
>_reflns.d_resolution_high            ? 
>HETATM 1150 O O   . HOH C 3 .   ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1954
>_reflns.number_obs                   14678 
>HETATM 1151 O O   . HOH C 3 .   ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1955
>_reflns.number_all                   ? 
>HETATM 1152 O O   . HOH C 3 .   ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1956
>_reflns.percent_possible_obs         90.3 
>HETATM 1153 O O   . HOH C 3 .   ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1957
>_reflns.pdbx_Rmerge_I_obs            ? 
>HETATM 1154 O O   . HOH C 3 .   ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1958
>_reflns.pdbx_Rsym_value              ? 
>HETATM 1155 O O   . HOH C 3 .   ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1959
>_reflns.pdbx_netI_over_sigmaI        ? 
>HETATM 1156 O O   . HOH C 3 .   ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1960
>_reflns.B_iso_Wilson_estimate        ? 
>HETATM 1157 O O   . HOH C 3 .   ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1961
>_reflns.pdbx_redundancy              ? 
>HETATM 1158 O O   . HOH C 3 .   ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1962
>_reflns.pdbx_diffrn_id               1 
>HETATM 1159 O O   . HOH C 3 .   ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1963
>_reflns.pdbx_ordinal                 1 
>HETATM 1160 O O   . HOH C 3 .   ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1964
># 
>HETATM 1161 O O   . HOH C 3 .   ? 3.502  22.911 43.083 1.00 30.15 ? 347 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1965
>_diffrn_radiation_wavelength.id           1 
>HETATM 1162 O O   . HOH C 3 .   ? 20.610 7.668  40.212 1.00 49.06 ? 348 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1966
>_diffrn_radiation_wavelength.wavelength   . 
>HETATM 1163 O O   . HOH C 3 .   ? 24.813 2.899  36.403 1.00 48.98 ? 349 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1967
>_diffrn_radiation_wavelength.wt           1.0 
>HETATM 1164 O O   . HOH C 3 .   ? 29.900 5.163  26.918 1.00 23.60 ? 350 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1968
># 
>HETATM 1165 O O   . HOH C 3 .   ? 14.333 5.466  42.757 1.00 22.90 ? 351 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1969
>_diffrn_radiation.diffrn_id                        1 
>HETATM 1166 O O   . HOH C 3 .   ? 8.914  5.771  35.515 1.00 35.92 ? 352 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1970
>_diffrn_radiation.wavelength_id                    1 
>HETATM 1167 O O   . HOH C 3 .   ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1971
>_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
>HETATM 1168 O O   . HOH C 3 .   ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1972
>_diffrn_radiation.monochromator                    ? 
>HETATM 1169 O O   . HOH C 3 .   ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1973
>_diffrn_radiation.pdbx_diffrn_protocol             ? 
>HETATM 1170 O O   . HOH C 3 .   ? 12.491 24.840 7.594  1.00 39.45 ? 356 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1974
>_diffrn_radiation.pdbx_scattering_type             x-ray 
>HETATM 1171 O O   . HOH C 3 .   ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1975
># 
>HETATM 1172 O O   . HOH C 3 .   ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1976
>_diffrn.id                     1 
>HETATM 1173 O O   . HOH C 3 .   ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1977
>_diffrn.ambient_temp           ? 
>HETATM 1174 O O   . HOH C 3 .   ? 11.358 8.880  19.119 1.00 24.31 ? 360 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1978
>_diffrn.ambient_temp_details   ? 
>HETATM 1175 O O   . HOH C 3 .   ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1979
>_diffrn.crystal_id             1 
>HETATM 1176 O O   . HOH C 3 .   ? 22.049 27.870 4.565  1.00 25.37 ? 362 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1980
># 
>HETATM 1177 O O   . HOH C 3 .   ? 11.533 6.689  34.501 1.00 29.92 ? 363 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1981
>_exptl_crystal.id                    1 
>HETATM 1178 O O   . HOH C 3 .   ? 13.269 4.551  36.338 1.00 45.75 ? 364 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1982
>_exptl_crystal.density_meas          ? 
>HETATM 1179 O O   . HOH C 3 .   ? 23.149 9.493  41.173 1.00 30.10 ? 365 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1983
>_exptl_crystal.density_Matthews      2.70 
>HETATM 1180 O O   . HOH C 3 .   ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1984
>_exptl_crystal.density_percent_sol   54.49 
>HETATM 1181 O O   . HOH C 3 .   ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1985
>_exptl_crystal.description           ? 
>HETATM 1182 O O   . HOH C 3 .   ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1986
># 
>HETATM 1183 O O   . HOH C 3 .   ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1987
>_exptl.entry_id          1CBS 
>HETATM 1184 O O   . HOH C 3 .   ? 31.928 9.444  23.294 1.00 46.07 ? 370 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1988
>_exptl.method            'X-RAY DIFFRACTION' 
>HETATM 1185 O O   . HOH C 3 .   ? 25.699 10.933 9.557  1.00 44.12 ? 371 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1989
>_exptl.crystals_number   ? 
