Go to:
Gentoo Home
Documentation
Forums
Lists
Bugs
Planet
Store
Wiki
Get Gentoo!
Gentoo's Bugzilla – Attachment 766725 Details for
Bug 834882
sci-chemistry/dssp-4.0.3 fails tests
Home
|
New
–
[Ex]
|
Browse
|
Search
|
Privacy Policy
|
[?]
|
Reports
|
Requests
|
Help
|
New Account
|
Log In
[x]
|
Forgot Password
Login:
[x]
LastTest.log
LastTest.log (text/x-log), 663.35 KB, created by
Jakov Smolić
on 2022-03-10 08:31:45 UTC
(
hide
)
Description:
LastTest.log
Filename:
MIME Type:
Creator:
Jakov Smolić
Created:
2022-03-10 08:31:45 UTC
Size:
663.35 KB
patch
obsolete
>Start testing: Mar 10 09:26 CET >---------------------------------------------------------- >1/1 Testing: unit-test >1/1 Test: unit-test >Command: "/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3_build/unit-test" >Directory: /var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test >"unit-test" start time: Mar 10 09:26 CET >Output: >---------------------------------------------------------- >Running 2 test cases... >5 >_audit_conform.dict_name mmcif_pdbx_v50 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >6 >_audit_conform.dict_version ? >_database_2.database_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >7 ># >_database_2.database_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >8 >loop_ >PDB 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >9 >_software.name >WWPDB D_1000172215 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >10 >_software.classification ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >11 >_software.version >_pdbx_database_status.status_code REL >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >12 >_software.citation_id >_pdbx_database_status.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >13 >_software.pdbx_ordinal >_pdbx_database_status.recvd_initial_deposition_date 1994-09-28 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >14 >_software.date >_pdbx_database_status.deposit_site ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >15 >X-PLOR 'model building' . ? 1 ? >_pdbx_database_status.process_site ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >16 >X-PLOR refinement . ? 2 ? >_pdbx_database_status.status_code_sf REL >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >17 >X-PLOR phasing . ? 3 ? >_pdbx_database_status.status_code_mr ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >18 >dssp other ? ? 4 ? >_pdbx_database_status.SG_entry ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >19 ># >_pdbx_database_status.pdb_format_compatible Y >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >20 >loop_ >_pdbx_database_status.status_code_cs ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >21 >_pdbx_poly_seq_scheme.asym_id ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >22 >_pdbx_poly_seq_scheme.entity_id >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >23 >_pdbx_poly_seq_scheme.seq_id >_audit_author.name >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >24 >_pdbx_poly_seq_scheme.mon_id >_audit_author.pdbx_ordinal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >25 >_pdbx_poly_seq_scheme.ndb_seq_num >'Kleywegt, G.J.' 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >26 >_pdbx_poly_seq_scheme.pdb_seq_num >'Bergfors, T.' 2 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >27 >_pdbx_poly_seq_scheme.auth_seq_num >'Jones, T.A.' 3 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >28 >_pdbx_poly_seq_scheme.pdb_mon_id ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >29 >_pdbx_poly_seq_scheme.auth_mon_id >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >30 >_pdbx_poly_seq_scheme.pdb_strand_id >_citation.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >31 >_pdbx_poly_seq_scheme.pdb_ins_code >_citation.title >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >32 >_pdbx_poly_seq_scheme.hetero >_citation.journal_abbrev >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >33 >A 1 1 PRO 1 1 1 PRO PRO A . n >_citation.journal_volume >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >34 >A 1 2 ASN 2 2 2 ASN ASN A . n >_citation.page_first >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >35 >A 1 3 PHE 3 3 3 PHE PHE A . n >_citation.page_last >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >36 >A 1 4 SER 4 4 4 SER SER A . n >_citation.year >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >37 >A 1 5 GLY 5 5 5 GLY GLY A . n >_citation.journal_id_ASTM >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >38 >A 1 6 ASN 6 6 6 ASN ASN A . n >_citation.country >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >39 >A 1 7 TRP 7 7 7 TRP TRP A . n >_citation.journal_id_ISSN >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >40 >A 1 8 LYS 8 8 8 LYS LYS A . n >_citation.journal_id_CSD >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >41 >A 1 9 ILE 9 9 9 ILE ILE A . n >_citation.book_publisher >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >42 >A 1 10 ILE 10 10 10 ILE ILE A . n >_citation.pdbx_database_id_PubMed >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >43 >A 1 11 ARG 11 11 11 ARG ARG A . n >_citation.pdbx_database_id_DOI >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >44 >A 1 12 SER 12 12 12 SER SER A . n >primary >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >45 >A 1 13 GLU 13 13 13 GLU GLU A . n >;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid. >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >46 >A 1 14 ASN 14 14 14 ASN ASN A . n >; >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >47 >A 1 15 PHE 15 15 15 PHE PHE A . n >Structure 2 1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >48 >A 1 16 GLU 16 16 16 GLU GLU A . n >1 'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >49 >A 1 17 GLU 17 17 17 GLU GLU A . n >'Adv.Protein Chem.' 45 89 ? 1994 APCHA2 US 0065-3233 0433 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >50 >A 1 18 LEU 18 18 18 LEU LEU A . n >2 'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >51 >A 1 19 LEU 19 19 19 LEU LEU A . n >'Acta Crystallogr.,Sect.D' 50 370 ? 1994 ABCRE6 DK 0907-4449 0766 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >52 >A 1 20 LYS 20 20 20 LYS LYS A . n >3 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >53 >A 1 21 VAL 21 21 21 VAL VAL A . n >;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >54 >A 1 22 LEU 22 22 22 LEU LEU A . n >; >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >55 >A 1 23 GLY 23 23 23 GLY GLY A . n >J.Mol.Biol. 230 1225 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >56 >A 1 24 VAL 24 24 24 VAL VAL A . n >4 'The Three-Dimensional Structure of P2 Myelin Protein' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >57 >A 1 25 ASN 25 25 25 ASN ASN A . n >'Embo J.' 7 1597 ? 1988 EMJODG UK 0261-4189 0897 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >58 >A 1 26 VAL 26 26 26 VAL VAL A . n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >59 >A 1 27 MET 27 27 27 MET MET A . n >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >60 >A 1 28 LEU 28 28 28 LEU LEU A . n >_citation_author.citation_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >61 >A 1 29 ARG 29 29 29 ARG ARG A . n >_citation_author.name >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >62 >A 1 30 LYS 30 30 30 LYS LYS A . n >_citation_author.ordinal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >63 >A 1 31 ILE 31 31 31 ILE ILE A . n >primary 'Kleywegt, G.J.' 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >64 >A 1 32 ALA 32 32 32 ALA ALA A . n >primary 'Bergfors, T.' 2 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >65 >A 1 33 VAL 33 33 33 VAL VAL A . n >primary 'Senn, H.' 3 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >66 >A 1 34 ALA 34 34 34 ALA ALA A . n >primary 'Le Motte, P.' 4 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >67 >A 1 35 ALA 35 35 35 ALA ALA A . n >primary 'Gsell, B.' 5 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >68 >A 1 36 ALA 36 36 36 ALA ALA A . n >primary 'Shudo, K.' 6 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >69 >A 1 37 SER 37 37 37 SER SER A . n >primary 'Jones, T.A.' 7 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >70 >A 1 38 LYS 38 38 38 LYS LYS A . n >1 'Banaszak, L.' 8 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >71 >A 1 39 PRO 39 39 39 PRO PRO A . n >1 'Winter, N.' 9 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >72 >A 1 40 ALA 40 40 40 ALA ALA A . n >1 'Xu, Z.' 10 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >73 >A 1 41 VAL 41 41 41 VAL VAL A . n >1 'Bernlohr, D.A.' 11 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >74 >A 1 42 GLU 42 42 42 GLU GLU A . n >1 'Cowan, S.W.' 12 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >75 >A 1 43 ILE 43 43 43 ILE ILE A . n >1 'Jones, T.A.' 13 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >76 >A 1 44 LYS 44 44 44 LYS LYS A . n >2 'Bergfors, T.' 14 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >77 >A 1 45 GLN 45 45 45 GLN GLN A . n >2 'Kleywegt, G.J.' 15 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >78 >A 1 46 GLU 46 46 46 GLU GLU A . n >2 'Jones, T.A.' 16 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >79 >A 1 47 GLY 47 47 47 GLY GLY A . n >3 'Cowan, S.W.' 17 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >80 >A 1 48 ASP 48 48 48 ASP ASP A . n >3 'Newcomer, M.E.' 18 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >81 >A 1 49 THR 49 49 49 THR THR A . n >3 'Jones, T.A.' 19 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >82 >A 1 50 PHE 50 50 50 PHE PHE A . n >4 'Jones, T.A.' 20 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >83 >A 1 51 TYR 51 51 51 TYR TYR A . n >4 'Bergfors, T.' 21 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >84 >A 1 52 ILE 52 52 52 ILE ILE A . n >4 'Sedzik, J.' 22 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >85 >A 1 53 LYS 53 53 53 LYS LYS A . n >4 'Unge, T.' 23 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >86 >A 1 54 THR 54 54 54 THR THR A . n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >87 >A 1 55 SER 55 55 55 SER SER A . n >_cell.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >88 >A 1 56 THR 56 56 56 THR THR A . n >_cell.length_a 45.650 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >89 >A 1 57 THR 57 57 57 THR THR A . n >_cell.length_b 47.560 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >90 >A 1 58 VAL 58 58 58 VAL VAL A . n >_cell.length_c 77.610 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >91 >A 1 59 ARG 59 59 59 ARG ARG A . n >_cell.angle_alpha 90.00 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >92 >A 1 60 THR 60 60 60 THR THR A . n >_cell.angle_beta 90.00 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >93 >A 1 61 THR 61 61 61 THR THR A . n >_cell.angle_gamma 90.00 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >94 >A 1 62 GLU 62 62 62 GLU GLU A . n >_cell.Z_PDB 4 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >95 >A 1 63 ILE 63 63 63 ILE ILE A . n >_cell.pdbx_unique_axis ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >96 >A 1 64 ASN 64 64 64 ASN ASN A . n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >97 >A 1 65 PHE 65 65 65 PHE PHE A . n >_symmetry.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >98 >A 1 66 LYS 66 66 66 LYS LYS A . n >_symmetry.space_group_name_H-M 'P 21 21 21' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >99 >A 1 67 VAL 67 67 67 VAL VAL A . n >_symmetry.pdbx_full_space_group_name_H-M ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >100 >A 1 68 GLY 68 68 68 GLY GLY A . n >_symmetry.cell_setting ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >101 >A 1 69 GLU 69 69 69 GLU GLU A . n >_symmetry.Int_Tables_number 19 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >102 >A 1 70 GLU 70 70 70 GLU GLU A . n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >103 >A 1 71 PHE 71 71 71 PHE PHE A . n >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >104 >A 1 72 GLU 72 72 72 GLU GLU A . n >_entity.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >105 >A 1 73 GLU 73 73 73 GLU GLU A . n >_entity.type >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >106 >A 1 74 GLN 74 74 74 GLN GLN A . n >_entity.src_method >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >107 >A 1 75 THR 75 75 75 THR THR A . n >_entity.pdbx_description >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >108 >A 1 76 VAL 76 76 76 VAL VAL A . n >_entity.formula_weight >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >109 >A 1 77 ASP 77 77 77 ASP ASP A . n >_entity.pdbx_number_of_molecules >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >110 >A 1 78 GLY 78 78 78 GLY GLY A . n >_entity.pdbx_ec >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >111 >A 1 79 ARG 79 79 79 ARG ARG A . n >_entity.pdbx_mutation >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >112 >A 1 80 PRO 80 80 80 PRO PRO A . n >_entity.pdbx_fragment >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >113 >A 1 81 CYS 81 81 81 CYS CYS A . n >_entity.details >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >114 >A 1 82 LYS 82 82 82 LYS LYS A . n >1 polymer man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1 ? ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >115 >A 1 83 SER 83 83 83 SER SER A . n >2 non-polymer syn 'RETINOIC ACID' 300.435 1 ? ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >116 >A 1 84 LEU 84 84 84 LEU LEU A . n >3 water nat water 18.015 100 ? ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >117 >A 1 85 VAL 85 85 85 VAL VAL A . n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >118 >A 1 86 LYS 86 86 86 LYS LYS A . n >_entity_poly.entity_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >119 >A 1 87 TRP 87 87 87 TRP TRP A . n >_entity_poly.type polypeptide(L) >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >120 >A 1 88 GLU 88 88 88 GLU GLU A . n >_entity_poly.nstd_linkage no >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >121 >A 1 89 SER 89 89 89 SER SER A . n >_entity_poly.nstd_monomer no >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >122 >A 1 90 GLU 90 90 90 GLU GLU A . n >_entity_poly.pdbx_seq_one_letter_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >123 >A 1 91 ASN 91 91 91 ASN ASN A . n >;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >124 >A 1 92 LYS 92 92 92 LYS LYS A . n >CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >125 >A 1 93 MET 93 93 93 MET MET A . n >; >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >126 >A 1 94 VAL 94 94 94 VAL VAL A . n >_entity_poly.pdbx_seq_one_letter_code_can >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >127 >A 1 95 CYS 95 95 95 CYS CYS A . n >;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >128 >A 1 96 GLU 96 96 96 GLU GLU A . n >CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >129 >A 1 97 GLN 97 97 97 GLN GLN A . n >; >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >130 >A 1 98 LYS 98 98 98 LYS LYS A . n >_entity_poly.pdbx_strand_id A >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >131 >A 1 99 LEU 99 99 99 LEU LEU A . n >_entity_poly.pdbx_target_identifier ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >132 >A 1 100 LEU 100 100 100 LEU LEU A . n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >133 >A 1 101 LYS 101 101 101 LYS LYS A . n >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >134 >A 1 102 GLY 102 102 102 GLY GLY A . n >_entity_poly_seq.entity_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >135 >A 1 103 GLU 103 103 103 GLU GLU A . n >_entity_poly_seq.num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >136 >A 1 104 GLY 104 104 104 GLY GLY A . n >_entity_poly_seq.mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >137 >A 1 105 PRO 105 105 105 PRO PRO A . n >_entity_poly_seq.hetero >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >138 >A 1 106 LYS 106 106 106 LYS LYS A . n >1 1 PRO