>HETATM 1186 O O   . HOH C 3 .   ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1990
># 
>HETATM 1187 O O   . HOH C 3 .   ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1991
>loop_
>HETATM 1188 O O   . HOH C 3 .   ? 20.596 32.070 6.807  1.00 36.38 ? 374 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1992
>_chem_comp.id 
>HETATM 1189 O O   . HOH C 3 .   ? 17.126 28.421 9.515  1.00 23.81 ? 375 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1993
>_chem_comp.type 
>HETATM 1190 O O   . HOH C 3 .   ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1994
>_chem_comp.mon_nstd_flag 
>HETATM 1191 O O   . HOH C 3 .   ? 6.046  30.510 19.639 1.00 29.02 ? 377 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1995
>_chem_comp.name 
>HETATM 1192 O O   . HOH C 3 .   ? 9.543  16.072 11.145 1.00 50.91 ? 378 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1996
>_chem_comp.pdbx_synonyms 
>HETATM 1193 O O   . HOH C 3 .   ? 8.174  14.289 20.240 1.00 54.21 ? 379 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1997
>_chem_comp.formula 
>HETATM 1194 O O   . HOH C 3 .   ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1998
>_chem_comp.formula_weight 
>HETATM 1195 O O   . HOH C 3 .   ? 5.486  15.385 24.922 1.00 50.19 ? 381 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>1999
>ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
>HETATM 1196 O O   . HOH C 3 .   ? 6.038  21.424 43.276 1.00 46.64 ? 382 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2000
>ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
>HETATM 1197 O O   . HOH C 3 .   ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2001
>ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
>HETATM 1198 O O   . HOH C 3 .   ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2002
>ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
>HETATM 1199 O O   . HOH C 3 .   ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2003
>CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
>HETATM 1200 O O   . HOH C 3 .   ? 31.446 7.504  31.389 1.00 28.93 ? 386 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2004
>GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
>HETATM 1201 O O   . HOH C 3 .   ? 18.212 20.893 5.892  1.00 29.90 ? 387 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2005
>GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
>HETATM 1202 O O   . HOH C 3 .   ? 15.148 27.608 7.685  1.00 30.91 ? 388 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2006
>GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
>HETATM 1203 O O   . HOH C 3 .   ? 2.656  23.148 20.117 1.00 35.98 ? 389 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2007
>HOH non-polymer         . WATER           ? 'H2 O'           18.015  
>HETATM 1204 O O   . HOH C 3 .   ? 3.100  22.690 28.640 1.00 31.31 ? 390 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2008
>ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
>HETATM 1205 O O   . HOH C 3 .   ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2009
>LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
>HETATM 1206 O O   . HOH C 3 .   ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2010
>LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
>HETATM 1207 O O   . HOH C 3 .   ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2011
>MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
>HETATM 1208 O O   . HOH C 3 .   ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2012
>PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
>HETATM 1209 O O   . HOH C 3 .   ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2013
>PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
>HETATM 1210 O O   . HOH C 3 .   ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2014
>REA non-polymer         . 'RETINOIC ACID' ? 'C20 H28 O2'     300.435 
>HETATM 1211 O O   . HOH C 3 .   ? 1.988  27.992 43.589 1.00 33.97 ? 397 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2015
>SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
>HETATM 1212 O O   . HOH C 3 .   ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2016
>THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
>HETATM 1213 O O   . HOH C 3 .   ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2017
>TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2018
>TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2019
>VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
>_pdbx_poly_seq_scheme.asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2020
># 
>_pdbx_poly_seq_scheme.entity_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2021
>_struct_ref_seq.align_id                      1 
>_pdbx_poly_seq_scheme.seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2022
>_struct_ref_seq.ref_id                        1 
>_pdbx_poly_seq_scheme.mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2023
>_struct_ref_seq.pdbx_PDB_id_code              1CBS 
>_pdbx_poly_seq_scheme.ndb_seq_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2024
>_struct_ref_seq.pdbx_strand_id                A 
>_pdbx_poly_seq_scheme.pdb_seq_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2025
>_struct_ref_seq.seq_align_beg                 1 
>_pdbx_poly_seq_scheme.auth_seq_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2026
>_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
>_pdbx_poly_seq_scheme.pdb_mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2027
>_struct_ref_seq.seq_align_end                 137 
>_pdbx_poly_seq_scheme.auth_mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2028
>_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
>_pdbx_poly_seq_scheme.pdb_strand_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2029
>_struct_ref_seq.pdbx_db_accession             P29373 
>_pdbx_poly_seq_scheme.pdb_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2030
>_struct_ref_seq.db_align_beg                  1 
>_pdbx_poly_seq_scheme.hetero 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2031
>_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
>A 1 1   PRO 1   1   1   PRO PRO A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2032
>_struct_ref_seq.db_align_end                  137 
>A 1 2   ASN 2   2   2   ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2033
>_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
>A 1 3   PHE 3   3   3   PHE PHE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2034
>_struct_ref_seq.pdbx_auth_seq_align_beg       1 
>A 1 4   SER 4   4   4   SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2035
>_struct_ref_seq.pdbx_auth_seq_align_end       137 
>A 1 5   GLY 5   5   5   GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2036
># 
>A 1 6   ASN 6   6   6   ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2037
>_struct_ref.id                         1 
>A 1 7   TRP 7   7   7   TRP TRP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2038
>_struct_ref.db_name                    UNP 
>A 1 8   LYS 8   8   8   LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2039
>_struct_ref.db_code                    RABP2_HUMAN 
>A 1 9   ILE 9   9   9   ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2040
>_struct_ref.entity_id                  1 
>A 1 10  ILE 10  10  10  ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2041
>_struct_ref.pdbx_db_accession          P29373 
>A 1 11  ARG 11  11  11  ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2042
>_struct_ref.pdbx_align_begin           1 
>A 1 12  SER 12  12  12  SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2043
>_struct_ref.pdbx_seq_one_letter_code   
>A 1 13  GLU 13  13  13  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2044
>;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
>A 1 14  ASN 14  14  14  ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2045
>CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
>A 1 15  PHE 15  15  15  PHE PHE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2046
>;
>A 1 16  GLU 16  16  16  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2047
>_struct_ref.pdbx_db_isoform            ? 
>A 1 17  GLU 17  17  17  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2048
># 
>A 1 18  LEU 18  18  18  LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2049
>_entity_src_gen.entity_id                          1 
>A 1 19  LEU 19  19  19  LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2050
>_entity_src_gen.pdbx_src_id                        1 
>A 1 20  LYS 20  20  20  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2051
>_entity_src_gen.pdbx_alt_source_flag               sample 
>A 1 21  VAL 21  21  21  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2052
>_entity_src_gen.pdbx_seq_type                      ? 
>A 1 22  LEU 22  22  22  LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2053
>_entity_src_gen.pdbx_beg_seq_num                   ? 
>A 1 23  GLY 23  23  23  GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2054
>_entity_src_gen.pdbx_end_seq_num                   ? 
>A 1 24  VAL 24  24  24  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2055
>_entity_src_gen.gene_src_common_name               human 
>A 1 25  ASN 25  25  25  ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2056
>_entity_src_gen.gene_src_genus                     Homo 
>A 1 26  VAL 26  26  26  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2057
>_entity_src_gen.pdbx_gene_src_gene                 'HUMAN CRABP-II' 
>A 1 27  MET 27  27  27  MET MET A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2058
>_entity_src_gen.gene_src_species                   ? 
>A 1 28  LEU 28  28  28  LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2059
>_entity_src_gen.gene_src_strain                    ? 
>A 1 29  ARG 29  29  29  ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2060
>_entity_src_gen.gene_src_tissue                    ? 
>A 1 30  LYS 30  30  30  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2061
>_entity_src_gen.gene_src_tissue_fraction           ? 
>A 1 31  ILE 31  31  31  ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2062
>_entity_src_gen.gene_src_details                   ? 
>A 1 32  ALA 32  32  32  ALA ALA A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2063
>_entity_src_gen.pdbx_gene_src_fragment             ? 
>A 1 33  VAL 33  33  33  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2064
>_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
>A 1 34  ALA 34  34  34  ALA ALA A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2065
>_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
>A 1 35  ALA 35  35  35  ALA ALA A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2066
>_entity_src_gen.pdbx_gene_src_variant              ? 
>A 1 36  ALA 36  36  36  ALA ALA A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2067
>_entity_src_gen.pdbx_gene_src_cell_line            BL21 
>A 1 37  SER 37  37  37  SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2068
>_entity_src_gen.pdbx_gene_src_atcc                 ? 
>A 1 38  LYS 38  38  38  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2069
>_entity_src_gen.pdbx_gene_src_organ                ? 
>A 1 39  PRO 39  39  39  PRO PRO A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2070
>_entity_src_gen.pdbx_gene_src_organelle            ? 
>A 1 40  ALA 40  40  40  ALA ALA A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2071
>_entity_src_gen.pdbx_gene_src_cell                 ? 
>A 1 41  VAL 41  41  41  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2072
>_entity_src_gen.pdbx_gene_src_cellular_location    ? 
>A 1 42  GLU 42  42  42  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2073
>_entity_src_gen.host_org_common_name               ? 
>A 1 43  ILE 43  43  43  ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2074
>_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
>A 1 44  LYS 44  44  44  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2075
>_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
>A 1 45  GLN 45  45  45  GLN GLN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2076
>_entity_src_gen.host_org_genus                     Escherichia 
>A 1 46  GLU 46  46  46  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2077
>_entity_src_gen.pdbx_host_org_gene                 ? 
>A 1 47  GLY 47  47  47  GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2078
>_entity_src_gen.pdbx_host_org_organ                ? 
>A 1 48  ASP 48  48  48  ASP ASP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2079
>_entity_src_gen.host_org_species                   'Escherichia coli' 
>A 1 49  THR 49  49  49  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2080
>_entity_src_gen.pdbx_host_org_tissue               ? 