n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >139 >A 1 107 THR 107 107 107 THR THR A . n >1 2 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >140 >A 1 108 SER 108 108 108 SER SER A . n >1 3 PHE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >141 >A 1 109 TRP 109 109 109 TRP TRP A . n >1 4 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >142 >A 1 110 THR 110 110 110 THR THR A . n >1 5 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >143 >A 1 111 ARG 111 111 111 ARG ARG A . n >1 6 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >144 >A 1 112 GLU 112 112 112 GLU GLU A . n >1 7 TRP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >145 >A 1 113 LEU 113 113 113 LEU LEU A . n >1 8 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >146 >A 1 114 THR 114 114 114 THR THR A . n >1 9 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >147 >A 1 115 ASN 115 115 115 ASN ASN A . n >1 10 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >148 >A 1 116 ASP 116 116 116 ASP ASP A . n >1 11 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >149 >A 1 117 GLY 117 117 117 GLY GLY A . n >1 12 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >150 >A 1 118 GLU 118 118 118 GLU GLU A . n >1 13 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >151 >A 1 119 LEU 119 119 119 LEU LEU A . n >1 14 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >152 >A 1 120 ILE 120 120 120 ILE ILE A . n >1 15 PHE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >153 >A 1 121 LEU 121 121 121 LEU LEU A . n >1 16 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >154 >A 1 122 THR 122 122 122 THR THR A . n >1 17 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >155 >A 1 123 MET 123 123 123 MET MET A . n >1 18 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >156 >A 1 124 THR 124 124 124 THR THR A . n >1 19 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >157 >A 1 125 ALA 125 125 125 ALA ALA A . n >1 20 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >158 >A 1 126 ASP 126 126 126 ASP ASP A . n >1 21 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >159 >A 1 127 ASP 127 127 127 ASP ASP A . n >1 22 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >160 >A 1 128 VAL 128 128 128 VAL VAL A . n >1 23 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >161 >A 1 129 VAL 129 129 129 VAL VAL A . n >1 24 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >162 >A 1 130 CYS 130 130 130 CYS CYS A . n >1 25 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >163 >A 1 131 THR 131 131 131 THR THR A . n >1 26 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >164 >A 1 132 ARG 132 132 132 ARG ARG A . n >1 27 MET n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >165 >A 1 133 VAL 133 133 133 VAL VAL A . n >1 28 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >166 >A 1 134 TYR 134 134 134 TYR TYR A . n >1 29 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >167 >A 1 135 VAL 135 135 135 VAL VAL A . n >1 30 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >168 >A 1 136 ARG 136 136 136 ARG ARG A . n >1 31 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >169 >A 1 137 GLU 137 137 137 GLU GLU A . n >1 32 ALA n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >170 ># >1 33 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >171 >loop_ >1 34 ALA n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >172 >_struct_conf.conf_type_id >1 35 ALA n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >173 >_struct_conf.id >1 36 ALA n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >174 >_struct_conf.pdbx_PDB_helix_id >1 37 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >175 >_struct_conf.beg_label_comp_id >1 38 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >176 >_struct_conf.beg_label_asym_id >1 39 PRO n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >177 >_struct_conf.beg_label_seq_id >1 40 ALA n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >178 >_struct_conf.pdbx_beg_PDB_ins_code >1 41 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >179 >_struct_conf.end_label_comp_id >1 42 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >180 >_struct_conf.end_label_asym_id >1 43 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >181 >_struct_conf.end_label_seq_id >1 44 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >182 >_struct_conf.pdbx_end_PDB_ins_code >1 45 GLN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >183 >_struct_conf.beg_auth_comp_id >1 46 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >184 >_struct_conf.beg_auth_asym_id >1 47 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >185 >_struct_conf.beg_auth_seq_id >1 48 ASP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >186 >_struct_conf.end_auth_comp_id >1 49 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >187 >_struct_conf.end_auth_asym_id >1 50 PHE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >188 >_struct_conf.end_auth_seq_id >1 51 TYR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >189 >_struct_conf.pdbx_PDB_helix_class >1 52 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >190 >_struct_conf.details >1 53 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >191 >_struct_conf.pdbx_PDB_helix_length >1 54 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >192 >OTHER OTHER1 ? PRO A 1 ? SER A 4 ? PRO A 1 SER A 4 ? ? ? >1 55 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >193 >STRN STRN1 ? GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 ? ? ? >1 56 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >194 >BEND BEND1 ? ASN A 14 ? ASN A 14 ? ASN A 14 ASN A 14 ? ? ? >1 57 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >195 >HELX_RH_AL_P HELX_RH_AL_P1 ? PHE A 15 ? VAL A 21 ? PHE A 15 VAL A 21 ? ? ? >1 58 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >196 >TURN_TY1_P TURN_TY1_P1 ? LEU A 22 ? GLY A 23 ? LEU A 22 GLY A 23 ? ? ? >1 59 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >197 >OTHER OTHER2 ? VAL A 24 ? ASN A 25 ? VAL A 24 ASN A 25 ? ? ? >1 60 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >198 >HELX_RH_AL_P HELX_RH_AL_P2 ? VAL A 26 ? ALA A 36 ? VAL A 26 ALA A 36 ? ? ? >1 61 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >199 >TURN_TY1_P TURN_TY1_P2 ? SER A 37 ? SER A 37 ? SER A 37 SER A 37 ? ? ? >1 62 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >200 >BEND BEND2 ? LYS A 38 ? LYS A 38 ? LYS A 38 LYS A 38 ? ? ? >1 63 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >201 >OTHER OTHER3 ? PRO A 39 ? PRO A 39 ? PRO A 39 PRO A 39 ? ? ? >1 64 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >202 >STRN STRN2 ? ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 ? ? ? >1 65 PHE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >203 >TURN_TY1_P TURN_TY1_P3 ? GLY A 47 ? ASP A 48 ? GLY A 47 ASP A 48 ? ? ? >1 66 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >204 >STRN STRN3 ? THR A 49 ? SER A 55 ? THR A 49 SER A 55 ? ? ? >1 67 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >205 >OTHER OTHER4 ? THR A 56 ? THR A 56 ? THR A 56 THR A 56 ? ? ? >1 68 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >206 >BEND BEND3 ? THR A 57 ? VAL A 58 ? THR A 57 VAL A 58 ? ? ? >1 69 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >207 >OTHER OTHER5 ? ARG A 59 ? ARG A 59 ? ARG A 59 ARG A 59 ? ? ? >1 70 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >208 >STRN STRN4 ? THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 ? ? ? >1 71 PHE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >209 >TURN_TY1_P TURN_TY1_P4 ? VAL A 67 ? GLY A 68 ? VAL A 67 GLY A 68 ? ? ? >1 72 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >210 >BEND BEND4 ? GLU A 69 ? GLU A 69 ? GLU A 69 GLU A 69 ? ? ? >1 73 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >211 >OTHER OTHER6 ? GLU A 70 ? GLU A 70 ? GLU A 70 GLU A 70 ? ? ? >1 74 GLN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >212 >STRN STRN5 ? PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 ? ? ? >1 75 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >213 >OTHER OTHER7 ? THR A 75 ? THR A 75 ? THR A 75 THR A 75 ? ? ? >1 76 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >214 >TURN_TY1_P TURN_TY1_P5 ? VAL A 76 ? ASP A 77 ? VAL A 76 ASP A 77 ? ? ? >1 77 ASP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >215 >BEND BEND5 ? GLY A 78 ? GLY A 78 ? GLY A 78 GLY A 78 ? ? ? >1 78 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >216 >OTHER OTHER8 ? ARG A 79 ? ARG A 79 ? ARG A 79 ARG A 79 ? ? ? >1 79 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >217 >STRN STRN6 ? PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 ? ? ? >1 80 PRO n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >218 >TURN_TY1_P TURN_TY1_P6 ? GLU A 90 ? ASN A 91 ? GLU A 90 ASN A 91 ? ? ? >1 81 CYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >219 >STRN STRN7 ? LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 ? ? ? >1 82 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >220 >BEND BEND6 ? LEU A 100 ? GLY A 102 ? LEU A 100 GLY A 102 ? ? ? >1 83 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >221 >OTHER OTHER9 ? GLU A 103 ? LYS A 106 ? GLU A 103 LYS A 106 ? ? ? >1 84 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >222 >STRN STRN8 ? THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 ? ? ? >1 85 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >223 >OTHER OTHER10 ? THR A 114 ? THR A 114 ? THR A 114 THR A 114 ? ? ? >1 86 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >224 >TURN_TY1_P TURN_TY1_P7 ? ASN A 115 ? ASP A 116 ? ASN A 115 ASP A 116 ? ? ? >1 87 TRP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >225 >BEND BEND7 ? GLY A 117 ? GLY A 117 ? GLY A 117 GLY A 117 ? ? ? >1 88 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >226 >OTHER OTHER11 ? GLU A 118 ? GLU A 118 ? GLU A 118 GLU A 118 ? ? ? >1 89 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >227 >STRN STRN9 ? LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 ? ? ? >1 90 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >228 >TURN_TY1_P TURN_TY1_P8 ? ASP A 126 ? ASP A 127 ? ASP A 126 ASP A 127 ? ? ? >1 91 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >229 >STRN STRN10 ? VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 ? ? ? >1 92 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >230 >OTHER OTHER12 ? GLU A 137 ? GLU A 137 ? GLU A 137 GLU A 137 ? ? ? >1 93 MET n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >231 ># >1 94 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >232 >loop_ >1 95 CYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >233 >_struct_conf_type.id >1 96 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >234 >_struct_conf_type.criteria >1 97 GLN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >235 >_struct_conf_type.reference >1 98 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >236 >OTHER DSSP ? >1 99 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >237 >STRN DSSP ? >1 100 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >238 >BEND DSSP ? >1 101 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >239 >HELX_RH_AL_P DSSP ? >1 102 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >240 >TURN_TY1_P DSSP ? >1 103 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >241 ># >1 104 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >242 >loop_ >1 105 PRO n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >243 >_pdbx_nonpoly_scheme.asym_id >1 106 LYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >244 >_pdbx_nonpoly_scheme.entity_id >1 107 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >245 >_pdbx_nonpoly_scheme.mon_id >1 108 SER n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >246 >_pdbx_nonpoly_scheme.ndb_seq_num >1 109 TRP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >247 >_pdbx_nonpoly_scheme.pdb_seq_num >1 110 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >248 >_pdbx_nonpoly_scheme.auth_seq_num >1 111 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >249 >_pdbx_nonpoly_scheme.pdb_mon_id >1 112 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >250 >_pdbx_nonpoly_scheme.auth_mon_id >1 113 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >251 >_pdbx_nonpoly_scheme.pdb_strand_id >1 114 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >252 >_pdbx_nonpoly_scheme.pdb_ins_code >1 115 ASN n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >253 >B 2 REA 1 200 200 REA REA A . >1 116 ASP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >254 >C 3 HOH 1 300 300 HOH HOH A . >1 117 GLY n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >255 >C 3 HOH 2 301 301 HOH HOH A . >1 118 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >256 >C 3 HOH 3 302 302 HOH HOH A . >1 119 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >257 >C 3 HOH 4 303 303 HOH HOH A . >1 120 ILE n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >258 >C 3 HOH 5 304 304 HOH HOH A . >1 121 LEU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >259 >C 3 HOH 6 305 305 HOH HOH A . >1 122 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >260 >C 3 HOH 7 306 306 HOH HOH A . >1 123 MET n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >261 >C 3 HOH 8 307 307 HOH HOH A . >1 124 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >262 >C 3 HOH 9 308 308 HOH HOH A . >1 125 ALA n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >263 >C 3 HOH 10 309 309 HOH HOH A . >1 126 ASP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >264 >C 3 HOH 11 310 310 HOH HOH A . >1 127 ASP n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >265 >C 3 HOH 12 311 311 HOH HOH A . >1 128 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >266 >C 3 HOH 13 312 312 HOH HOH A . >1 129 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >267 >C 3 HOH 14 313 313 HOH HOH A . >1 130 CYS n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >268 >C 3 HOH 15 314 314 HOH HOH A . >1 131 THR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >269 >C 3 HOH 16 315 315 HOH HOH A . >1 132 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >270 >C 3 HOH 17 316 316 HOH HOH A . >1 133 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >271 >C 3 HOH 18 317 317 HOH HOH A . >1 134 TYR n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >272 >C 3 HOH 19 318 318 HOH HOH A . >1 135 VAL n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >273 >C 3 HOH 20 319 319 HOH HOH A . >1 136 ARG n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >274 >C 3 HOH 21 320 320 HOH HOH A . >1 137 GLU n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >275 >C 3 HOH 22 321 321 HOH HOH A . ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >276 >C 3 HOH 23 322 322 HOH HOH A . >_entity_src_gen.entity_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >277 >C 3 HOH 24 323 323 HOH HOH A . >_entity_src_gen.pdbx_src_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >278 >C 3 HOH 25 324 324 HOH HOH A . >_entity_src_gen.pdbx_alt_source_flag sample >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >279 >C 3 HOH 26 325 325 HOH HOH A . >_entity_src_gen.pdbx_seq_type ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >280 >C 3 HOH 27 326 326 HOH HOH A . >_entity_src_gen.pdbx_beg_seq_num ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >281 >C 3 HOH 28 327 327 HOH HOH A . >_entity_src_gen.pdbx_end_seq_num ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >282 >C 3 HOH 29 328 328 HOH HOH A . >_entity_src_gen.gene_src_common_name human >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >283 >C 3 HOH 30 329 329 HOH HOH A . >_entity_src_gen.gene_src_genus Homo >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >284 >C 3 HOH 31 330 330 HOH HOH A . >_entity_src_gen.pdbx_gene_src_gene 'HUMAN CRABP-II' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >285 >C 3 HOH 32 331 331 HOH HOH A . >_entity_src_gen.gene_src_species ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >286 >C 3 HOH 33 332 332 HOH HOH A . >_entity_src_gen.gene_src_strain ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >287 >C 3 HOH 34 333 333 HOH HOH A . >_entity_src_gen.gene_src_tissue ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >288 >C 3 HOH 35 334 334 HOH HOH A . >_entity_src_gen.gene_src_tissue_fraction ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >289 >C 3 HOH 36 335 335 HOH HOH A . >_entity_src_gen.gene_src_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >290 >C 3 HOH 37 336 336 HOH HOH A . >_entity_src_gen.pdbx_gene_src_fragment ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >291 >C 3 HOH 38 337 337 HOH HOH A . >_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >292 >C 3 HOH 39 338 338 HOH HOH A . >_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >293 >C 3 HOH 40 339 339 HOH HOH A . >_entity_src_gen.pdbx_gene_src_variant ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >294 >C 3 HOH 41 340 340 HOH HOH A . >_entity_src_gen.pdbx_gene_src_cell_line BL21 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >295 >C 3 HOH 42 341 341 HOH HOH A . >_entity_src_gen.pdbx_gene_src_atcc ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >296 >C 3 HOH 43 342 342 HOH HOH A . >_entity_src_gen.pdbx_gene_src_organ ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >297 >C 3 HOH 44 343 343 HOH HOH A . >_entity_src_gen.pdbx_gene_src_organelle ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >298 >C 3 HOH 45 344 344 HOH HOH A . >_entity_src_gen.pdbx_gene_src_cell ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >299 >C 3 HOH 46 345 345 HOH HOH A . >_entity_src_gen.pdbx_gene_src_cellular_location ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >300 >C 3 HOH 47 346 346 HOH HOH A . >_entity_src_gen.host_org_common_name ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >301 >C 3 HOH 48 347 347 HOH HOH A . >_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >302 >C 3 HOH 49 348 348 HOH HOH A . >_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >303 >C 3 HOH 50 349 349 HOH HOH A . >_entity_src_gen.host_org_genus Escherichia >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >304 >C 3 HOH 51 350 350 HOH HOH A . >_entity_src_gen.pdbx_host_org_gene ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >305 >C 3 HOH 52 351 351 HOH HOH A . >_entity_src_gen.pdbx_host_org_organ ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >306 >C 3 HOH 53 352 352 HOH HOH A . >_entity_src_gen.host_org_species 'Escherichia coli' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >307 >C 3 HOH 54 353 353 HOH HOH A . >_entity_src_gen.pdbx_host_org_tissue ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >308 >C 3 HOH 55 354 354 HOH HOH A . >_entity_src_gen.pdbx_host_org_tissue_fraction ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >309 >C 3 HOH 56 355 355 HOH HOH A . >_entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >310 >C 3 HOH 57 356 356 HOH HOH A . >_entity_src_gen.pdbx_host_org_variant ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >311 >C 3 HOH 58 357 357 HOH HOH A . >_entity_src_gen.pdbx_host_org_cell_line ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >312 >C 3 HOH 59 358 358 HOH HOH A . >_entity_src_gen.pdbx_host_org_atcc ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >313 >C 3 HOH 60 359 359 HOH HOH A . >_entity_src_gen.pdbx_host_org_culture_collection ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >314 >C 3 HOH 61 360 360 HOH HOH A . >_entity_src_gen.pdbx_host_org_cell ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >315 >C 3 HOH 62 361 361 HOH HOH A . >_entity_src_gen.pdbx_host_org_organelle ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >316 >C 3 HOH 63 362 362 HOH HOH A . >_entity_src_gen.pdbx_host_org_cellular_location ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >317 >C 3 HOH 64 363 363 HOH HOH A . >_entity_src_gen.pdbx_host_org_vector_type ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >318 >C 3 HOH 65 364 364 HOH HOH A . >_entity_src_gen.pdbx_host_org_vector ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >319 >C 3 HOH 66 365 365 HOH HOH A . >_entity_src_gen.host_org_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >320 >C 3 HOH 67 366 366 HOH HOH A . >_entity_src_gen.expression_system_id ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >321 >C 3 HOH 68 367 367 HOH HOH A . >_entity_src_gen.plasmid_name PET-3A >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >322 >C 3 HOH 69 368 368 HOH HOH A . >_entity_src_gen.plasmid_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >323 >C 3 HOH 70 369 369 HOH HOH A . >_entity_src_gen.pdbx_description ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >324 >C 3 HOH 71 370 370 HOH HOH A . ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >325 >C 3 HOH 72 371 371 HOH HOH A . >_struct_ref.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >326 >C 3 HOH 73 372 372 HOH HOH A . >_struct_ref.db_name UNP >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >327 >C 3 HOH 74 373 373 HOH HOH A . >_struct_ref.db_code RABP2_HUMAN >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >328 >C 3 HOH 75 374 374 HOH HOH A . >_struct_ref.entity_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >329 >C 3 HOH 76 375 375 HOH HOH A . >_struct_ref.pdbx_db_accession P29373 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >330 >C 3 HOH 77 376 376 HOH HOH A . >_struct_ref.pdbx_align_begin 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >331 >C 3 HOH 78 377 377 HOH HOH A . >_struct_ref.pdbx_seq_one_letter_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >332 >C 3 HOH 79 378 378 HOH HOH A . >;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >333 >C 3 HOH 80 379 379 HOH HOH A . >CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >334 >C 3 HOH 81 380 380 HOH HOH A . >; >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >335 >C 3 HOH 82 381 381 HOH HOH A . >_struct_ref.pdbx_db_isoform ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >336 >C 3 HOH 83 382 382 HOH HOH A . ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >337 >C 3 HOH 84 383 383 HOH HOH A . >_struct_ref_seq.align_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >338 >C 3 HOH 85 384 384 HOH HOH A . >_struct_ref_seq.ref_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >339 >C 3 HOH 86 385 385 HOH HOH A . >_struct_ref_seq.pdbx_PDB_id_code 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >340 >C 3 HOH 87 386 386 HOH HOH A . >_struct_ref_seq.pdbx_strand_id A >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >341 >C 3 HOH 88 387 387 HOH HOH A . >_struct_ref_seq.seq_align_beg 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >342 >C 3 HOH 89 388 388 HOH HOH A . >_struct_ref_seq.pdbx_seq_align_beg_ins_code ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >343 >C 3 HOH 90 389 389 HOH HOH A . >_struct_ref_seq.seq_align_end 137 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >344 >C 3 HOH 91 390 390 HOH HOH A . >_struct_ref_seq.pdbx_seq_align_end_ins_code ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >345 >C 3 HOH 92 391 391 HOH HOH A . >_struct_ref_seq.pdbx_db_accession P29373 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >346 >C 3 HOH 93 392 392 HOH HOH A . >_struct_ref_seq.db_align_beg 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >347 >C 3 HOH 94 393 393 HOH HOH A . >_struct_ref_seq.pdbx_db_align_beg_ins_code ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >348 >C 3 HOH 95 394 394 HOH HOH A . >_struct_ref_seq.db_align_end 137 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >349 >C 3 HOH 96 395 395 HOH HOH A . >_struct_ref_seq.pdbx_db_align_end_ins_code ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >350 >C 3 HOH 97 396 396 HOH HOH A . >_struct_ref_seq.pdbx_auth_seq_align_beg 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >351 >C 3 HOH 98 397 397 HOH HOH A . >_struct_ref_seq.pdbx_auth_seq_align_end 137 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >352 >C 3 HOH 99 398 398 HOH HOH A . ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >353 >C 3 HOH 100 399 399 HOH HOH A . >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >354 ># >_chem_comp.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >355 >loop_ >_chem_comp.type >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >356 >_atom_site.group_PDB >_chem_comp.mon_nstd_flag >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >357 >_atom_site.id >_chem_comp.name >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >358 >_atom_site.type_symbol >_chem_comp.pdbx_synonyms >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >359 >_atom_site.label_atom_id >_chem_comp.formula >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >360 >_atom_site.label_alt_id >_chem_comp.formula_weight >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >361 >_atom_site.label_comp_id >ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >362 >_atom_site.label_asym_id >ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >363 >_atom_site.label_entity_id >ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >364 >_atom_site.label_seq_id >ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >365 >_atom_site.pdbx_PDB_ins_code >CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >366 >_atom_site.Cartn_x >GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >367 >_atom_site.Cartn_y >GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >368 >_atom_site.Cartn_z >GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >369 >_atom_site.occupancy >HOH non-polymer . WATER ? 'H2 O' 18.015 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >370 >_atom_site.B_iso_or_equiv >ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >371 >_atom_site.pdbx_formal_charge >LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >372 >_atom_site.auth_seq_id >LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >373 >_atom_site.auth_comp_id >MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >374 >_atom_site.auth_asym_id >PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >375 >_atom_site.auth_atom_id >PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >376 >_atom_site.pdbx_PDB_model_num >REA non-polymer . 'RETINOIC ACID' ? 'C20 H28 O2' 300.435 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >377 >ATOM 1 N N . PRO A 1 1 ? 16.979 13.301 44.555 1.00 30.05 ? 1 PRO A N 1 >SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >378 >ATOM 2 C CA . PRO A 1 1 ? 18.150 13.525 43.680 1.00 28.82 ? 1 PRO A CA 1 >THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >379 >ATOM 3 C C . PRO A 1 1 ? 18.656 14.966 43.784 1.00 26.59 ? 1 PRO A C 1 >TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >380 >ATOM 4 O O . PRO A 1 1 ? 17.890 15.889 44.078 1.00 26.84 ? 1 PRO A O 1 >TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >381 >ATOM 5 C CB . PRO A 1 1 ? 17.678 13.270 42.255 1.00 29.24 ? 1 PRO A CB 1 >VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >382 >ATOM 6 C CG . PRO A 1 1 ? 16.248 13.734 42.347 1.00 29.29 ? 1 PRO A CG 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >383 >ATOM 7 C CD . PRO A 1 1 ? 15.762 13.216 43.724 1.00 30.71 ? 1 PRO A CD 1 >_exptl.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >384 >ATOM 8 N N . ASN A 1 2 ? 19.957 15.139 43.558 1.00 24.04 ? 2 ASN A N 1 >_exptl.method 'X-RAY DIFFRACTION' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >385 >ATOM 9 C CA . ASN A 1 2 ? 20.576 16.457 43.578 1.00 20.79 ? 2 ASN A CA 1 >_exptl.crystals_number ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >386 >ATOM 10 C C . ASN A 1 2 ? 21.301 16.714 42.262 1.00 16.75 ? 2 ASN A C 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >387 >ATOM 11 O O . ASN A 1 2 ? 22.402 16.215 42.028 1.00 15.23 ? 2 ASN A O 1 >_exptl_crystal.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >388 >ATOM 12 C CB . ASN A 1 2 ? 21.559 16.620 44.724 1.00 22.81 ? 2 ASN A CB 1 >_exptl_crystal.density_meas ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >389 >ATOM 13 C CG . ASN A 1 2 ? 22.240 17.968 44.685 1.00 24.29 ? 2 ASN A CG 1 >_exptl_crystal.density_Matthews 2.70 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >390 >ATOM 14 O OD1 . ASN A 1 2 ? 21.612 18.984 44.358 1.00 21.87 ? 2 ASN A OD1 1 >_exptl_crystal.density_percent_sol 54.49 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >391 >ATOM 15 N ND2 . ASN A 1 2 ? 23.537 17.983 44.966 1.00 27.94 ? 2 ASN A ND2 1 >_exptl_crystal.description ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >392 >ATOM 16 N N . PHE A 1 3 ? 20.637 17.477 41.402 1.00 14.69 ? 3 PHE A N 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >393 >ATOM 17 C CA . PHE A 1 3 ? 21.144 17.838 40.087 1.00 12.62 ? 3 PHE A CA 1 >_diffrn.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >394 >ATOM 18 C C . PHE A 1 3 ? 22.152 18.987 40.140 1.00 12.43 ? 3 PHE A C 1 >_diffrn.ambient_temp ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >395 >ATOM 19 O O . PHE A 1 3 ? 22.796 19.289 39.136 1.00 12.12 ? 3 PHE A O 1 >_diffrn.ambient_temp_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >396 >ATOM 20 C CB . PHE A 1 3 ? 19.970 18.262 39.188 1.00 10.74 ? 3 PHE A CB 1 >_diffrn.crystal_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >397 >ATOM 21 C CG . PHE A 1 3 ? 19.073 17.128 38.750 1.00 11.85 ? 3 PHE A CG 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >398 >ATOM 22 C CD1 . PHE A 1 3 ? 18.066 16.646 39.581 1.00 10.90 ? 3 PHE A CD1 1 >_diffrn_radiation.diffrn_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >399 >ATOM 23 C CD2 . PHE A 1 3 ? 19.189 16.588 37.475 1.00 13.26 ? 3 PHE A CD2 1 >_diffrn_radiation.wavelength_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >400 >ATOM 24 C CE1 . PHE A 1 3 ? 17.200 15.662 39.149 1.00 9.12 ? 3 PHE A CE1 1 >_diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >401 >ATOM 25 C CE2 . PHE A 1 3 ? 18.312 15.594 37.041 1.00 11.76 ? 3 PHE A CE2 1 >_diffrn_radiation.monochromator ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >402 >ATOM 26 C CZ . PHE A 1 3 ? 17.324 15.137 37.878 1.00 10.30 ? 3 PHE A CZ 1 >_diffrn_radiation.pdbx_diffrn_protocol ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >403 >ATOM 27 N N . SER A 1 4 ? 22.282 19.630 41.299 1.00 11.24 ? 4 SER A N 1 >_diffrn_radiation.pdbx_scattering_type x-ray >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >404 >ATOM 28 C CA . SER A 1 4 ? 23.170 20.780 41.464 1.00 11.30 ? 4 SER A CA 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >405 >ATOM 29 C C . SER A 1 4 ? 24.627 20.568 41.091 1.00 10.39 ? 4 SER A C 1 >_diffrn_radiation_wavelength.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >406 >ATOM 30 O O . SER A 1 4 ? 25.201 19.532 41.384 1.00 10.24 ? 4 SER A O 1 >_diffrn_radiation_wavelength.wavelength . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >407 >ATOM 31 C CB . SER A 1 4 ? 23.112 21.301 42.906 1.00 13.53 ? 4 SER A CB 1 >_diffrn_radiation_wavelength.wt 1.0 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >408 >ATOM 32 O OG . SER A 1 4 ? 21.821 21.787 43.240 1.00 16.76 ? 4 SER A OG 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >409 >ATOM 33 N N . GLY A 1 5 ? 25.224 21.572 40.460 1.00 9.87 ? 5 GLY A N 1 >_reflns.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >410 >ATOM 34 C CA . GLY A 1 5 ? 26.628 21.486 40.103 1.00 10.86 ? 5 GLY A CA 1 >_reflns.observed_criterion_sigma_I 3. >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >411 >ATOM 35 C C . GLY A 1 5 ? 26.985 22.158 38.794 1.00 11.21 ? 5 GLY A C 1 >_reflns.observed_criterion_sigma_F ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >412 >ATOM 36 O O . GLY A 1 5 ? 26.123 22.761 38.142 1.00 9.91 ? 5 GLY A O 1 >_reflns.d_resolution_low ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >413 >ATOM 37 N N . ASN A 1 6 ? 28.277 22.142 38.475 1.00 10.41 ? 6 ASN A N 1 >_reflns.d_resolution_high ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >414 >ATOM 38 C CA . ASN A 1 6 ? 