>A 1 50  PHE 50  50  50  PHE PHE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2081
>_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
>A 1 51  TYR 51  51  51  TYR TYR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2082
>_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
>A 1 52  ILE 52  52  52  ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2083
>_entity_src_gen.pdbx_host_org_variant              ? 
>A 1 53  LYS 53  53  53  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2084
>_entity_src_gen.pdbx_host_org_cell_line            ? 
>A 1 54  THR 54  54  54  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2085
>_entity_src_gen.pdbx_host_org_atcc                 ? 
>A 1 55  SER 55  55  55  SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2086
>_entity_src_gen.pdbx_host_org_culture_collection   ? 
>A 1 56  THR 56  56  56  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2087
>_entity_src_gen.pdbx_host_org_cell                 ? 
>A 1 57  THR 57  57  57  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2088
>_entity_src_gen.pdbx_host_org_organelle            ? 
>A 1 58  VAL 58  58  58  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2089
>_entity_src_gen.pdbx_host_org_cellular_location    ? 
>A 1 59  ARG 59  59  59  ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2090
>_entity_src_gen.pdbx_host_org_vector_type          ? 
>A 1 60  THR 60  60  60  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2091
>_entity_src_gen.pdbx_host_org_vector               ? 
>A 1 61  THR 61  61  61  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2092
>_entity_src_gen.host_org_details                   ? 
>A 1 62  GLU 62  62  62  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2093
>_entity_src_gen.expression_system_id               ? 
>A 1 63  ILE 63  63  63  ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2094
>_entity_src_gen.plasmid_name                       PET-3A 
>A 1 64  ASN 64  64  64  ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2095
>_entity_src_gen.plasmid_details                    ? 
>A 1 65  PHE 65  65  65  PHE PHE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2096
>_entity_src_gen.pdbx_description                   ? 
>A 1 66  LYS 66  66  66  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2097
># 
>A 1 67  VAL 67  67  67  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2098
>loop_
>A 1 68  GLY 68  68  68  GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2099
>_entity_poly_seq.entity_id 
>A 1 69  GLU 69  69  69  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2100
>_entity_poly_seq.num 
>A 1 70  GLU 70  70  70  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2101
>_entity_poly_seq.mon_id 
>A 1 71  PHE 71  71  71  PHE PHE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2102
>_entity_poly_seq.hetero 
>A 1 72  GLU 72  72  72  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2103
>1 1   PRO n 
>A 1 73  GLU 73  73  73  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2104
>1 2   ASN n 
>A 1 74  GLN 74  74  74  GLN GLN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2105
>1 3   PHE n 
>A 1 75  THR 75  75  75  THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2106
>1 4   SER n 
>A 1 76  VAL 76  76  76  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2107
>1 5   GLY n 
>A 1 77  ASP 77  77  77  ASP ASP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2108
>1 6   ASN n 
>A 1 78  GLY 78  78  78  GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2109
>1 7   TRP n 
>A 1 79  ARG 79  79  79  ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2110
>1 8   LYS n 
>A 1 80  PRO 80  80  80  PRO PRO A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2111
>1 9   ILE n 
>A 1 81  CYS 81  81  81  CYS CYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2112
>1 10  ILE n 
>A 1 82  LYS 82  82  82  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2113
>1 11  ARG n 
>A 1 83  SER 83  83  83  SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2114
>1 12  SER n 
>A 1 84  LEU 84  84  84  LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2115
>1 13  GLU n 
>A 1 85  VAL 85  85  85  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2116
>1 14  ASN n 
>A 1 86  LYS 86  86  86  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2117
>1 15  PHE n 
>A 1 87  TRP 87  87  87  TRP TRP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2118
>1 16  GLU n 
>A 1 88  GLU 88  88  88  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2119
>1 17  GLU n 
>A 1 89  SER 89  89  89  SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2120
>1 18  LEU n 
>A 1 90  GLU 90  90  90  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2121
>1 19  LEU n 
>A 1 91  ASN 91  91  91  ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2122
>1 20  LYS n 
>A 1 92  LYS 92  92  92  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2123
>1 21  VAL n 
>A 1 93  MET 93  93  93  MET MET A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2124
>1 22  LEU n 
>A 1 94  VAL 94  94  94  VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2125
>1 23  GLY n 
>A 1 95  CYS 95  95  95  CYS CYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2126
>1 24  VAL n 
>A 1 96  GLU 96  96  96  GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2127
>1 25  ASN n 
>A 1 97  GLN 97  97  97  GLN GLN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2128
>1 26  VAL n 
>A 1 98  LYS 98  98  98  LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2129
>1 27  MET n 
>A 1 99  LEU 99  99  99  LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2130
>1 28  LEU n 
>A 1 100 LEU 100 100 100 LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2131
>1 29  ARG n 
>A 1 101 LYS 101 101 101 LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2132
>1 30  LYS n 
>A 1 102 GLY 102 102 102 GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2133
>1 31  ILE n 
>A 1 103 GLU 103 103 103 GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2134
>1 32  ALA n 
>A 1 104 GLY 104 104 104 GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2135
>1 33  VAL n 
>A 1 105 PRO 105 105 105 PRO PRO A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2136
>1 34  ALA n 
>A 1 106 LYS 106 106 106 LYS LYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2137
>1 35  ALA n 
>A 1 107 THR 107 107 107 THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2138
>1 36  ALA n 
>A 1 108 SER 108 108 108 SER SER A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2139
>1 37  SER n 
>A 1 109 TRP 109 109 109 TRP TRP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2140
>1 38  LYS n 
>A 1 110 THR 110 110 110 THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2141
>1 39  PRO n 
>A 1 111 ARG 111 111 111 ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2142
>1 40  ALA n 
>A 1 112 GLU 112 112 112 GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2143
>1 41  VAL n 
>A 1 113 LEU 113 113 113 LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2144
>1 42  GLU n 
>A 1 114 THR 114 114 114 THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2145
>1 43  ILE n 
>A 1 115 ASN 115 115 115 ASN ASN A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2146
>1 44  LYS n 
>A 1 116 ASP 116 116 116 ASP ASP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2147
>1 45  GLN n 
>A 1 117 GLY 117 117 117 GLY GLY A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2148
>1 46  GLU n 
>A 1 118 GLU 118 118 118 GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2149
>1 47  GLY n 
>A 1 119 LEU 119 119 119 LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2150
>1 48  ASP n 
>A 1 120 ILE 120 120 120 ILE ILE A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2151
>1 49  THR n 
>A 1 121 LEU 121 121 121 LEU LEU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2152
>1 50  PHE n 
>A 1 122 THR 122 122 122 THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2153
>1 51  TYR n 
>A 1 123 MET 123 123 123 MET MET A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2154
>1 52  ILE n 
>A 1 124 THR 124 124 124 THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2155
>1 53  LYS n 
>A 1 125 ALA 125 125 125 ALA ALA A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2156
>1 54  THR n 
>A 1 126 ASP 126 126 126 ASP ASP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2157
>1 55  SER n 
>A 1 127 ASP 127 127 127 ASP ASP A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2158
>1 56  THR n 
>A 1 128 VAL 128 128 128 VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2159
>1 57  THR n 
>A 1 129 VAL 129 129 129 VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2160
>1 58  VAL n 
>A 1 130 CYS 130 130 130 CYS CYS A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2161
>1 59  ARG n 
>A 1 131 THR 131 131 131 THR THR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2162
>1 60  THR n 
>A 1 132 ARG 132 132 132 ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2163
>1 61  THR n 
>A 1 133 VAL 133 133 133 VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2164
>1 62  GLU n 
>A 1 134 TYR 134 134 134 TYR TYR A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2165
>1 63  ILE n 
>A 1 135 VAL 135 135 135 VAL VAL A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2166
>1 64  ASN n 
>A 1 136 ARG 136 136 136 ARG ARG A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2167
>1 65  PHE n 
>A 1 137 GLU 137 137 137 GLU GLU A . n 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2168
>1 66  LYS n 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2169
>1 67  VAL n 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2170
>1 68  GLY n 
>_pdbx_nonpoly_scheme.asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2171
>1 69  GLU n 
>_pdbx_nonpoly_scheme.entity_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2172
>1 70  GLU n 
>_pdbx_nonpoly_scheme.mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2173
>1 71  PHE n 
>_pdbx_nonpoly_scheme.ndb_seq_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2174
>1 72  GLU n 
>_pdbx_nonpoly_scheme.pdb_seq_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2175
>1 73  GLU n 
>_pdbx_nonpoly_scheme.auth_seq_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2176
>1 74  GLN n 
>_pdbx_nonpoly_scheme.pdb_mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2177
>1 75  THR n 
>_pdbx_nonpoly_scheme.auth_mon_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2178
>1 76  VAL n 
>_pdbx_nonpoly_scheme.pdb_strand_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2179
>1 77  ASP n 
>_pdbx_nonpoly_scheme.pdb_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2180
>1 78  GLY n 
>B 2 REA 1   200 200 REA REA A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2181
>1 79  ARG n 
>C 3 HOH 1   300 300 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2182
>1 80  PRO n 
>C 3 HOH 2   301 301 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2183
>1 81  CYS n 
>C 3 HOH 3   302 302 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2184
>1 82  LYS n 
>C 3 HOH 4   303 303 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2185
>1 83  SER n 
>C 3 HOH 5   304 304 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2186
>1 84  LEU n 
>C 3 HOH 6   305 305 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2187
>1 85  VAL n 
>C 3 HOH 7   306 306 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2188
>1 86  LYS n 
>C 3 HOH 8   307 307 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2189
>1 87  TRP n 
>C 3 HOH 9   308 308 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2190
>1 88  GLU n 
>C 3 HOH 10  309 309 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2191
>1 89  SER n 
>C 3 HOH 11  310 310 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2192
>1 90  GLU n 
>C 3 HOH 12  311 311 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2193
>1 91  ASN n 
>C 3 HOH 13  312 312 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2194
>1 92  LYS n 