28.796 22.676 37.211 1.00 11.06 ? 6 ASN A CA 1 >_reflns.number_obs 14678 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >415 >ATOM 39 C C . ASN A 1 6 ? 29.117 21.435 36.378 1.00 10.33 ? 6 ASN A C 1 >_reflns.number_all ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >416 >ATOM 40 O O . ASN A 1 6 ? 29.947 20.603 36.754 1.00 11.28 ? 6 ASN A O 1 >_reflns.percent_possible_obs 90.3 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >417 >ATOM 41 C CB . ASN A 1 6 ? 30.023 23.548 37.445 1.00 12.95 ? 6 ASN A CB 1 >_reflns.pdbx_Rmerge_I_obs ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >418 >ATOM 42 C CG . ASN A 1 6 ? 29.675 24.816 38.200 1.00 18.08 ? 6 ASN A CG 1 >_reflns.pdbx_Rsym_value ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >419 >ATOM 43 O OD1 . ASN A 1 6 ? 29.022 25.708 37.665 1.00 19.52 ? 6 ASN A OD1 1 >_reflns.pdbx_netI_over_sigmaI ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >420 >ATOM 44 N ND2 . ASN A 1 6 ? 30.047 24.872 39.467 1.00 21.23 ? 6 ASN A ND2 1 >_reflns.B_iso_Wilson_estimate ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >421 >ATOM 45 N N . TRP A 1 7 ? 28.399 21.289 35.272 1.00 8.66 ? 7 TRP A N 1 >_reflns.pdbx_redundancy ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >422 >ATOM 46 C CA . TRP A 1 7 ? 28.518 20.119 34.424 1.00 8.74 ? 7 TRP A CA 1 >_reflns.pdbx_diffrn_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >423 >ATOM 47 C C . TRP A 1 7 ? 29.246 20.352 33.092 1.00 9.63 ? 7 TRP A C 1 >_reflns.pdbx_ordinal 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >424 >ATOM 48 O O . TRP A 1 7 ? 29.064 21.389 32.440 1.00 9.45 ? 7 TRP A O 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >425 >ATOM 49 C CB . TRP A 1 7 ? 27.115 19.563 34.152 1.00 8.00 ? 7 TRP A CB 1 >_refine.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >426 >ATOM 50 C CG . TRP A 1 7 ? 26.325 19.198 35.391 1.00 8.01 ? 7 TRP A CG 1 >_refine.ls_number_reflns_obs 14312 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >427 >ATOM 51 C CD1 . TRP A 1 7 ? 25.556 20.031 36.159 1.00 8.29 ? 7 TRP A CD1 1 >_refine.ls_number_reflns_all ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >428 >ATOM 52 C CD2 . TRP A 1 7 ? 26.174 17.885 35.947 1.00 7.60 ? 7 TRP A CD2 1 >_refine.pdbx_ls_sigma_I ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >429 >ATOM 53 N NE1 . TRP A 1 7 ? 24.922 19.308 37.156 1.00 9.20 ? 7 TRP A NE1 1 >_refine.pdbx_ls_sigma_F 2. >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >430 >ATOM 54 C CE2 . TRP A 1 7 ? 25.286 17.987 37.046 1.00 8.73 ? 7 TRP A CE2 1 >_refine.pdbx_data_cutoff_high_absF ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >431 >ATOM 55 C CE3 . TRP A 1 7 ? 26.694 16.625 35.618 1.00 6.99 ? 7 TRP A CE3 1 >_refine.pdbx_data_cutoff_low_absF ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >432 >ATOM 56 C CZ2 . TRP A 1 7 ? 24.909 16.876 37.815 1.00 7.67 ? 7 TRP A CZ2 1 >_refine.pdbx_data_cutoff_high_rms_absF ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >433 >ATOM 57 C CZ3 . TRP A 1 7 ? 26.320 15.527 36.380 1.00 7.58 ? 7 TRP A CZ3 1 >_refine.ls_d_res_low 8.0 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >434 >ATOM 58 C CH2 . TRP A 1 7 ? 25.433 15.663 37.468 1.00 5.92 ? 7 TRP A CH2 1 >_refine.ls_d_res_high 1.8 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >435 >ATOM 59 N N . LYS A 1 8 ? 30.052 19.368 32.702 1.00 9.39 ? 8 LYS A N 1 >_refine.ls_percent_reflns_obs 90.3 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >436 >ATOM 60 C CA . LYS A 1 8 ? 30.802 19.424 31.450 1.00 11.56 ? 8 LYS A CA 1 >_refine.ls_R_factor_obs 0.2000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >437 >ATOM 61 C C . LYS A 1 8 ? 30.342 18.243 30.611 1.00 10.56 ? 8 LYS A C 1 >_refine.ls_R_factor_all ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >438 >ATOM 62 O O . LYS A 1 8 ? 30.091 17.158 31.138 1.00 10.14 ? 8 LYS A O 1 >_refine.ls_R_factor_R_work 0.2000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >439 >ATOM 63 C CB . LYS A 1 8 ? 32.308 19.360 31.710 1.00 15.20 ? 8 LYS A CB 1 >_refine.ls_R_factor_R_free 0.2370000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >440 >ATOM 64 C CG . LYS A 1 8 ? 32.785 18.080 32.313 1.00 18.52 ? 8 LYS A CG 1 >_refine.ls_R_factor_R_free_error ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >441 >ATOM 65 C CD . LYS A 1 8 ? 34.263 18.182 32.618 1.00 26.26 ? 8 LYS A CD 1 >_refine.ls_R_factor_R_free_error_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >442 >ATOM 66 C CE . LYS A 1 8 ? 35.091 18.499 31.378 1.00 29.22 ? 8 LYS A CE 1 >_refine.ls_percent_reflns_R_free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >443 >ATOM 67 N NZ . LYS A 1 8 ? 35.067 17.393 30.369 1.00 32.48 ? 8 LYS A NZ 1 >_refine.ls_number_reflns_R_free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >444 >ATOM 68 N N . ILE A 1 9 ? 30.222 18.447 29.308 1.00 8.21 ? 9 ILE A N 1 >_refine.ls_number_parameters ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >445 >ATOM 69 C CA . ILE A 1 9 ? 29.739 17.384 28.441 1.00 8.08 ? 9 ILE A CA 1 >_refine.ls_number_restraints ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >446 >ATOM 70 C C . ILE A 1 9 ? 30.798 16.325 28.117 1.00 7.86 ? 9 ILE A C 1 >_refine.occupancy_min ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >447 >ATOM 71 O O . ILE A 1 9 ? 31.990 16.635 28.028 1.00 8.38 ? 9 ILE A O 1 >_refine.occupancy_max ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >448 >ATOM 72 C CB . ILE A 1 9 ? 29.148 17.997 27.144 1.00 10.70 ? 9 ILE A CB 1 >_refine.B_iso_mean 16.6 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >449 >ATOM 73 C CG1 . ILE A 1 9 ? 28.285 16.981 26.401 1.00 10.95 ? 9 ILE A CG1 1 >_refine.aniso_B[1][1] ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >450 >ATOM 74 C CG2 . ILE A 1 9 ? 30.261 18.500 26.243 1.00 10.70 ? 9 ILE A CG2 1 >_refine.aniso_B[2][2] ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >451 >ATOM 75 C CD1 . ILE A 1 9 ? 27.586 17.597 25.207 1.00 13.23 ? 9 ILE A CD1 1 >_refine.aniso_B[3][3] ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >452 >ATOM 76 N N . ILE A 1 10 ? 30.373 15.067 27.995 1.00 7.08 ? 10 ILE A N 1 >_refine.aniso_B[1][2] ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >453 >ATOM 77 C CA . ILE A 1 10 ? 31.288 13.988 27.656 1.00 7.45 ? 10 ILE A CA 1 >_refine.aniso_B[1][3] ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >454 >ATOM 78 C C . ILE A 1 10 ? 30.812 13.201 26.441 1.00 8.49 ? 10 ILE A C 1 >_refine.aniso_B[2][3] ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >455 >ATOM 79 O O . ILE A 1 10 ? 31.561 12.397 25.892 1.00 9.49 ? 10 ILE A O 1 >_refine.solvent_model_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >456 >ATOM 80 C CB . ILE A 1 10 ? 31.586 13.023 28.847 1.00 10.28 ? 10 ILE A CB 1 >_refine.solvent_model_param_ksol ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >457 >ATOM 81 C CG1 . ILE A 1 10 ? 30.304 12.393 29.382 1.00 10.51 ? 10 ILE A CG1 1 >_refine.solvent_model_param_bsol ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >458 >ATOM 82 C CG2 . ILE A 1 10 ? 32.349 13.756 29.963 1.00 10.10 ? 10 ILE A CG2 1 >_refine.pdbx_ls_cross_valid_method ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >459 >ATOM 83 C CD1 . ILE A 1 10 ? 30.578 11.242 30.325 1.00 12.18 ? 10 ILE A CD1 1 >_refine.details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >460 >ATOM 84 N N . ARG A 1 11 ? 29.566 13.419 26.030 1.00 7.59 ? 11 ARG A N 1 >_refine.pdbx_starting_model ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >461 >ATOM 85 C CA . ARG A 1 11 ? 29.015 12.742 24.851 1.00 8.70 ? 11 ARG A CA 1 >_refine.pdbx_method_to_determine_struct ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >462 >ATOM 86 C C . ARG A 1 11 ? 27.821 13.500 24.290 1.00 9.41 ? 11 ARG A C 1 >_refine.pdbx_isotropic_thermal_model ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >463 >ATOM 87 O O . ARG A 1 11 ? 26.990 14.004 25.043 1.00 9.84 ? 11 ARG A O 1 >_refine.pdbx_stereochemistry_target_values ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >464 >ATOM 88 C CB . ARG A 1 11 ? 28.563 11.316 25.184 1.00 8.07 ? 11 ARG A CB 1 >_refine.pdbx_stereochem_target_val_spec_case ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >465 >ATOM 89 C CG . ARG A 1 11 ? 27.912 10.616 23.998 1.00 12.26 ? 11 ARG A CG 1 >_refine.pdbx_R_Free_selection_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >466 >ATOM 90 C CD . ARG A 1 11 ? 27.234 9.340 24.394 1.00 13.46 ? 11 ARG A CD 1 >_refine.pdbx_overall_ESU_R ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >467 >ATOM 91 N NE . ARG A 1 11 ? 28.157 8.304 24.847 1.00 15.44 ? 11 ARG A NE 1 >_refine.pdbx_overall_ESU_R_Free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >468 >ATOM 92 C CZ . ARG A 1 11 ? 28.815 7.470 24.037 1.00 19.59 ? 11 ARG A CZ 1 >_refine.overall_SU_ML ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >469 >ATOM 93 N NH1 . ARG A 1 11 ? 28.677 7.559 22.714 1.00 19.40 ? 11 ARG A NH1 1 >_refine.overall_SU_B ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >470 >ATOM 94 N NH2 . ARG A 1 11 ? 29.521 6.467 24.547 1.00 17.50 ? 11 ARG A NH2 1 >_refine.pdbx_refine_id 'X-RAY DIFFRACTION' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >471 >ATOM 95 N N . SER A 1 12 ? 27.748 13.594 22.965 1.00 8.84 ? 12 SER A N 1 >_refine.pdbx_diffrn_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >472 >ATOM 96 C CA . SER A 1 12 ? 26.621 14.245 22.310 1.00 8.61 ? 12 SER A CA 1 >_refine.pdbx_TLS_residual_ADP_flag ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >473 >ATOM 97 C C . SER A 1 12 ? 26.278 13.431 21.063 1.00 9.48 ? 12 SER A C 1 >_refine.correlation_coeff_Fo_to_Fc ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >474 >ATOM 98 O O . SER A 1 12 ? 27.159 13.147 20.250 1.00 9.84 ? 12 SER A O 1 >_refine.correlation_coeff_Fo_to_Fc_free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >475 >ATOM 99 C CB . SER A 1 12 ? 26.966 15.676 21.925 1.00 9.02 ? 12 SER A CB 1 >_refine.pdbx_solvent_vdw_probe_radii ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >476 >ATOM 100 O OG . SER A 1 12 ? 25.863 16.285 21.273 1.00 11.97 ? 12 SER A OG 1 >_refine.pdbx_solvent_ion_probe_radii ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >477 >ATOM 101 N N . GLU A 1 13 ? 25.016 13.038 20.924 1.00 7.59 ? 13 GLU A N 1 >_refine.pdbx_solvent_shrinkage_radii ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >478 >ATOM 102 C CA . GLU A 1 13 ? 24.586 12.258 19.768 1.00 9.67 ? 13 GLU A CA 1 >_refine.pdbx_overall_phase_error ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >479 >ATOM 103 C C . GLU A 1 13 ? 23.368 12.887 19.118 1.00 9.06 ? 13 GLU A C 1 >_refine.overall_SU_R_Cruickshank_DPI ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >480 >ATOM 104 O O . GLU A 1 13 ? 22.457 13.343 19.815 1.00 7.34 ? 13 GLU A O 1 >_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >481 >ATOM 105 C CB . GLU A 1 13 ? 24.185 10.833 20.184 1.00 9.72 ? 13 GLU A CB 1 >_refine.pdbx_overall_SU_R_Blow_DPI ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >482 >ATOM 106 C CG . GLU A 1 13 ? 25.257 10.018 20.895 1.00 15.17 ? 13 GLU A CG 1 >_refine.pdbx_overall_SU_R_free_Blow_DPI ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >483 >ATOM 107 C CD . GLU A 1 13 ? 26.262 9.340 19.954 1.00 18.75 ? 13 GLU A CD 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >484 >ATOM 108 O OE1 . GLU A 1 13 ? 26.031 9.310 18.726 1.00 18.53 ? 13 GLU A OE1 1 >_refine_analyze.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >485 >ATOM 109 O OE2 . GLU A 1 13 ? 27.286 8.822 20.457 1.00 19.23 ? 13 GLU A OE2 1 >_refine_analyze.Luzzati_coordinate_error_obs 0.2 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >486 >ATOM 110 N N . ASN A 1 14 ? 23.363 12.919 17.786 1.00 8.79 ? 14 ASN A N 1 >_refine_analyze.Luzzati_sigma_a_obs ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >487 >ATOM 111 C CA . ASN A 1 14 ? 22.202 13.408 17.025 1.00 8.29 ? 14 ASN A CA 1 >_refine_analyze.Luzzati_d_res_low_obs ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >488 >ATOM 112 C C . ASN A 1 14 ? 21.813 14.896 17.153 1.00 7.35 ? 14 ASN A C 1 >_refine_analyze.Luzzati_coordinate_error_free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >489 >ATOM 113 O O . ASN A 1 14 ? 20.681 15.245 16.860 1.00 7.00 ? 14 ASN A O 1 >_refine_analyze.Luzzati_sigma_a_free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >490 >ATOM 114 C CB . ASN A 1 14 ? 20.989 12.522 17.383 1.00 7.23 ? 14 ASN A CB 1 >_refine_analyze.Luzzati_d_res_low_free ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >491 >ATOM 115 C CG . ASN A 1 14 ? 20.358 11.833 16.172 1.00 9.38 ? 14 ASN A CG 1 >_refine_analyze.number_disordered_residues ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >492 >ATOM 116 O OD1 . ASN A 1 14 ? 20.996 11.670 15.128 1.00 10.37 ? 14 ASN A OD1 1 >_refine_analyze.occupancy_sum_hydrogen ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >493 >ATOM 117 N ND2 . ASN A 1 14 ? 19.106 11.436 16.310 1.00 6.35 ? 14 ASN A ND2 1 >_refine_analyze.occupancy_sum_non_hydrogen ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >494 >ATOM 118 N N . PHE A 1 15 ? 22.734 15.777 17.536 1.00 7.26 ? 15 PHE A N 1 >_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >495 >ATOM 119 C CA . PHE A 1 15 ? 22.385 17.198 17.681 1.00 9.06 ? 15 PHE A CA 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >496 >ATOM 120 C C . PHE A 1 15 ? 22.041 17.878 16.358 1.00 9.15 ? 15 PHE A C 1 >_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >497 >ATOM 121 O O . PHE A 1 15 ? 21.041 18.578 16.265 1.00 8.64 ? 15 PHE A O 1 >_refine_hist.cycle_id LAST >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >498 >ATOM 122 C CB . PHE A 1 15 ? 23.497 17.990 18.379 1.00 10.05 ? 15 PHE A CB 1 >_refine_hist.pdbx_number_atoms_protein 1091 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >499 >ATOM 123 C CG . PHE A 1 15 ? 23.102 19.397 18.746 1.00 10.57 ? 15 PHE A CG 1 >_refine_hist.pdbx_number_atoms_nucleic_acid 0 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >500 >ATOM 124 C CD1 . PHE A 1 15 ? 22.032 19.633 19.605 1.00 13.39 ? 15 PHE A CD1 1 >_refine_hist.pdbx_number_atoms_ligand 22 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >501 >ATOM 125 C CD2 . PHE A 1 15 ? 23.813 20.485 18.254 1.00 11.47 ? 15 PHE A CD2 1 >_refine_hist.number_atoms_solvent 100 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >502 >ATOM 126 C CE1 . PHE A 1 15 ? 21.678 20.929 19.968 1.00 13.52 ? 15 PHE A CE1 1 >_refine_hist.number_atoms_total 1213 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >503 >ATOM 127 C CE2 . PHE A 1 15 ? 23.467 21.784 18.609 1.00 11.60 ? 15 PHE A CE2 1 >_refine_hist.d_res_high 1.8 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >504 >ATOM 128 C CZ . PHE A 1 15 ? 22.399 22.006 19.469 1.00 13.52 ? 15 PHE A CZ 1 >_refine_hist.d_res_low 8.0 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >505 >ATOM 129 N N . GLU A 1 16 ? 22.878 17.699 15.342 1.00 11.17 ? 16 GLU A N 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >506 >ATOM 130 C CA . GLU A 1 16 ? 22.583 18.313 14.053 1.00 12.58 ? 16 GLU A CA 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >507 >ATOM 131 C C . GLU A 1 16 ? 21.271 17.797 13.468 1.00 11.71 ? 16 GLU A C 1 >_refine_ls_restr.type >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >508 >ATOM 132 O O . GLU A 1 16 ? 20.503 18.567 12.888 1.00 12.66 ? 16 GLU A O 1 >_refine_ls_restr.dev_ideal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >509 >ATOM 133 C CB . GLU A 1 16 ? 23.711 18.081 13.060 1.00 15.91 ? 16 GLU A CB 1 >_refine_ls_restr.dev_ideal_target >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >510 >ATOM 134 C CG . GLU A 1 16 ? 23.274 18.337 11.626 1.00 21.31 ? 16 GLU A CG 1 >_refine_ls_restr.weight >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >511 >ATOM 135 C CD . GLU A 1 16 ? 24.376 18.878 10.757 1.00 25.39 ? 16 GLU A CD 1 >_refine_ls_restr.number >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >512 >ATOM 136 O OE1 . GLU A 1 16 ? 25.526 18.984 11.240 1.00 27.92 ? 16 GLU A OE1 1 >_refine_ls_restr.pdbx_refine_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >513 >ATOM 137 O OE2 . GLU A 1 16 ? 24.084 19.213 9.588 1.00 28.60 ? 16 GLU A OE2 1 >_refine_ls_restr.pdbx_restraint_function >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >514 >ATOM 138 N N . GLU A 1 17 ? 21.018 16.497 13.619 1.00 11.67 ? 17 GLU A N 1 >x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >515 >ATOM 139 C CA . GLU A 1 17 ? 19.785 15.878 13.116 1.00 13.65 ? 17 GLU A CA 1 >x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >516 >ATOM 140 C C . GLU A 1 17 ? 18.529 16.490 13.767 1.00 13.48 ? 17 GLU A C 1 >x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >517 >ATOM 141 O O . GLU A 1 17 ? 17.490 16.662 13.115 1.00 11.68 ? 17 GLU A O 1 >x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >518 >ATOM 142 C CB . GLU A 1 17 ? 19.811 14.361 13.325 1.00 17.06 ? 17 GLU A CB 1 >x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >519 >ATOM 143 C CG . GLU A 1 17 ? 20.806 13.602 12.430 1.00 23.45 ? 17 GLU A CG 1 >x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >520 >ATOM 144 C CD . GLU A 1 17 ? 22.279 13.624 12.909 1.00 27.80 ? 17 GLU A CD 1 >x_angle_deg 1.51 ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >521 >ATOM 145 O OE1 . GLU A 1 17 ? 22.637 14.338 13.881 1.00 26.52 ? 17 GLU A OE1 1 >x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >522 >ATOM 146 O OE2 . GLU A 1 17 ? 23.097 12.897 12.291 1.00 31.80 ? 17 GLU A OE2 1 >x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >523 >ATOM 147 N N . LEU A 1 18 ? 18.640 16.834 15.048 1.00 10.82 ? 18 LEU A N 1 >x_dihedral_angle_d 27.4 ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >524 >ATOM 148 C CA . LEU A 1 18 ? 17.547 17.468 15.777 1.00 9.45 ? 18 LEU A CA 1 >x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >525 >ATOM 149 C C . LEU A 1 18 ? 17.302 18.849 15.155 1.00 9.27 ? 18 LEU A C 1 >x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >526 >ATOM 150 O O . LEU A 1 18 ? 16.153 19.246 14.927 1.00 9.04 ? 18 LEU A O 1 >x_improper_angle_d 1.32 ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >527 >ATOM 151 C CB . LEU A 1 18 ? 17.931 17.644 17.253 1.00 9.77 ? 18 LEU A CB 1 >x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >528 >ATOM 152 C CG . LEU A 1 18 ? 16.921 18.358 18.163 1.00 11.36 ? 18 LEU A CG 1 >x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >529 >ATOM 153 C CD1 . LEU A 1 18 ? 15.817 17.402 18.554 1.00 13.85 ? 18 LEU A CD1 1 >x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >530 >ATOM 154 C CD2 . LEU A 1 18 ? 17.616 18.876 19.409 1.00 12.69 ? 18 LEU A CD2 1 >x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >531 >ATOM 155 N N . LEU A 1 19 ? 18.387 19.568 14.864 1.00 10.75 ? 19 LEU A N 1 >x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >532 >ATOM 156 C CA . LEU A 1 19 ? 18.275 20.906 14.276 1.00 11.15 ? 19 LEU A CA 1 >x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >533 >ATOM 157 C C . LEU A 1 19 ? 17.671 20.873 12.874 1.00 12.52 ? 19 LEU A C 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >534 >ATOM 158 O O . LEU A 1 19 ? 16.932 21.777 12.485 1.00 10.05 ? 19 LEU A O 1 >_struct.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >535 >ATOM 159 C CB . LEU A 1 19 ? 19.631 21.616 14.263 1.00 12.01 ? 19 LEU A CB 1 >_struct.title >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >536 >ATOM 160 C CG . LEU A 1 19 ? 20.282 21.963 15.614 1.00 10.42 ? 19 LEU A CG 1 >;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >537 >ATOM 161 C CD1 . LEU A 1 19 ? 21.560 22.763 15.369 1.00 13.01 ? 19 LEU A CD1 1 >; >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >538 >ATOM 162 C CD2 . LEU A 1 19 ? 19.312 22.742 16.513 1.00 11.45 ? 19 LEU A CD2 1 >_struct.pdbx_descriptor >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >539 >ATOM 163 N N . LYS A 1 20 ? 17.944 19.795 12.150 1.00 14.41 ? 20 LYS A N 1 >'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >540 >ATOM 164 C CA . LYS A 1 20 ? 17.427 19.628 10.800 1.00 16.54 ? 20 LYS A CA 1 >_struct.pdbx_model_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >541 >ATOM 165 C C . LYS A 1 20 ? 15.902 19.512 10.832 1.00 16.17 ? 20 LYS A C 1 >_struct.pdbx_CASP_flag ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >542 >ATOM 166 O O . LYS A 1 20 ? 15.201 20.164 10.053 1.00 15.90 ? 20 LYS A O 1 >_struct.pdbx_model_type_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >543 >ATOM 167 C CB . LYS A 1 20 ? 18.048 18.390 10.157 1.00 20.07 ? 20 LYS A CB 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >544 >ATOM 168 C CG . LYS A 1 20 ? 18.592 18.643 8.765 1.00 26.61 ? 20 LYS A CG 1 >_struct_keywords.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >545 >ATOM 169 C CD . LYS A 1 20 ? 18.960 17.349 8.027 1.00 30.95 ? 20 LYS A CD 1 >_struct_keywords.pdbx_keywords 'RETINOIC-ACID TRANSPORT' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >546 >ATOM 170 C CE . LYS A 1 20 ? 20.226 16.690 8.579 1.00 35.68 ? 20 LYS A CE 1 >_struct_keywords.text 'RETINOIC-ACID TRANSPORT' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >547 >ATOM 171 N NZ . LYS A 1 20 ? 21.485 17.466 8.342 1.00 39.27 ? 20 LYS A NZ 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >548 >ATOM 172 N N . VAL A 1 21 ? 15.395 18.700 11.759 1.00 15.31 ? 21 VAL A N 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >549 >ATOM 173 C CA . VAL A 1 21 ? 13.958 18.508 11.927 1.00 14.41 ? 21 VAL A CA 1 >_struct_asym.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >550 >ATOM 174 C C . VAL A 1 21 ? 13.275 19.831 12.316 1.00 15.02 ? 21 VAL A C 1 >_struct_asym.pdbx_blank_PDB_chainid_flag >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >551 >ATOM 175 O O . VAL A 1 21 ? 12.150 20.119 11.878 1.00 13.59 ? 21 VAL A O 1 >_struct_asym.pdbx_modified >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >552 >ATOM 176 C CB . VAL A 1 21 ? 13.674 17.422 12.998 1.00 14.93 ? 21 VAL A CB 1 >_struct_asym.entity_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >553 >ATOM 177 C CG1 . VAL A 1 21 ? 12.194 17.383 13.364 1.00 17.29 ? 21 VAL A CG1 1 >_struct_asym.details >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >554 >ATOM 178 C CG2 . VAL A 1 21 ? 14.115 16.082 12.482 1.00 15.09 ? 21 VAL A CG2 1 >A N N 1 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >555 >ATOM 179 N N . LEU A 1 22 ? 13.966 20.643 13.119 1.00 14.52 ? 22 LEU A N 1 >B N N 2 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >556 >ATOM 180 C CA . LEU A 1 22 ? 13.432 21.938 13.569 1.00 14.42 ? 22 LEU A CA 1 >C N N 3 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >557 >ATOM 181 C C . LEU A 1 22 ? 13.478 22.984 12.467 1.00 15.49 ? 22 LEU A C 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >558 >ATOM 182 O O . LEU A 1 22 ? 13.038 24.115 12.666 1.00 16.81 ? 22 LEU A O 1 >_struct_biol.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >559 >ATOM 183 C CB . LEU A 1 22 ? 14.180 22.440 14.818 1.00 13.61 ? 22 LEU A CB 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >560 >ATOM 184 C CG . LEU A 1 22 ? 13.986 21.565 16.069 1.00 13.97 ? 22 LEU A CG 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >561 >ATOM 185 C CD1 . LEU A 1 22 ? 14.852 22.047 17.225 1.00 13.25 ? 22 LEU A CD1 1 >_struct_conf.conf_type_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >562 >ATOM 186 C CD2 . LEU A 1 22 ? 12.525 21.580 16.467 1.00 14.62 ? 22 LEU A CD2 1 >_struct_conf.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >563 >ATOM 187 N N . GLY A 1 23 ? 14.062 22.618 11.328 1.00 16.41 ? 23 GLY A N 1 >_struct_conf.pdbx_PDB_helix_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >564 >ATOM 188 C CA . GLY A 1 23 ? 14.123 23.516 10.183 1.00 17.05 ? 23 GLY A CA 1 >_struct_conf.beg_label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >565 >ATOM 189 C C . GLY A 1 23 ? 15.241 24.539 10.125 1.00 18.00 ? 23 GLY A C 1 >_struct_conf.beg_label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >566 >ATOM 190 O O . GLY A 1 23 ? 15.112 25.545 9.425 1.00 19.45 ? 23 GLY A O 1 >_struct_conf.beg_label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >567 >ATOM 191 N N . VAL A 1 24 ? 16.320 24.315 10.869 1.00 14.78 ? 24 VAL A N 1 >_struct_conf.pdbx_beg_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >568 >ATOM 192 C CA . VAL A 1 24 ? 17.440 25.241 10.860 1.00 13.71 ? 24 VAL A CA 1 >_struct_conf.end_label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >569 >ATOM 193 C C . VAL A 1 24 ? 18.289 24.983 9.607 1.00 15.09 ? 24 VAL A C 1 >_struct_conf.end_label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >570 >ATOM 194 O O . VAL A 1 24 ? 18.679 23.840 9.334 1.00 14.12 ? 24 VAL A O 1 >_struct_conf.end_label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >571 >ATOM 195 C CB . VAL A 1 24 ? 18.297 25.081 12.139 1.00 12.19 ? 24 VAL A CB 1 >_struct_conf.pdbx_end_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >572 >ATOM 196 C CG1 . VAL A 1 24 ? 19.465 26.054 12.109 1.00 8.69 ? 24 VAL A CG1 1 >_struct_conf.beg_auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >573 >ATOM 197 C CG2 . VAL A 1 24 ? 17.416 25.294 13.388 1.00 11.37 ? 24 VAL A CG2 1 >_struct_conf.beg_auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >574 >ATOM 198 N N . ASN A 1 25 ? 18.595 26.047 8.866 1.00 15.37 ? 25 ASN A N 1 >_struct_conf.beg_auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >575 >ATOM 199 C CA . ASN A 1 25 ? 19.360 25.914 7.635 1.00 17.74 ? 25 ASN A CA 1 >_struct_conf.end_auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >576 >ATOM 200 C C . ASN A 1 25 ? 20.808 25.466 7.819 1.00 18.29 ? 25 ASN A C 1 >_struct_conf.end_auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >577 >ATOM 201 O O . ASN A 1 25 ? 21.377 25.592 8.903 1.00 18.05 ? 25 ASN A O 1 >_struct_conf.end_auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >578 >ATOM 202 C CB . ASN A 1 25 ? 19.230 27.172 6.742 1.00 19.41 ? 25 ASN A CB 1 >_struct_conf.pdbx_PDB_helix_class >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >579 >ATOM 203 C CG . ASN A 1 25 ? 20.090 28.351 7.200 1.00 22.35 ? 25 ASN A CG 1 >_struct_conf.details >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >580 >ATOM 204 O OD1 . ASN A 1 25 ? 21.207 28.189 7.698 1.00 22.64 ? 25 ASN A OD1 1 >_struct_conf.pdbx_PDB_helix_length >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >581 >ATOM 205 N ND2 . ASN A 1 25 ? 19.602 29.558 6.933 1.00 24.15 ? 25 ASN A ND2 1 >OTHER OTHER1 ? PRO A 1 ? SER A 4 ? PRO A 1 SER A 4 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >582 >ATOM 206 N N . VAL A 1 26 ? 21.398 24.971 6.733 1.00 18.67 ? 26 VAL A N 1 >STRN STRN1 ? GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >583 >ATOM 207 C CA . VAL A 1 26 ? 22.755 24.444 6.742 1.00 19.24 ? 26 VAL A CA 1 >BEND BEND1 ? ASN A 14 ? ASN A 14 ? ASN A 14 ASN A 14 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >584 >ATOM 208 C C . VAL A 1 26 ? 23.825 25.280 7.421 1.00 18.39 ? 26 VAL A C 1 >HELX_RH_AL_P HELX_RH_AL_P1 ? PHE A 15 ? VAL A 21 ? PHE A 15 VAL A 21 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >585 >ATOM 209 O O . VAL A 1 26 ? 24.558 24.764 8.261 1.00 18.50 ? 26 VAL A O 1 >TURN_TY1_P TURN_TY1_P1 ? LEU A 22 ? GLY A 23 ? LEU A 22 GLY A 23 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >586 >ATOM 210 C CB . VAL A 1 26 ? 23.223 24.088 5.320 1.00 20.77 ? 26 VAL A CB 1 >OTHER OTHER2 ? VAL A 24 ? ASN A 25 ? VAL A 24 ASN A 25 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >587 >ATOM 211 C CG1 . VAL A 1 26 ? 24.624 23.523 5.378 1.00 22.39 ? 26 VAL A CG1 1 >HELX_RH_AL_P HELX_RH_AL_P2 ? VAL A 26 ? ALA A 36 ? VAL A 26 ALA A 36 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >588 >ATOM 212 C CG2 . VAL A 1 26 ? 22.276 23.084 4.698 1.00 21.28 ? 26 VAL A CG2 1 >TURN_TY1_P TURN_TY1_P2 ? SER A 37 ? SER A 37 ? SER A 37 SER A 37 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >589 >ATOM 213 N N . MET A 1 27 ? 23.932 26.556 7.052 1.00 19.00 ? 27 MET A N 1 >BEND BEND2 ? LYS A 38 ? LYS A 38 ? LYS A 38 LYS A 38 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >590 >ATOM 214 C CA . MET A 1 27 ? 24.948 27.433 7.628 1.00 19.54 ? 27 MET A CA 1 >OTHER OTHER3 ? PRO A 39 ? PRO A 39 ? PRO A 39 PRO A 39 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >591 >ATOM 215 C C . MET A 1 27 ? 24.734 27.741 9.099 1.00 19.04 ? 27 MET A C 1 >STRN STRN2 ? ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >592 >ATOM 216 O O . MET A 1 27 ? 25.702 27.820 9.849 1.00 18.28 ? 27 MET A O 1 >TURN_TY1_P TURN_TY1_P3 ? GLY A 47 ? ASP A 48 ? GLY A 47 ASP A 48 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >593 >ATOM 217 C CB . MET A 1 27 ? 25.104 28.736 6.830 1.00 23.31 ? 27 MET A CB 1 >STRN STRN3 ? THR A 49 ? SER A 55 ? THR A 49 SER A 55 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >594 >ATOM 218 C CG . MET A 1 27 ? 25.955 28.602 5.552 1.00 29.99 ? 27 MET A CG 1 >OTHER OTHER4 ? THR A 56 ? THR A 56 ? THR A 56 THR A 56 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >595 >ATOM 219 S SD . MET A 1 27 ? 24.975 28.527 4.010 1.00 37.48 ? 27 MET A SD 1 >BEND BEND3 ? THR A 57 ? VAL A 58 ? THR A 57 VAL A 58 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >596 >ATOM 220 C CE . MET A 1 27 ? 26.198 29.150 2.776 1.00 35.24 ? 27 MET A CE 1 >OTHER OTHER5 ? ARG A 59 ? ARG A 59 ? ARG A 59 ARG A 59 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >597 >ATOM 221 N N . LEU A 1 28 ? 23.480 27.932 9.507 1.00 16.74 ? 28 LEU A N 1 >STRN STRN4 ? THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >598 >ATOM 222 C CA . LEU A 1 28 ? 23.190 28.209 10.912 1.00 16.39 ? 28 LEU A CA 1 >TURN_TY1_P TURN_TY1_P4 ? VAL A 67 ? GLY A 68 ? VAL A 67 GLY A 68 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >599 >ATOM 223 C C . LEU A 1 28 ? 23.477 26.954 11.722 1.00 16.86 ? 28 LEU A C 1 >BEND BEND4 ? GLU A 69 ? GLU A 69 ? GLU A 69 GLU A 69 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >600 >ATOM 224 O O . LEU A 1 28 ? 23.954 27.038 12.852 1.00 15.09 ? 28 LEU A O 1 >OTHER OTHER6 ? GLU A 70 ? GLU A 70 ? GLU A 70 GLU A 70 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >601 >ATOM 225 C CB . LEU A 1 28 ? 21.739 28.679 11.111 1.00 15.94 ? 28 LEU A CB 1 >STRN STRN5 ? PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >602 >ATOM 226 C CG . LEU A 1 28 ? 21.490 30.154 10.741 1.00 16.72 ? 28 LEU A CG 1 >OTHER OTHER7 ? THR A 75 ? THR A 75 ? THR A 75 THR A 75 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >603 >ATOM 227 C CD1 . LEU A 1 28 ? 20.008 30.496 10.780 1.00 14.38 ? 28 LEU A CD1 1 >TURN_TY1_P TURN_TY1_P5 ? VAL A 76 ? ASP A 77 ? VAL A 76 ASP A 77 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >604 >ATOM 228 C CD2 . LEU A 1 28 ? 22.302 31.074 11.665 1.00 12.81 ? 28 LEU A CD2 1 >BEND BEND5 ? GLY A 78 ? GLY A 78 ? GLY A 78 GLY A 78 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >605 >ATOM 229 N N . ARG A 1 29 ? 23.228 25.791 11.121 1.00 16.05 ? 29 ARG A N 1 >OTHER OTHER8 ? ARG A 79 ? ARG A 79 ? ARG A 79 ARG A 79 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >606 >ATOM 230 C CA . ARG A 1 29 ? 23.498 24.524 11.798 1.00 18.43 ? 29 ARG A CA 1 >STRN STRN6 ? PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >607 >ATOM 231 C C . ARG A 1 29 ? 24.980 24.377 12.076 1.00 19.22 ? 29 ARG A C 1 >TURN_TY1_P TURN_TY1_P6 ? GLU A 90 ? ASN A 91 ? GLU A 90 ASN A 91 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >608 >ATOM 232 O O . ARG A 1 29 ? 25.383 23.987 13.171 1.00 17.97 ? 29 ARG A O 1 >STRN STRN7 ? LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >609 >ATOM 233 C CB . ARG A 1 29 ? 23.030 23.334 10.969 1.00 18.63 ? 29 ARG A CB 1 >BEND BEND6 ? LEU A 100 ? GLY A 102 ? LEU A 100 GLY A 102 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >610 >ATOM 234 C CG . ARG A 1 29 ? 21.596 22.983 11.189 1.00 21.26 ? 29 ARG A CG 1 >OTHER OTHER9 ? GLU A 103 ? LYS A 106 ? GLU A 103 LYS A 106 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >611 >ATOM 235 C CD . ARG A 1 29 ? 21.339 21.572 10.739 1.00 24.71 ? 