>C 3 HOH 14  313 313 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2195
>1 93  MET n 
>C 3 HOH 15  314 314 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2196
>1 94  VAL n 
>C 3 HOH 16  315 315 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2197
>1 95  CYS n 
>C 3 HOH 17  316 316 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2198
>1 96  GLU n 
>C 3 HOH 18  317 317 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2199
>1 97  GLN n 
>C 3 HOH 19  318 318 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2200
>1 98  LYS n 
>C 3 HOH 20  319 319 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2201
>1 99  LEU n 
>C 3 HOH 21  320 320 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2202
>1 100 LEU n 
>C 3 HOH 22  321 321 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2203
>1 101 LYS n 
>C 3 HOH 23  322 322 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2204
>1 102 GLY n 
>C 3 HOH 24  323 323 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2205
>1 103 GLU n 
>C 3 HOH 25  324 324 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2206
>1 104 GLY n 
>C 3 HOH 26  325 325 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2207
>1 105 PRO n 
>C 3 HOH 27  326 326 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2208
>1 106 LYS n 
>C 3 HOH 28  327 327 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2209
>1 107 THR n 
>C 3 HOH 29  328 328 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2210
>1 108 SER n 
>C 3 HOH 30  329 329 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2211
>1 109 TRP n 
>C 3 HOH 31  330 330 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2212
>1 110 THR n 
>C 3 HOH 32  331 331 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2213
>1 111 ARG n 
>C 3 HOH 33  332 332 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2214
>1 112 GLU n 
>C 3 HOH 34  333 333 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2215
>1 113 LEU n 
>C 3 HOH 35  334 334 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2216
>1 114 THR n 
>C 3 HOH 36  335 335 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2217
>1 115 ASN n 
>C 3 HOH 37  336 336 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2218
>1 116 ASP n 
>C 3 HOH 38  337 337 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2219
>1 117 GLY n 
>C 3 HOH 39  338 338 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2220
>1 118 GLU n 
>C 3 HOH 40  339 339 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2221
>1 119 LEU n 
>C 3 HOH 41  340 340 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2222
>1 120 ILE n 
>C 3 HOH 42  341 341 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2223
>1 121 LEU n 
>C 3 HOH 43  342 342 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2224
>1 122 THR n 
>C 3 HOH 44  343 343 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2225
>1 123 MET n 
>C 3 HOH 45  344 344 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2226
>1 124 THR n 
>C 3 HOH 46  345 345 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2227
>1 125 ALA n 
>C 3 HOH 47  346 346 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2228
>1 126 ASP n 
>C 3 HOH 48  347 347 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2229
>1 127 ASP n 
>C 3 HOH 49  348 348 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2230
>1 128 VAL n 
>C 3 HOH 50  349 349 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2231
>1 129 VAL n 
>C 3 HOH 51  350 350 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2232
>1 130 CYS n 
>C 3 HOH 52  351 351 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2233
>1 131 THR n 
>C 3 HOH 53  352 352 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2234
>1 132 ARG n 
>C 3 HOH 54  353 353 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2235
>1 133 VAL n 
>C 3 HOH 55  354 354 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2236
>1 134 TYR n 
>C 3 HOH 56  355 355 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2237
>1 135 VAL n 
>C 3 HOH 57  356 356 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2238
>1 136 ARG n 
>C 3 HOH 58  357 357 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2239
>1 137 GLU n 
>C 3 HOH 59  358 358 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2240
># 
>C 3 HOH 60  359 359 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2241
>_entity_poly.entity_id                      1 
>C 3 HOH 61  360 360 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2242
>_entity_poly.type                           polypeptide(L) 
>C 3 HOH 62  361 361 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2243
>_entity_poly.nstd_linkage                   no 
>C 3 HOH 63  362 362 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2244
>_entity_poly.nstd_monomer                   no 
>C 3 HOH 64  363 363 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2245
>_entity_poly.pdbx_seq_one_letter_code       
>C 3 HOH 65  364 364 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2246
>;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
>C 3 HOH 66  365 365 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2247
>CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
>C 3 HOH 67  366 366 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2248
>;
>C 3 HOH 68  367 367 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2249
>_entity_poly.pdbx_seq_one_letter_code_can   
>C 3 HOH 69  368 368 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2250
>;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
>C 3 HOH 70  369 369 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2251
>CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
>C 3 HOH 71  370 370 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2252
>;
>C 3 HOH 72  371 371 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2253
>_entity_poly.pdbx_strand_id                 A 
>C 3 HOH 73  372 372 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2254
>_entity_poly.pdbx_target_identifier         ? 
>C 3 HOH 74  373 373 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2255
># 
>C 3 HOH 75  374 374 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2256
>loop_
>C 3 HOH 76  375 375 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2257
>_entity.id 
>C 3 HOH 77  376 376 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2258
>_entity.type 
>C 3 HOH 78  377 377 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2259
>_entity.src_method 
>C 3 HOH 79  378 378 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2260
>_entity.pdbx_description 
>C 3 HOH 80  379 379 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2261
>_entity.formula_weight 
>C 3 HOH 81  380 380 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2262
>_entity.pdbx_number_of_molecules 
>C 3 HOH 82  381 381 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2263
>_entity.pdbx_ec 
>C 3 HOH 83  382 382 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2264
>_entity.pdbx_mutation 
>C 3 HOH 84  383 383 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2265
>_entity.pdbx_fragment 
>C 3 HOH 85  384 384 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2266
>_entity.details 
>C 3 HOH 86  385 385 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2267
>1 polymer     man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1   ? ? ? ? 
>C 3 HOH 87  386 386 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2268
>2 non-polymer syn 'RETINOIC ACID'                                  300.435   1   ? ? ? ? 
>C 3 HOH 88  387 387 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2269
>3 water       nat water                                            18.015    100 ? ? ? ? 
>C 3 HOH 89  388 388 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2270
># 
>C 3 HOH 90  389 389 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2271
>_symmetry.entry_id                         1CBS 
>C 3 HOH 91  390 390 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2272
>_symmetry.space_group_name_H-M             'P 21 21 21' 
>C 3 HOH 92  391 391 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2273
>_symmetry.pdbx_full_space_group_name_H-M   ? 
>C 3 HOH 93  392 392 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2274
>_symmetry.cell_setting                     ? 
>C 3 HOH 94  393 393 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2275
>_symmetry.Int_Tables_number                19 
>C 3 HOH 95  394 394 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2276
># 
>C 3 HOH 96  395 395 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2277
>_cell.entry_id           1CBS 
>C 3 HOH 97  396 396 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2278
>_cell.length_a           45.650 
>C 3 HOH 98  397 397 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2279
>_cell.length_b           47.560 
>C 3 HOH 99  398 398 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2280
>_cell.length_c           77.610 
>C 3 HOH 100 399 399 HOH HOH A . 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2281
>_cell.angle_alpha        90.00 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2282
>_cell.angle_beta         90.00 
>_pdbx_struct_assembly.id                   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2283
>_cell.angle_gamma        90.00 
>_pdbx_struct_assembly.details              author_defined_assembly 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2284
>_cell.Z_PDB              4 
>_pdbx_struct_assembly.method_details       ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2285
>_cell.pdbx_unique_axis   ? 
>_pdbx_struct_assembly.oligomeric_details   monomeric 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2286
># 
>_pdbx_struct_assembly.oligomeric_count     1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2287
>loop_
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2288
>_citation_author.citation_id 
>_pdbx_struct_assembly_gen.assembly_id       1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2289
>_citation_author.name 
>_pdbx_struct_assembly_gen.oper_expression   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2290
>_citation_author.ordinal 
>_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2291
>primary 'Kleywegt, G.J.' 1  
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2292
>primary 'Bergfors, T.'   2  
>_pdbx_struct_oper_list.id                   1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2293
>primary 'Senn, H.'       3  
>_pdbx_struct_oper_list.type                 'identity operation' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2294
>primary 'Le Motte, P.'   4  
>_pdbx_struct_oper_list.name                 1_555 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2295
>primary 'Gsell, B.'      5  
>_pdbx_struct_oper_list.symmetry_operation   x,y,z 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2296
>primary 'Shudo, K.'      6  
>_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2297
>primary 'Jones, T.A.'    7  
>_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2298
>1       'Banaszak, L.'   8  
>_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2299
>1       'Winter, N.'     9  
>_pdbx_struct_oper_list.vector[1]            0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2300
>1       'Xu, Z.'         10 
>_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2301
>1       'Bernlohr, D.A.' 11 
>_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2302
>1       'Cowan, S.W.'    12 
>_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2303
>1       'Jones, T.A.'    13 
>_pdbx_struct_oper_list.vector[2]            0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2304
>2       'Bergfors, T.'   14 
>_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2305
>2       'Kleywegt, G.J.' 15 
>_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2306
>2       'Jones, T.A.'    16 
>_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2307
>3       'Cowan, S.W.'    17 
>_pdbx_struct_oper_list.vector[3]            0.0000000000 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2308
>3       'Newcomer, M.E.' 18 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2309
>3       'Jones, T.A.'    19 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2310
>4       'Jones, T.A.'    20 
>_pdbx_audit_revision_history.ordinal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2311
>4       'Bergfors, T.'   21 
>_pdbx_audit_revision_history.data_content_type 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2312
>4       'Sedzik, J.'     22 
>_pdbx_audit_revision_history.major_revision 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2313
>4       'Unge, T.'       23 
>_pdbx_audit_revision_history.minor_revision 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2314
># 
>_pdbx_audit_revision_history.revision_date 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2315
>loop_
>1 'Structure model' 1 0 1995-01-26 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2316
>_citation.id 
>2 'Structure model' 1 1 2008-03-24 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2317
>_citation.title 
>3 'Structure model' 1 2 2011-07-13 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2318
>_citation.journal_abbrev 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2319
>_citation.journal_volume 
>_pdbx_audit_revision_details.ordinal             1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2320
>_citation.page_first 
>_pdbx_audit_revision_details.revision_ordinal    1 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2321
>_citation.page_last 
>_pdbx_audit_revision_details.data_content_type   'Structure model' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2322
>_citation.year 
>_pdbx_audit_revision_details.provider            repository 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2323
>_citation.journal_id_ASTM 
>_pdbx_audit_revision_details.type                'Initial release' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2324
>_citation.country 
>_pdbx_audit_revision_details.description         ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2325
>_citation.journal_id_ISSN 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2326
>_citation.journal_id_CSD 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2327
>_citation.book_publisher 
>_pdbx_audit_revision_group.ordinal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2328
>_citation.pdbx_database_id_PubMed 
>_pdbx_audit_revision_group.revision_ordinal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2329
>_citation.pdbx_database_id_DOI 
>_pdbx_audit_revision_group.data_content_type 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2330
>primary 
>_pdbx_audit_revision_group.group 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2331
>;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid.