29 ARG A CD 1 >STRN STRN8 ? THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >612 >ATOM 236 N NE . ARG A 1 29 ? 20.571 21.564 9.513 1.00 29.88 ? 29 ARG A NE 1 >OTHER OTHER10 ? THR A 114 ? THR A 114 ? THR A 114 THR A 114 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >613 >ATOM 237 C CZ . ARG A 1 29 ? 21.019 21.147 8.340 1.00 29.19 ? 29 ARG A CZ 1 >TURN_TY1_P TURN_TY1_P7 ? ASN A 115 ? ASP A 116 ? ASN A 115 ASP A 116 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >614 >ATOM 238 N NH1 . ARG A 1 29 ? 22.248 20.682 8.205 1.00 30.52 ? 29 ARG A NH1 1 >BEND BEND7 ? GLY A 117 ? GLY A 117 ? GLY A 117 GLY A 117 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >615 >ATOM 239 N NH2 . ARG A 1 29 ? 20.232 21.233 7.295 1.00 31.61 ? 29 ARG A NH2 1 >OTHER OTHER11 ? GLU A 118 ? GLU A 118 ? GLU A 118 GLU A 118 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >616 >ATOM 240 N N . LYS A 1 30 ? 25.790 24.709 11.078 1.00 19.76 ? 30 LYS A N 1 >STRN STRN9 ? LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >617 >ATOM 241 C CA . LYS A 1 30 ? 27.235 24.619 11.198 1.00 21.96 ? 30 LYS A CA 1 >TURN_TY1_P TURN_TY1_P8 ? ASP A 126 ? ASP A 127 ? ASP A 126 ASP A 127 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >618 >ATOM 242 C C . LYS A 1 30 ? 27.706 25.418 12.417 1.00 20.91 ? 30 LYS A C 1 >STRN STRN10 ? VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >619 >ATOM 243 O O . LYS A 1 30 ? 28.470 24.916 13.239 1.00 22.15 ? 30 LYS A O 1 >OTHER OTHER12 ? GLU A 137 ? GLU A 137 ? GLU A 137 GLU A 137 ? ? ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >620 >ATOM 244 C CB . LYS A 1 30 ? 27.894 25.143 9.915 1.00 25.07 ? 30 LYS A CB 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >621 >ATOM 245 C CG . LYS A 1 30 ? 29.404 25.031 9.905 1.00 30.48 ? 30 LYS A CG 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >622 >ATOM 246 C CD . LYS A 1 30 ? 30.013 25.631 8.639 1.00 35.43 ? 30 LYS A CD 1 >_struct_conf_type.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >623 >ATOM 247 C CE . LYS A 1 30 ? 31.533 25.759 8.778 1.00 37.96 ? 30 LYS A CE 1 >_struct_conf_type.criteria >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >624 >ATOM 248 N NZ . LYS A 1 30 ? 32.180 26.388 7.584 1.00 41.61 ? 30 LYS A NZ 1 >_struct_conf_type.reference >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >625 >ATOM 249 N N . ILE A 1 31 ? 27.208 26.643 12.544 1.00 18.38 ? 31 ILE A N 1 >OTHER DSSP ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >626 >ATOM 250 C CA . ILE A 1 31 ? 27.557 27.527 13.652 1.00 16.41 ? 31 ILE A CA 1 >STRN DSSP ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >627 >ATOM 251 C C . ILE A 1 31 ? 27.105 26.932 14.989 1.00 15.39 ? 31 ILE A C 1 >BEND DSSP ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >628 >ATOM 252 O O . ILE A 1 31 ? 27.888 26.855 15.930 1.00 14.90 ? 31 ILE A O 1 >HELX_RH_AL_P DSSP ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >629 >ATOM 253 C CB . ILE A 1 31 ? 26.881 28.920 13.471 1.00 16.63 ? 31 ILE A CB 1 >TURN_TY1_P DSSP ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >630 >ATOM 254 C CG1 . ILE A 1 31 ? 27.419 29.606 12.208 1.00 18.74 ? 31 ILE A CG1 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >631 >ATOM 255 C CG2 . ILE A 1 31 ? 27.071 29.791 14.713 1.00 15.71 ? 31 ILE A CG2 1 >_struct_sheet.id A >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >632 >ATOM 256 C CD1 . ILE A 1 31 ? 26.735 30.946 11.858 1.00 17.27 ? 31 ILE A CD1 1 >_struct_sheet.type ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >633 >ATOM 257 N N . ALA A 1 32 ? 25.853 26.487 15.048 1.00 13.39 ? 32 ALA A N 1 >_struct_sheet.number_strands 10 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >634 >ATOM 258 C CA . ALA A 1 32 ? 25.271 25.930 16.267 1.00 12.76 ? 32 ALA A CA 1 >_struct_sheet.details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >635 >ATOM 259 C C . ALA A 1 32 ? 25.994 24.685 16.775 1.00 12.11 ? 32 ALA A C 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >636 >ATOM 260 O O . ALA A 1 32 ? 26.325 24.598 17.946 1.00 10.54 ? 32 ALA A O 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >637 >ATOM 261 C CB . ALA A 1 32 ? 23.790 25.638 16.040 1.00 12.45 ? 32 ALA A CB 1 >_struct_sheet_order.sheet_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >638 >ATOM 262 N N . VAL A 1 33 ? 26.252 23.731 15.886 1.00 11.95 ? 33 VAL A N 1 >_struct_sheet_order.range_id_1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >639 >ATOM 263 C CA . VAL A 1 33 ? 26.932 22.490 16.256 1.00 13.80 ? 33 VAL A CA 1 >_struct_sheet_order.range_id_2 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >640 >ATOM 264 C C . VAL A 1 33 ? 28.328 22.701 16.855 1.00 14.00 ? 33 VAL A C 1 >_struct_sheet_order.offset >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >641 >ATOM 265 O O . VAL A 1 33 ? 28.693 22.048 17.832 1.00 14.07 ? 33 VAL A O 1 >_struct_sheet_order.sense >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >642 >ATOM 266 C CB . VAL A 1 33 ? 27.016 21.504 15.044 1.00 13.56 ? 33 VAL A CB 1 >A 1 2 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >643 >ATOM 267 C CG1 . VAL A 1 33 ? 27.909 20.318 15.375 1.00 16.07 ? 33 VAL A CG1 1 >A 2 3 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >644 >ATOM 268 C CG2 . VAL A 1 33 ? 25.621 21.006 14.684 1.00 14.96 ? 33 VAL A CG2 1 >A 3 4 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >645 >ATOM 269 N N . ALA A 1 34 ? 29.101 23.620 16.281 1.00 14.73 ? 34 ALA A N 1 >A 4 5 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >646 >ATOM 270 C CA . ALA A 1 34 ? 30.443 23.898 16.780 1.00 14.95 ? 34 ALA A CA 1 >A 5 6 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >647 >ATOM 271 C C . ALA A 1 34 ? 30.381 24.505 18.178 1.00 15.59 ? 34 ALA A C 1 >A 6 7 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >648 >ATOM 272 O O . ALA A 1 34 ? 31.120 24.085 19.065 1.00 16.65 ? 34 ALA A O 1 >A 7 8 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >649 >ATOM 273 C CB . ALA A 1 34 ? 31.191 24.844 15.833 1.00 16.10 ? 34 ALA A CB 1 >A 8 9 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >650 >ATOM 274 N N . ALA A 1 35 ? 29.495 25.480 18.375 1.00 13.20 ? 35 ALA A N 1 >A 9 10 ? anti-parallel >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >651 >ATOM 275 C CA . ALA A 1 35 ? 29.371 26.134 19.671 1.00 13.04 ? 35 ALA A CA 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >652 >ATOM 276 C C . ALA A 1 35 ? 28.807 25.200 20.749 1.00 12.91 ? 35 ALA A C 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >653 >ATOM 277 O O . ALA A 1 35 ? 29.245 25.239 21.895 1.00 12.32 ? 35 ALA A O 1 >_struct_sheet_range.sheet_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >654 >ATOM 278 C CB . ALA A 1 35 ? 28.517 27.387 19.552 1.00 12.14 ? 35 ALA A CB 1 >_struct_sheet_range.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >655 >ATOM 279 N N . ALA A 1 36 ? 27.878 24.332 20.362 1.00 11.40 ? 36 ALA A N 1 >_struct_sheet_range.beg_label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >656 >ATOM 280 C CA . ALA A 1 36 ? 27.253 23.416 21.312 1.00 12.63 ? 36 ALA A CA 1 >_struct_sheet_range.beg_label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >657 >ATOM 281 C C . ALA A 1 36 ? 28.128 22.256 21.770 1.00 13.40 ? 36 ALA A C 1 >_struct_sheet_range.beg_label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >658 >ATOM 282 O O . ALA A 1 36 ? 27.743 21.512 22.668 1.00 13.47 ? 36 ALA A O 1 >_struct_sheet_range.pdbx_beg_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >659 >ATOM 283 C CB . ALA A 1 36 ? 25.952 22.883 20.744 1.00 11.79 ? 36 ALA A CB 1 >_struct_sheet_range.end_label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >660 >ATOM 284 N N . SER A 1 37 ? 29.286 22.080 21.148 1.00 13.86 ? 37 SER A N 1 >_struct_sheet_range.end_label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >661 >ATOM 285 C CA . SER A 1 37 ? 30.169 20.983 21.520 1.00 15.95 ? 37 SER A CA 1 >_struct_sheet_range.end_label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >662 >ATOM 286 C C . SER A 1 37 ? 30.938 21.245 22.818 1.00 16.46 ? 37 SER A C 1 >_struct_sheet_range.pdbx_end_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >663 >ATOM 287 O O . SER A 1 37 ? 31.488 20.320 23.406 1.00 18.23 ? 37 SER A O 1 >_struct_sheet_range.beg_auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >664 >ATOM 288 C CB . SER A 1 37 ? 31.145 20.689 20.388 1.00 16.93 ? 37 SER A CB 1 >_struct_sheet_range.beg_auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >665 >ATOM 289 O OG . SER A 1 37 ? 32.100 21.729 20.293 1.00 21.65 ? 37 SER A OG 1 >_struct_sheet_range.beg_auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >666 >ATOM 290 N N . LYS A 1 38 ? 30.957 22.496 23.272 1.00 16.91 ? 38 LYS A N 1 >_struct_sheet_range.end_auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >667 >ATOM 291 C CA . LYS A 1 38 ? 31.657 22.869 24.502 1.00 18.36 ? 38 LYS A CA 1 >_struct_sheet_range.end_auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >668 >ATOM 292 C C . LYS A 1 38 ? 30.817 23.809 25.382 1.00 15.90 ? 38 LYS A C 1 >_struct_sheet_range.end_auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >669 >ATOM 293 O O . LYS A 1 38 ? 31.175 24.975 25.591 1.00 16.72 ? 38 LYS A O 1 >A 1 THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >670 >ATOM 294 C CB . LYS A 1 38 ? 33.004 23.539 24.156 1.00 23.99 ? 38 LYS A CB 1 >A 2 THR A 49 ? SER A 55 ? THR A 49 SER A 55 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >671 >ATOM 295 C CG . LYS A 1 38 ? 32.907 24.607 23.046 1.00 30.97 ? 38 LYS A CG 1 >A 3 ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >672 >ATOM 296 C CD . LYS A 1 38 ? 34.250 25.320 22.792 1.00 36.44 ? 38 LYS A CD 1 >A 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >673 >ATOM 297 C CE . LYS A 1 38 ? 34.266 26.098 21.456 1.00 38.70 ? 38 LYS A CE 1 >A 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >674 >ATOM 298 N NZ . LYS A 1 38 ? 33.193 27.131 21.321 1.00 39.37 ? 38 LYS A NZ 1 >A 6 LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >675 >ATOM 299 N N . PRO A 1 39 ? 29.669 23.321 25.906 1.00 13.53 ? 39 PRO A N 1 >A 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >676 >ATOM 300 C CA . PRO A 1 39 ? 28.851 24.201 26.747 1.00 11.87 ? 39 PRO A CA 1 >A 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >677 >ATOM 301 C C . PRO A 1 39 ? 29.292 24.248 28.211 1.00 12.05 ? 39 PRO A C 1 >A 9 PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >678 >ATOM 302 O O . PRO A 1 39 ? 30.027 23.380 28.676 1.00 12.12 ? 39 PRO A O 1 >A 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >679 >ATOM 303 C CB . PRO A 1 39 ? 27.469 23.560 26.649 1.00 9.34 ? 39 PRO A CB 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >680 >ATOM 304 C CG . PRO A 1 39 ? 27.779 22.131 26.593 1.00 10.32 ? 39 PRO A CG 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >681 >ATOM 305 C CD . PRO A 1 39 ? 29.009 22.020 25.703 1.00 10.86 ? 39 PRO A CD 1 >_pdbx_struct_sheet_hbond.sheet_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >682 >ATOM 306 N N . ALA A 1 40 ? 28.921 25.316 28.898 1.00 11.52 ? 40 ALA A N 1 >_pdbx_struct_sheet_hbond.range_id_1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >683 >ATOM 307 C CA . ALA A 1 40 ? 29.192 25.423 30.329 1.00 11.84 ? 40 ALA A CA 1 >_pdbx_struct_sheet_hbond.range_id_2 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >684 >ATOM 308 C C . ALA A 1 40 ? 27.773 25.329 30.894 1.00 10.23 ? 40 ALA A C 1 >_pdbx_struct_sheet_hbond.range_1_label_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >685 >ATOM 309 O O . ALA A 1 40 ? 26.894 26.080 30.478 1.00 10.42 ? 40 ALA A O 1 >_pdbx_struct_sheet_hbond.range_1_label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >686 >ATOM 310 C CB . ALA A 1 40 ? 29.830 26.767 30.673 1.00 11.40 ? 40 ALA A CB 1 >_pdbx_struct_sheet_hbond.range_1_label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >687 >ATOM 311 N N . VAL A 1 41 ? 27.518 24.345 31.750 1.00 10.73 ? 41 VAL A N 1 >_pdbx_struct_sheet_hbond.range_1_label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >688 >ATOM 312 C CA . VAL A 1 41 ? 26.185 24.169 32.333 1.00 9.92 ? 41 VAL A CA 1 >_pdbx_struct_sheet_hbond.range_1_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >689 >ATOM 313 C C . VAL A 1 41 ? 26.226 24.295 33.854 1.00 11.64 ? 41 VAL A C 1 >_pdbx_struct_sheet_hbond.range_1_auth_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >690 >ATOM 314 O O . VAL A 1 41 ? 27.026 23.627 34.514 1.00 11.40 ? 41 VAL A O 1 >_pdbx_struct_sheet_hbond.range_1_auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >691 >ATOM 315 C CB . VAL A 1 41 ? 25.594 22.772 31.987 1.00 10.67 ? 41 VAL A CB 1 >_pdbx_struct_sheet_hbond.range_1_auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >692 >ATOM 316 C CG1 . VAL A 1 41 ? 24.204 22.596 32.612 1.00 11.34 ? 41 VAL A CG1 1 >_pdbx_struct_sheet_hbond.range_1_auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >693 >ATOM 317 C CG2 . VAL A 1 41 ? 25.507 22.583 30.475 1.00 11.31 ? 41 VAL A CG2 1 >_pdbx_struct_sheet_hbond.range_2_label_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >694 >ATOM 318 N N . GLU A 1 42 ? 25.364 25.147 34.399 1.00 10.94 ? 42 GLU A N 1 >_pdbx_struct_sheet_hbond.range_2_label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >695 >ATOM 319 C CA . GLU A 1 42 ? 25.271 25.327 35.845 1.00 12.40 ? 42 GLU A CA 1 >_pdbx_struct_sheet_hbond.range_2_label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >696 >ATOM 320 C C . GLU A 1 42 ? 23.837 25.095 36.316 1.00 11.42 ? 42 GLU A C 1 >_pdbx_struct_sheet_hbond.range_2_label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >697 >ATOM 321 O O . GLU A 1 42 ? 22.898 25.720 35.825 1.00 10.46 ? 42 GLU A O 1 >_pdbx_struct_sheet_hbond.range_2_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >698 >ATOM 322 C CB . GLU A 1 42 ? 25.711 26.721 36.270 1.00 16.26 ? 42 GLU A CB 1 >_pdbx_struct_sheet_hbond.range_2_auth_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >699 >ATOM 323 C CG . GLU A 1 42 ? 25.495 26.947 37.768 1.00 23.78 ? 42 GLU A CG 1 >_pdbx_struct_sheet_hbond.range_2_auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >700 >ATOM 324 C CD . GLU A 1 42 ? 25.944 28.311 38.242 1.00 27.94 ? 42 GLU A CD 1 >_pdbx_struct_sheet_hbond.range_2_auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >701 >ATOM 325 O OE1 . GLU A 1 42 ? 25.308 29.329 37.872 1.00 29.92 ? 42 GLU A OE1 1 >_pdbx_struct_sheet_hbond.range_2_auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >702 >ATOM 326 O OE2 . GLU A 1 42 ? 26.935 28.351 39.002 1.00 32.64 ? 42 GLU A OE2 1 >A 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >703 >ATOM 327 N N . ILE A 1 43 ? 23.673 24.176 37.261 1.00 10.55 ? 43 ILE A N 1 >A 2 3 N SER A 55 ? N SER A 55 O ALA A 40 ? O ALA A 40 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >704 >ATOM 328 C CA . ILE A 1 43 ? 22.362 23.864 37.794 1.00 10.69 ? 43 ILE A CA 1 >A 3 4 N ILE A 43 ? N ILE A 43 O GLY A 5 ? O GLY A 5 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >705 >ATOM 329 C C . ILE A 1 43 ? 22.360 24.120 39.300 1.00 11.07 ? 43 ILE A C 1 >A 4 5 N GLU A 13 ? N GLU A 13 O THR A 131 ? O THR A 131 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >706 >ATOM 330 O O . ILE A 1 43 ? 23.307 23.764 39.992 1.00 10.83 ? 43 ILE A O 1 >A 5 6 N TYR A 134 ? N TYR A 134 O LEU A 119 ? O LEU A 119 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >707 >ATOM 331 C CB . ILE A 1 43 ? 21.996 22.374 37.552 1.00 10.47 ? 43 ILE A CB 1 >A 6 7 N THR A 124 ? N THR A 124 O SER A 108 ? O SER A 108 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >708 >ATOM 332 C CG1 . ILE A 1 43 ? 21.974 22.072 36.056 1.00 10.46 ? 43 ILE A CG1 1 >A 7 8 O ARG A 111 ? O ARG A 111 N MET A 93 ? N MET A 93 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >709 >ATOM 333 C CG2 . ILE A 1 43 ? 20.636 22.031 38.186 1.00 10.34 ? 43 ILE A CG2 1 >A 8 9 O LYS A 98 ? O LYS A 98 N LYS A 82 ? N LYS A 82 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >710 >ATOM 334 C CD1 . ILE A 1 43 ? 21.607 20.639 35.726 1.00 9.00 ? 43 ILE A CD1 1 >A 9 10 N SER A 83 ? N SER A 83 O PHE A 71 ? O PHE A 71 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >711 >ATOM 335 N N . LYS A 1 44 ? 21.315 24.784 39.778 1.00 12.26 ? 44 LYS A N 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >712 >ATOM 336 C CA . LYS A 1 44 ? 21.127 25.051 41.201 1.00 13.96 ? 44 LYS A CA 1 >_struct_site.id AC1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >713 >ATOM 337 C C . LYS A 1 44 ? 19.729 24.528 41.516 1.00 14.16 ? 44 LYS A C 1 >_struct_site.pdbx_evidence_code Software >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >714 >ATOM 338 O O . LYS A 1 44 ? 18.749 24.920 40.873 1.00 14.12 ? 44 LYS A O 1 >_struct_site.pdbx_auth_asym_id ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >715 >ATOM 339 C CB . LYS A 1 44 ? 21.220 26.545 41.503 1.00 16.58 ? 44 LYS A CB 1 >_struct_site.pdbx_auth_comp_id ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >716 >ATOM 340 C CG . LYS A 1 44 ? 22.580 27.150 41.170 1.00 22.90 ? 44 LYS A CG 1 >_struct_site.pdbx_auth_seq_id ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >717 >ATOM 341 C CD . LYS A 1 44 ? 22.571 28.654 41.385 1.00 29.01 ? 44 LYS A CD 1 >_struct_site.pdbx_auth_ins_code ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >718 >ATOM 342 C CE . LYS A 1 44 ? 23.890 29.293 40.982 1.00 31.56 ? 44 LYS A CE 1 >_struct_site.pdbx_num_residues 10 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >719 >ATOM 343 N NZ . LYS A 1 44 ? 23.818 30.781 41.111 1.00 34.70 ? 44 LYS A NZ 1 >_struct_site.details 'BINDING SITE FOR RESIDUE REA A 200' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >720 >ATOM 344 N N . GLN A 1 45 ? 19.649 23.594 42.460 1.00 15.66 ? 45 GLN A N 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >721 >ATOM 345 C CA . GLN A 1 45 ? 18.377 22.993 42.852 1.00 16.03 ? 45 GLN A CA 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >722 >ATOM 346 C C . GLN A 1 45 ? 18.098 23.182 44.342 1.00 17.60 ? 45 GLN A C 1 >_struct_site_gen.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >723 >ATOM 347 O O . GLN A 1 45 ? 18.989 23.024 45.164 1.00 17.17 ? 45 GLN A O 1 >_struct_site_gen.site_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >724 >ATOM 348 C CB . GLN A 1 45 ? 18.397 21.498 42.544 1.00 15.51 ? 45 GLN A CB 1 >_struct_site_gen.pdbx_num_res >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >725 >ATOM 349 C CG . GLN A 1 45 ? 17.168 20.744 43.015 1.00 13.62 ? 45 GLN A CG 1 >_struct_site_gen.label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >726 >ATOM 350 C CD . GLN A 1 45 ? 17.312 19.256 42.838 1.00 15.68 ? 45 GLN A CD 1 >_struct_site_gen.label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >727 >ATOM 351 O OE1 . GLN A 1 45 ? 18.348 18.769 42.397 1.00 18.84 ? 45 GLN A OE1 1 >_struct_site_gen.label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >728 >ATOM 352 N NE2 . GLN A 1 45 ? 16.276 18.521 43.177 1.00 16.73 ? 45 GLN A NE2 1 >_struct_site_gen.pdbx_auth_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >729 >ATOM 353 N N . GLU A 1 46 ? 16.868 23.551 44.670 1.00 18.48 ? 46 GLU A N 1 >_struct_site_gen.auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >730 >ATOM 354 C CA . GLU A 1 46 ? 16.441 23.718 46.062 1.00 21.26 ? 46 GLU A CA 1 >_struct_site_gen.auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >731 >ATOM 355 C C . GLU A 1 46 ? 15.108 23.004 46.105 1.00 19.06 ? 46 GLU A C 1 >_struct_site_gen.auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >732 >ATOM 356 O O . GLU A 1 46 ? 14.080 23.589 45.784 1.00 20.08 ? 46 GLU A O 1 >_struct_site_gen.label_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >733 >ATOM 357 C CB . GLU A 1 46 ? 16.239 25.194 46.408 1.00 26.45 ? 46 GLU A CB 1 >_struct_site_gen.label_alt_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >734 >ATOM 358 C CG . GLU A 1 46 ? 17.284 25.787 47.361 1.00 37.46 ? 46 GLU A CG 1 >_struct_site_gen.symmetry >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >735 >ATOM 359 C CD . GLU A 1 46 ? 17.093 25.374 48.832 1.00 42.24 ? 46 GLU A CD 1 >_struct_site_gen.details >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >736 >ATOM 360 O OE1 . GLU A 1 46 ? 16.192 25.944 49.501 1.00 44.05 ? 46 GLU A OE1 1 >1 AC1 10 GLU A 13 ? GLU A 13 . ? 3_655 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >737 >ATOM 361 O OE2 . GLU A 1 46 ? 17.867 24.507 49.320 1.00 44.14 ? 46 GLU A OE2 1 >2 AC1 10 ALA A 32 ? ALA A 32 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >738 >ATOM 362 N N . GLY A 1 47 ? 15.131 21.720 46.429 1.00 18.35 ? 47 GLY A N 1 >3 AC1 10 THR A 54 ? THR A 54 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >739 >ATOM 363 C CA . GLY A 1 47 ? 13.893 20.970 46.463 1.00 18.96 ? 47 GLY A CA 1 >4 AC1 10 VAL A 58 ? VAL A 58 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >740 >ATOM 364 C C . GLY A 1 47 ? 13.382 20.755 45.053 1.00 18.27 ? 47 GLY A C 1 >5 AC1 10 VAL A 76 ? VAL A 76 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >741 >ATOM 365 O O . GLY A 1 47 ? 14.067 20.157 44.238 1.00 18.05 ? 47 GLY A O 1 >6 AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >742 >ATOM 366 N N . ASP A 1 48 ? 12.194 21.262 44.755 1.00 16.66 ? 48 ASP A N 1 >7 AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >743 >ATOM 367 C CA . ASP A 1 48 ? 11.617 21.107 43.420 1.00 16.86 ? 48 ASP A CA 1 >8 AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >744 >ATOM 368 C C . ASP A 1 48 ? 11.771 22.378 42.566 1.00 15.92 ? 48 ASP A C 1 >9 AC1 10 HOH C . ? HOH A 309 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >745 >ATOM 369 O O . ASP A 1 48 ? 11.139 22.511 41.504 1.00 14.50 ? 48 ASP A O 1 >10 AC1 10 HOH C . ? HOH A 343 . ? 1_555 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >746 >ATOM 370 C CB . ASP A 1 48 ? 10.136 20.694 43.513 1.00 19.00 ? 48 ASP A CB 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >747 >ATOM 371 C CG . ASP A 1 48 ? 9.943 19.221 43.897 1.00 21.49 ? 48 ASP A CG 1 >_database_PDB_matrix.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >748 >ATOM 372 O OD1 . ASP A 1 48 ? 10.901 18.406 43.840 1.00 23.51 ? 48 ASP A OD1 1 >_database_PDB_matrix.origx[1][1] 1.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >749 >ATOM 373 O OD2 . ASP A 1 48 ? 8.802 18.868 44.243 1.00 25.04 ? 48 ASP A OD2 1 >_database_PDB_matrix.origx[1][2] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >750 >ATOM 374 N N . THR A 1 49 ? 12.610 23.299 43.042 1.00 13.75 ? 49 THR A N 1 >_database_PDB_matrix.origx[1][3] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >751 >ATOM 375 C CA . THR A 1 49 ? 12.870 24.551 42.348 1.00 13.82 ? 49 THR A CA 1 >_database_PDB_matrix.origx[2][1] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >752 >ATOM 376 C C . THR A 1 49 ? 14.231 24.460 41.678 1.00 13.22 ? 49 THR A C 1 >_database_PDB_matrix.origx[2][2] 1.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >753 >ATOM 377 O O . THR A 1 49 ? 15.235 24.152 42.322 1.00 12.56 ? 49 THR A O 1 >_database_PDB_matrix.origx[2][3] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >754 >ATOM 378 C CB . THR A 1 49 ? 12.847 25.741 43.316 1.00 16.10 ? 49 THR A CB 1 >_database_PDB_matrix.origx[3][1] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >755 >ATOM 379 O OG1 . THR A 1 49 ? 11.556 25.815 43.941 1.00 17.94 ? 49 THR A OG1 1 >_database_PDB_matrix.origx[3][2] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >756 >ATOM 380 C CG2 . THR A 1 49 ? 13.100 27.037 42.571 1.00 16.15 ? 49 THR A CG2 1 >_database_PDB_matrix.origx[3][3] 1.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >757 >ATOM 381 N N . PHE A 1 50 ? 14.266 24.794 40.392 1.00 12.20 ? 50 PHE A N 1 >_database_PDB_matrix.origx_vector[1] 0.00000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >758 >ATOM 382 C CA . PHE A 1 50 ? 15.485 24.704 39.602 1.00 10.82 ? 50 PHE A CA 1 >_database_PDB_matrix.origx_vector[2] 0.00000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >759 >ATOM 383 C C . PHE A 1 50 ? 15.842 25.979 38.855 1.00 10.40 ? 50 PHE A C 1 >_database_PDB_matrix.origx_vector[3] 0.00000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >760 >ATOM 384 O O . PHE A 1 50 ? 14.968 26.758 38.460 1.00 9.90 ? 50 PHE A O 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >761 >ATOM 385 C CB . PHE A 1 50 ? 15.338 23.591 38.547 1.00 10.78 ? 50 PHE A CB 1 >_atom_sites.entry_id 1CBS >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >762 >ATOM 386 C CG . PHE A 1 50 ? 15.316 22.192 39.107 1.00 13.13 ? 50 PHE A CG 1 >_atom_sites.fract_transf_matrix[1][1] 0.021906 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >763 >ATOM 387 C CD1 . PHE A 1 50 ? 14.146 21.653 39.634 1.00 11.97 ? 50 PHE A CD1 1 >_atom_sites.fract_transf_matrix[1][2] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >764 >ATOM 388 C CD2 . PHE A 1 50 ? 16.464 21.401 39.079 1.00 14.34 ? 50 PHE A CD2 1 >_atom_sites.fract_transf_matrix[1][3] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >765 >ATOM 389 C CE1 . PHE A 1 50 ? 14.113 20.367 40.120 1.00 12.69 ? 50 PHE A CE1 1 >_atom_sites.fract_transf_matrix[2][1] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >766 >ATOM 390 C CE2 . PHE A 1 50 ? 16.439 20.098 39.569 1.00 14.64 ? 50 PHE A CE2 1 >_atom_sites.fract_transf_matrix[2][2] 0.021026 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >767 >ATOM 391 C CZ . PHE A 1 50 ? 15.258 19.582 40.092 1.00 13.15 ? 50 PHE A CZ 1 >_atom_sites.fract_transf_matrix[2][3] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >768 >ATOM 392 N N . TYR A 1 51 ? 17.147 26.165 38.678 1.00 10.37 ? 51 TYR A N 1 >_atom_sites.fract_transf_matrix[3][1] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >769 >ATOM 393 C CA . TYR A 1 51 ? 17.709 27.258 37.910 1.00 10.95 ? 51 TYR A CA 1 >_atom_sites.fract_transf_matrix[3][2] 0.000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >770 >ATOM 394 C C . TYR A 1 51 ? 18.714 26.513 37.039 1.00 9.84 ? 51 TYR A C 1 >_atom_sites.fract_transf_matrix[3][3] 0.012885 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >771 >ATOM 395 O O . TYR A 1 51 ? 19.540 25.761 37.547 1.00 9.78 ? 51 TYR A O 1 >_atom_sites.fract_transf_vector[1] 0.00000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >772 >ATOM 396 C CB . TYR A 1 51 ? 18.436 28.284 38.790 1.00 12.57 ? 51 TYR A CB 1 >_atom_sites.fract_transf_vector[2] 0.00000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >773 >ATOM 397 C CG . TYR A 1 51 ? 19.396 29.178 38.014 1.00 12.91 ? 51 TYR A CG 1 >_atom_sites.fract_transf_vector[3] 0.00000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >774 >ATOM 398 C CD1 . TYR A 1 51 ? 18.939 30.302 37.327 1.00 15.83 ? 51 TYR A CD1 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >775 >ATOM 399 C CD2 . TYR A 1 51 ? 20.762 28.896 37.974 1.00 14.05 ? 51 TYR A CD2 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >776 >ATOM 400 C CE1 . TYR A 1 51 ? 19.822 31.126 36.621 1.00 16.52 ? 51 TYR A CE1 1 >_atom_type.symbol >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >777 >ATOM 401 C CE2 . TYR A 1 51 ? 21.655 29.705 37.275 1.00 14.62 ? 51 TYR A CE2 1 >C >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >778 >ATOM 402 C CZ . TYR A 1 51 ? 21.179 30.818 36.604 1.00 16.59 ? 51 TYR A CZ 1 >N >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >779 >ATOM 403 O OH . TYR A 1 51 ? 22.060 31.633 35.932 1.00 17.52 ? 51 TYR A OH 1 >O >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >780 >ATOM 404 N N . ILE A 1 52 ? 18.610 26.676 35.726 1.00 10.57 ? 52 ILE A N 1 >S >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >781 >ATOM 405 C CA . ILE A 1 52 ? 19.520 26.004 34.801 1.00 9.09 ? 52 ILE A CA 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >782 >ATOM 406 C C . ILE A 1 52 ? 20.066 27.020 33.801 1.00 8.55 ? 52 ILE A C 1 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >783 >ATOM 407 O O . ILE A 1 52 ? 19.296 27.652 33.086 1.00 10.49 ? 52 ILE A O 1 >_atom_site.group_PDB >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >784 >ATOM 408 C CB . ILE A 1 52 ? 18.807 24.859 34.026 1.00 8.96 ? 52 ILE A CB 1 >_atom_site.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >785 >ATOM 409 C CG1 . ILE A 1 52 ? 18.242 23.814 35.013 1.00 9.15 ? 52 ILE A CG1 1 >_atom_site.type_symbol >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >786 >ATOM 410 C CG2 . ILE A 1 52 ? 19.792 24.189 33.070 1.00 10.39 ? 52 ILE A CG2 1 >_atom_site.label_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >787 >ATOM 411 C CD1 . ILE A 1 52 ? 17.585 22.616 34.366 1.00 8.10 ? 52 ILE A CD1 1 >_atom_site.label_alt_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >788 >ATOM 412 N N . LYS A 1 53 ? 21.388 27.197 33.791 1.00 8.61 ? 53 LYS A N 1 >_atom_site.label_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >789 >ATOM 413 C CA . LYS A 1 53 ? 22.049 28.115 32.868 1.00 9.66 ? 53 LYS A CA 1 >_atom_site.label_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >790 >ATOM 414 C C . LYS A 1 53 ? 22.939 27.319 31.924 1.00 8.71 ? 53 LYS A C 1 >_atom_site.label_entity_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >791 >ATOM 415 O O . LYS A 1 53 ? 23.815 26.583 32.362 1.00 7.58 ? 53 LYS A O 1 >_atom_site.label_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >792 >ATOM 416 C CB . LYS A 1 53 ? 22.909 29.120 33.611 1.00 10.60 ? 53 LYS A CB 1 >_atom_site.pdbx_PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >793 >ATOM 417 C CG . LYS A 1 53 ? 23.580 30.135 32.688 1.00 14.21 ? 53 LYS A CG 1 >_atom_site.Cartn_x >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >794 >ATOM 418 C CD . LYS A 1 53 ? 24.496 31.006 33.505 1.00 20.27 ? 53 LYS A CD 1 >_atom_site.Cartn_y >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >795 >ATOM 419 C CE . LYS A 1 53 ? 24.831 32.319 32.828 1.00 26.91 ? 53 LYS A CE 1 >_atom_site.Cartn_z >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >796 >ATOM 420 N NZ . LYS A 1 53 ? 25.878 33.009 33.659 1.00 29.12 ? 53 LYS A NZ 1 >_atom_site.occupancy >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >797 >ATOM 421 N N . THR A 1 54 ? 22.686 27.445 30.625 1.00 8.49 ? 54 THR A N 1 >_atom_site.B_iso_or_equiv >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >798 >ATOM 422 C CA . THR A 1 54 ? 23.478 26.747 29.628 1.00 7.98 ? 54 THR A CA 1 >_atom_site.pdbx_formal_charge >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >799 >ATOM 423 C C . THR A 1 54 ? 24.118 27.820 28.764 1.00 8.23 ? 54 THR A C 1 >_atom_site.auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >800 >ATOM 424 O O . THR A 1 54 ? 23.433 28.584 28.087 1.00 8.40 ? 54 THR A O 1 >_atom_site.auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >801 >ATOM 425 C CB . THR A 1 54 ? 22.621 25.817 28.789 1.00 8.33 ? 54 THR A CB 1 >_atom_site.auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >802 >ATOM 426 O OG1 . THR A 1 54 ? 21.896 24.946 29.660 1.00 9.95 ? 54 THR A OG1 1 >_atom_site.auth_atom_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >803 >ATOM 427 C CG2 . THR A 1 54 ? 23.505 24.976 27.873 1.00 4.95 ? 54 THR A CG2 1 >_atom_site.pdbx_PDB_model_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >804 >ATOM 428 N N . SER A 1 55 ? 25.444 27.840 28.758 1.00 8.75 ? 55 SER A N 1 >ATOM 1 N N . PRO A 1 1 ? 16.979 13.301 44.555 1.00 30.05 ? 1 PRO A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >805 >ATOM 429 C CA . SER A 1 55 ? 26.171 28.865 28.047 1.00 10.50 ? 55 SER A CA 1 >ATOM 2 C CA . PRO A 1 1 ? 18.150 13.525 43.680 1.00 28.82 ? 1 PRO A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >806 >ATOM 430 C C . SER A 1 55 ? 27.116 28.382 26.950 1.00 9.24 ? 55 SER A C 1 >ATOM 3 C C . PRO A 1 1 ? 18.656 14.966 43.784 1.00 26.59 ? 1 PRO A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >807 >ATOM 431 O O . SER A 1 55 ? 27.802 27.370 27.101 1.00 8.98 ? 55 SER A O 1 >ATOM 4 O O . PRO A 1 1 ? 17.890 15.889 44.078 1.00 26.84 ? 1 PRO A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >808 >ATOM 432 C CB . SER A 1 55 ? 26.934 29.694 29.082 1.00 13.09 ? 55 SER A CB 1 >ATOM 5 C CB . PRO A 1 1 ? 17.678 13.270 42.255 1.00 29.24 ? 