>1 2 'Structure model' 'Version format compliance' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2332
>;
>2 3 'Structure model' 'Version format compliance' 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2333
>Structure                  2   1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2334
>1       'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins'                              
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2335
>'Adv.Protein Chem.'        45  89   ?    1994 APCHA2 US 0065-3233 0433 ? ?       ?                             
>_software.name 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2336
>2       'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' 
>_software.classification 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2337
>'Acta Crystallogr.,Sect.D' 50  370  ?    1994 ABCRE6 DK 0907-4449 0766 ? ?       ?                             
>_software.version 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2338
>3       
>_software.citation_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2339
>;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol
>_software.pdbx_ordinal 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2340
>;
>_software.date 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2341
>J.Mol.Biol.                230 1225 ?    1993 JMOBAK UK 0022-2836 0070 ? ?       ?                             
>X-PLOR 'model building' . ? 1 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2342
>4       'The Three-Dimensional Structure of P2 Myelin Protein'                                                        
>X-PLOR refinement       . ? 2 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2343
>'Embo J.'                  7   1597 ?    1988 EMJODG UK 0261-4189 0897 ? ?       ?                             
>X-PLOR phasing          . ? 3 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2344
># 
>dssp   other            ? ? 4 ? 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2345
>loop_
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2346
>_audit_author.name 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2347
>_audit_author.pdbx_ordinal 
>_pdbx_validate_torsion.id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2348
>'Kleywegt, G.J.' 1 
>_pdbx_validate_torsion.PDB_model_num 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2349
>'Bergfors, T.'   2 
>_pdbx_validate_torsion.auth_comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2350
>'Jones, T.A.'    3 
>_pdbx_validate_torsion.auth_asym_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2351
># 
>_pdbx_validate_torsion.auth_seq_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2352
>_pdbx_database_status.status_code                     REL 
>_pdbx_validate_torsion.PDB_ins_code 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2353
>_pdbx_database_status.entry_id                        1CBS 
>_pdbx_validate_torsion.label_alt_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2354
>_pdbx_database_status.recvd_initial_deposition_date   1994-09-28 
>_pdbx_validate_torsion.phi 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2355
>_pdbx_database_status.deposit_site                    ? 
>_pdbx_validate_torsion.psi 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2356
>_pdbx_database_status.process_site                    ? 
>1 1 GLU A 73  ? ? -144.94 -154.28 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2357
>_pdbx_database_status.status_code_sf                  REL 
>2 1 ASP A 126 ? ? 55.69   -115.96 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2358
>_pdbx_database_status.status_code_mr                  ? 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2359
>_pdbx_database_status.SG_entry                        ? 
>loop_
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2360
>_pdbx_database_status.pdb_format_compatible           Y 
>_pdbx_entity_nonpoly.entity_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2361
>_pdbx_database_status.status_code_cs                  ? 
>_pdbx_entity_nonpoly.name 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2362
># 
>_pdbx_entity_nonpoly.comp_id 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2363
>loop_
>2 'RETINOIC ACID' REA 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2364
>_database_2.database_id 
>3 water           HOH 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>2365
>_database_2.database_code 
># 
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(114): [1;31;49merror: in "ut_mmcif": check done_r == done_t has failed [true != false][0;39;49m
>/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(126): [1;31;49merror: in "ut_mmcif": check test.eof() has failed[0;39;49m
>
>[1;31;49m*** 2363 failures are detected in the test module "DSSP_Test"
>[0;39;49m
><end of output>
>Test time =   0.39 sec
>----------------------------------------------------------
>Test Failed.
>"unit-test" end time: Mar 10 09:26 CET
>"unit-test" time elapsed: 00:00:00
>----------------------------------------------------------
>
>End testing: Mar 10 09:26 CET

Actions: View

Attachments on bug 834882: 766725