1 PRO A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >809 >ATOM 433 O OG . SER A 1 55 ? 27.781 30.646 28.473 1.00 23.11 ? 55 SER A OG 1 >ATOM 6 C CG . PRO A 1 1 ? 16.248 13.734 42.347 1.00 29.29 ? 1 PRO A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >810 >ATOM 434 N N . THR A 1 56 ? 27.091 29.094 25.825 1.00 8.86 ? 56 THR A N 1 >ATOM 7 C CD . PRO A 1 1 ? 15.762 13.216 43.724 1.00 30.71 ? 1 PRO A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >811 >ATOM 435 C CA . THR A 1 56 ? 27.978 28.831 24.684 1.00 8.05 ? 56 THR A CA 1 >ATOM 8 N N . ASN A 1 2 ? 19.957 15.139 43.558 1.00 24.04 ? 2 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >812 >ATOM 436 C C . THR A 1 56 ? 28.393 30.215 24.138 1.00 8.09 ? 56 THR A C 1 >ATOM 9 C CA . ASN A 1 2 ? 20.576 16.457 43.578 1.00 20.79 ? 2 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >813 >ATOM 437 O O . THR A 1 56 ? 27.834 31.237 24.525 1.00 7.17 ? 56 THR A O 1 >ATOM 10 C C . ASN A 1 2 ? 21.301 16.714 42.262 1.00 16.75 ? 2 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >814 >ATOM 438 C CB . THR A 1 56 ? 27.296 28.024 23.534 1.00 6.70 ? 56 THR A CB 1 >ATOM 11 O O . ASN A 1 2 ? 22.402 16.215 42.028 1.00 15.23 ? 2 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >815 >ATOM 439 O OG1 . THR A 1 56 ? 26.294 28.829 22.909 1.00 9.76 ? 56 THR A OG1 1 >ATOM 12 C CB . ASN A 1 2 ? 21.559 16.620 44.724 1.00 22.81 ? 2 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >816 >ATOM 440 C CG2 . THR A 1 56 ? 26.653 26.751 24.049 1.00 7.76 ? 56 THR A CG2 1 >ATOM 13 C CG . ASN A 1 2 ? 22.240 17.968 44.685 1.00 24.29 ? 2 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >817 >ATOM 441 N N . THR A 1 57 ? 29.381 30.242 23.249 1.00 9.17 ? 57 THR A N 1 >ATOM 14 O OD1 . ASN A 1 2 ? 21.612 18.984 44.358 1.00 21.87 ? 2 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >818 >ATOM 442 C CA . THR A 1 57 ? 29.871 31.485 22.644 1.00 8.49 ? 57 THR A CA 1 >ATOM 15 N ND2 . ASN A 1 2 ? 23.537 17.983 44.966 1.00 27.94 ? 2 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >819 >ATOM 443 C C . THR A 1 57 ? 28.820 32.222 21.802 1.00 7.50 ? 57 THR A C 1 >ATOM 16 N N . PHE A 1 3 ? 20.637 17.477 41.402 1.00 14.69 ? 3 PHE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >820 >ATOM 444 O O . THR A 1 57 ? 28.952 33.412 21.565 1.00 9.40 ? 57 THR A O 1 >ATOM 17 C CA . PHE A 1 3 ? 21.144 17.838 40.087 1.00 12.62 ? 3 PHE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >821 >ATOM 445 C CB . THR A 1 57 ? 31.091 31.205 21.716 1.00 9.12 ? 57 THR A CB 1 >ATOM 18 C C . PHE A 1 3 ? 22.152 18.987 40.140 1.00 12.43 ? 3 PHE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >822 >ATOM 446 O OG1 . THR A 1 57 ? 30.758 30.171 20.786 1.00 9.41 ? 57 THR A OG1 1 >ATOM 19 O O . PHE A 1 3 ? 22.796 19.289 39.136 1.00 12.12 ? 3 PHE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >823 >ATOM 447 C CG2 . THR A 1 57 ? 32.297 30.775 22.516 1.00 11.48 ? 57 THR A CG2 1 >ATOM 20 C CB . PHE A 1 3 ? 19.970 18.262 39.188 1.00 10.74 ? 3 PHE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >824 >ATOM 448 N N . VAL A 1 58 ? 27.786 31.510 21.356 1.00 8.04 ? 58 VAL A N 1 >ATOM 21 C CG . PHE A 1 3 ? 19.073 17.128 38.750 1.00 11.85 ? 3 PHE A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >825 >ATOM 449 C CA . VAL A 1 58 ? 26.733 32.090 20.500 1.00 9.09 ? 58 VAL A CA 1 >ATOM 22 C CD1 . PHE A 1 3 ? 18.066 16.646 39.581 1.00 10.90 ? 3 PHE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >826 >ATOM 450 C C . VAL A 1 58 ? 25.328 32.224 21.102 1.00 8.67 ? 58 VAL A C 1 >ATOM 23 C CD2 . PHE A 1 3 ? 19.189 16.588 37.475 1.00 13.26 ? 3 PHE A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >827 >ATOM 451 O O . VAL A 1 58 ? 24.466 32.892 20.531 1.00 6.97 ? 58 VAL A O 1 >ATOM 24 C CE1 . PHE A 1 3 ? 17.200 15.662 39.149 1.00 9.12 ? 3 PHE A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >828 >ATOM 452 C CB . VAL A 1 58 ? 26.602 31.287 19.155 1.00 9.96 ? 58 VAL A CB 1 >ATOM 25 C CE2 . PHE A 1 3 ? 18.312 15.594 37.041 1.00 11.76 ? 3 PHE A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >829 >ATOM 453 C CG1 . VAL A 1 58 ? 27.976 31.161 18.454 1.00 11.08 ? 58 VAL A CG1 1 >ATOM 26 C CZ . PHE A 1 3 ? 17.324 15.137 37.878 1.00 10.30 ? 3 PHE A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >830 >ATOM 454 C CG2 . VAL A 1 58 ? 26.010 29.890 19.404 1.00 9.41 ? 58 VAL A CG2 1 >ATOM 27 N N . SER A 1 4 ? 22.282 19.630 41.299 1.00 11.24 ? 4 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >831 >ATOM 455 N N . ARG A 1 59 ? 25.100 31.620 22.266 1.00 8.88 ? 59 ARG A N 1 >ATOM 28 C CA . SER A 1 4 ? 23.170 20.780 41.464 1.00 11.30 ? 4 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >832 >ATOM 456 C CA . ARG A 1 59 ? 23.783 31.655 22.882 1.00 9.95 ? 59 ARG A CA 1 >ATOM 29 C C . SER A 1 4 ? 24.627 20.568 41.091 1.00 10.39 ? 4 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >833 >ATOM 457 C C . ARG A 1 59 ? 23.843 31.140 24.303 1.00 10.14 ? 59 ARG A C 1 >ATOM 30 O O . SER A 1 4 ? 25.201 19.532 41.384 1.00 10.24 ? 4 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >834 >ATOM 458 O O . ARG A 1 59 ? 24.440 30.108 24.556 1.00 10.10 ? 59 ARG A O 1 >ATOM 31 C CB . SER A 1 4 ? 23.112 21.301 42.906 1.00 13.53 ? 4 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >835 >ATOM 459 C CB . ARG A 1 59 ? 22.837 30.751 22.074 1.00 13.11 ? 59 ARG A CB 1 >ATOM 32 O OG . SER A 1 4 ? 21.821 21.787 43.240 1.00 16.76 ? 4 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >836 >ATOM 460 C CG . ARG A 1 59 ? 21.417 30.569 22.623 1.00 16.80 ? 59 ARG A CG 1 >ATOM 33 N N . GLY A 1 5 ? 25.224 21.572 40.460 1.00 9.87 ? 5 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >837 >ATOM 461 C CD . ARG A 1 59 ? 20.521 29.961 21.535 1.00 18.74 ? 59 ARG A CD 1 >ATOM 34 C CA . GLY A 1 5 ? 26.628 21.486 40.103 1.00 10.86 ? 5 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >838 >ATOM 462 N NE . ARG A 1 59 ? 19.250 29.440 22.032 1.00 20.63 ? 59 ARG A NE 1 >ATOM 35 C C . GLY A 1 5 ? 26.985 22.158 38.794 1.00 11.21 ? 5 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >839 >ATOM 463 C CZ . ARG A 1 59 ? 18.147 30.165 22.193 1.00 22.94 ? 59 ARG A CZ 1 >ATOM 36 O O . GLY A 1 5 ? 26.123 22.761 38.142 1.00 9.91 ? 5 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >840 >ATOM 464 N NH1 . ARG A 1 59 ? 18.138 31.462 21.894 1.00 22.55 ? 59 ARG A NH1 1 >ATOM 37 N N . ASN A 1 6 ? 28.277 22.142 38.475 1.00 10.41 ? 6 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >841 >ATOM 465 N NH2 . ARG A 1 59 ? 17.051 29.594 22.686 1.00 23.68 ? 59 ARG A NH2 1 >ATOM 38 C CA . ASN A 1 6 ? 28.796 22.676 37.211 1.00 11.06 ? 6 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >842 >ATOM 466 N N . THR A 1 60 ? 23.183 31.849 25.211 1.00 11.23 ? 60 THR A N 1 >ATOM 39 C C . ASN A 1 6 ? 29.117 21.435 36.378 1.00 10.33 ? 6 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >843 >ATOM 467 C CA . THR A 1 60 ? 23.120 31.458 26.611 1.00 11.84 ? 60 THR A CA 1 >ATOM 40 O O . ASN A 1 6 ? 29.947 20.603 36.754 1.00 11.28 ? 6 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >844 >ATOM 468 C C . THR A 1 60 ? 21.650 31.500 27.005 1.00 11.73 ? 60 THR A C 1 >ATOM 41 C CB . ASN A 1 6 ? 30.023 23.548 37.445 1.00 12.95 ? 6 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >845 >ATOM 469 O O . THR A 1 60 ? 20.934 32.423 26.620 1.00 13.69 ? 60 THR A O 1 >ATOM 42 C CG . ASN A 1 6 ? 29.675 24.816 38.200 1.00 18.08 ? 6 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >846 >ATOM 470 C CB . THR A 1 60 ? 23.916 32.451 27.519 1.00 10.13 ? 60 THR A CB 1 >ATOM 43 O OD1 . ASN A 1 6 ? 29.022 25.708 37.665 1.00 19.52 ? 6 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >847 >ATOM 471 O OG1 . THR A 1 60 ? 25.320 32.302 27.276 1.00 10.55 ? 60 THR A OG1 1 >ATOM 44 N ND2 . ASN A 1 6 ? 30.047 24.872 39.467 1.00 21.23 ? 6 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >848 >ATOM 472 C CG2 . THR A 1 60 ? 23.632 32.181 29.003 1.00 11.01 ? 60 THR A CG2 1 >ATOM 45 N N . TRP A 1 7 ? 28.399 21.289 35.272 1.00 8.66 ? 7 TRP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >849 >ATOM 473 N N . THR A 1 61 ? 21.183 30.470 27.706 1.00 11.78 ? 61 THR A N 1 >ATOM 46 C CA . TRP A 1 7 ? 28.518 20.119 34.424 1.00 8.74 ? 7 TRP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >850 >ATOM 474 C CA . THR A 1 61 ? 19.797 30.413 28.175 1.00 11.54 ? 61 THR A CA 1 >ATOM 47 C C . TRP A 1 7 ? 29.246 20.352 33.092 1.00 9.63 ? 7 TRP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >851 >ATOM 475 C C . THR A 1 61 ? 19.831 30.214 29.686 1.00 10.88 ? 61 THR A C 1 >ATOM 48 O O . TRP A 1 7 ? 29.064 21.389 32.440 1.00 9.45 ? 7 TRP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >852 >ATOM 476 O O . THR A 1 61 ? 20.734 29.570 30.205 1.00 9.63 ? 61 THR A O 1 >ATOM 49 C CB . TRP A 1 7 ? 27.115 19.563 34.152 1.00 8.00 ? 7 TRP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >853 >ATOM 477 C CB . THR A 1 61 ? 18.965 29.229 27.539 1.00 12.65 ? 61 THR A CB 1 >ATOM 50 C CG . TRP A 1 7 ? 26.325 19.198 35.391 1.00 8.01 ? 7 TRP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >854 >ATOM 478 O OG1 . THR A 1 61 ? 19.563 27.976 27.874 1.00 14.13 ? 61 THR A OG1 1 >ATOM 51 C CD1 . TRP A 1 7 ? 25.556 20.031 36.159 1.00 8.29 ? 7 TRP A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >855 >ATOM 479 C CG2 . THR A 1 61 ? 18.889 29.336 26.012 1.00 14.15 ? 61 THR A CG2 1 >ATOM 52 C CD2 . TRP A 1 7 ? 26.174 17.885 35.947 1.00 7.60 ? 7 TRP A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >856 >ATOM 480 N N . GLU A 1 62 ? 18.878 30.828 30.382 1.00 12.14 ? 62 GLU A N 1 >ATOM 53 N NE1 . TRP A 1 7 ? 24.922 19.308 37.156 1.00 9.20 ? 7 TRP A NE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >857 >ATOM 481 C CA . GLU A 1 62 ? 18.749 30.698 31.833 1.00 12.88 ? 62 GLU A CA 1 >ATOM 54 C CE2 . TRP A 1 7 ? 25.286 17.987 37.046 1.00 8.73 ? 7 TRP A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >858 >ATOM 482 C C . GLU A 1 62 ? 17.283 30.444 32.100 1.00 12.21 ? 62 GLU A C 1 >ATOM 55 C CE3 . TRP A 1 7 ? 26.694 16.625 35.618 1.00 6.99 ? 7 TRP A CE3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >859 >ATOM 483 O O . GLU A 1 62 ? 16.450 31.270 31.745 1.00 13.95 ? 62 GLU A O 1 >ATOM 56 C CZ2 . TRP A 1 7 ? 24.909 16.876 37.815 1.00 7.67 ? 7 TRP A CZ2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >860 >ATOM 484 C CB . GLU A 1 62 ? 19.151 31.990 32.538 1.00 16.15 ? 62 GLU A CB 1 >ATOM 57 C CZ3 . TRP A 1 7 ? 26.320 15.527 36.380 1.00 7.58 ? 7 TRP A CZ3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >861 >ATOM 485 C CG . GLU A 1 62 ? 20.585 32.344 32.326 1.00 23.65 ? 62 GLU A CG 1 >ATOM 58 C CH2 . TRP A 1 7 ? 25.433 15.663 37.468 1.00 5.92 ? 7 TRP A CH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >862 >ATOM 486 C CD . GLU A 1 62 ? 20.961 33.649 32.979 1.00 29.90 ? 62 GLU A CD 1 >ATOM 59 N N . LYS A 1 8 ? 30.052 19.368 32.702 1.00 9.39 ? 8 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >863 >ATOM 487 O OE1 . GLU A 1 62 ? 20.969 33.703 34.229 1.00 31.84 ? 62 GLU A OE1 1 >ATOM 60 C CA . LYS A 1 8 ? 30.802 19.424 31.450 1.00 11.56 ? 8 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >864 >ATOM 488 O OE2 . GLU A 1 62 ? 21.258 34.616 32.236 1.00 33.89 ? 62 GLU A OE2 1 >ATOM 61 C C . LYS A 1 8 ? 30.342 18.243 30.611 1.00 10.56 ? 8 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >865 >ATOM 489 N N . ILE A 1 63 ? 16.943 29.292 32.657 1.00 10.43 ? 63 ILE A N 1 >ATOM 62 O O . LYS A 1 8 ? 30.091 17.158 31.138 1.00 10.14 ? 8 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >866 >ATOM 490 C CA . ILE A 1 63 ? 15.548 29.021 32.946 1.00 11.02 ? 63 ILE A CA 1 >ATOM 63 C CB . LYS A 1 8 ? 32.308 19.360 31.710 1.00 15.20 ? 8 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >867 >ATOM 491 C C . ILE A 1 63 ? 15.352 28.816 34.446 1.00 11.60 ? 63 ILE A C 1 >ATOM 64 C CG . LYS A 1 8 ? 32.785 18.080 32.313 1.00 18.52 ? 8 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >868 >ATOM 492 O O . ILE A 1 63 ? 16.286 28.434 35.144 1.00 9.20 ? 63 ILE A O 1 >ATOM 65 C CD . LYS A 1 8 ? 34.263 18.182 32.618 1.00 26.26 ? 8 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >869 >ATOM 493 C CB . ILE A 1 63 ? 14.976 27.816 32.125 1.00 11.28 ? 63 ILE A CB 1 >ATOM 66 C CE . LYS A 1 8 ? 35.091 18.499 31.378 1.00 29.22 ? 8 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >870 >ATOM 494 C CG1 . ILE A 1 63 ? 15.717 26.519 32.431 1.00 10.60 ? 63 ILE A CG1 1 >ATOM 67 N NZ . LYS A 1 8 ? 35.067 17.393 30.369 1.00 32.48 ? 8 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >871 >ATOM 495 C CG2 . ILE A 1 63 ? 15.020 28.129 30.638 1.00 11.62 ? 63 ILE A CG2 1 >ATOM 68 N N . ILE A 1 9 ? 30.222 18.447 29.308 1.00 8.21 ? 9 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >872 >ATOM 496 C CD1 . ILE A 1 63 ? 15.126 25.293 31.720 1.00 13.40 ? 63 ILE A CD1 1 >ATOM 69 C CA . ILE A 1 9 ? 29.739 17.384 28.441 1.00 8.08 ? 9 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >873 >ATOM 497 N N . ASN A 1 64 ? 14.184 29.219 34.933 1.00 12.13 ? 64 ASN A N 1 >ATOM 70 C C . ILE A 1 9 ? 30.798 16.325 28.117 1.00 7.86 ? 9 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >874 >ATOM 498 C CA . ASN A 1 64 ? 13.824 29.083 36.343 1.00 14.79 ? 64 ASN A CA 1 >ATOM 71 O O . ILE A 1 9 ? 31.990 16.635 28.028 1.00 8.38 ? 9 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >875 >ATOM 499 C C . ASN A 1 64 ? 12.451 28.441 36.375 1.00 13.29 ? 64 ASN A C 1 >ATOM 72 C CB . ILE A 1 9 ? 29.148 17.997 27.144 1.00 10.70 ? 9 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >876 >ATOM 500 O O . ASN A 1 64 ? 11.490 28.976 35.802 1.00 13.29 ? 64 ASN A O 1 >ATOM 73 C CG1 . ILE A 1 9 ? 28.285 16.981 26.401 1.00 10.95 ? 9 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >877 >ATOM 501 C CB . ASN A 1 64 ? 13.732 30.450 37.054 1.00 16.87 ? 64 ASN A CB 1 >ATOM 74 C CG2 . ILE A 1 9 ? 30.261 18.500 26.243 1.00 10.70 ? 9 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >878 >ATOM 502 C CG . ASN A 1 64 ? 15.079 31.089 37.279 1.00 20.91 ? 64 ASN A CG 1 >ATOM 75 C CD1 . ILE A 1 9 ? 27.586 17.597 25.207 1.00 13.23 ? 9 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >879 >ATOM 503 O OD1 . ASN A 1 64 ? 15.775 30.764 38.238 1.00 22.91 ? 64 ASN A OD1 1 >ATOM 76 N N . ILE A 1 10 ? 30.373 15.067 27.995 1.00 7.08 ? 10 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >880 >ATOM 504 N ND2 . ASN A 1 64 ? 15.459 32.007 36.393 1.00 22.20 ? 64 ASN A ND2 1 >ATOM 77 C CA . ILE A 1 10 ? 31.288 13.988 27.656 1.00 7.45 ? 10 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >881 >ATOM 505 N N . PHE A 1 65 ? 12.347 27.301 37.044 1.00 12.90 ? 65 PHE A N 1 >ATOM 78 C C . ILE A 1 10 ? 30.812 13.201 26.441 1.00 8.49 ? 10 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >882 >ATOM 506 C CA . PHE A 1 65 ? 11.058 26.641 37.132 1.00 12.63 ? 65 PHE A CA 1 >ATOM 79 O O . ILE A 1 10 ? 31.561 12.397 25.892 1.00 9.49 ? 10 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >883 >ATOM 507 C C . PHE A 1 65 ? 10.858 25.841 38.410 1.00 13.07 ? 65 PHE A C 1 >ATOM 80 C CB . ILE A 1 10 ? 31.586 13.023 28.847 1.00 10.28 ? 10 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >884 >ATOM 508 O O . PHE A 1 65 ? 11.811 25.531 39.121 1.00 12.50 ? 65 PHE A O 1 >ATOM 81 C CG1 . ILE A 1 10 ? 30.304 12.393 29.382 1.00 10.51 ? 10 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >885 >ATOM 509 C CB . PHE A 1 65 ? 10.829 25.731 35.922 1.00 11.31 ? 65 PHE A CB 1 >ATOM 82 C CG2 . ILE A 1 10 ? 32.349 13.756 29.963 1.00 10.10 ? 10 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >886 >ATOM 510 C CG . PHE A 1 65 ? 11.794 24.586 35.825 1.00 12.32 ? 65 PHE A CG 1 >ATOM 83 C CD1 . ILE A 1 10 ? 30.578 11.242 30.325 1.00 12.18 ? 10 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >887 >ATOM 511 C CD1 . PHE A 1 65 ? 11.549 23.386 36.494 1.00 10.31 ? 65 PHE A CD1 1 >ATOM 84 N N . ARG A 1 11 ? 29.566 13.419 26.030 1.00 7.59 ? 11 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >888 >ATOM 512 C CD2 . PHE A 1 65 ? 12.947 24.706 35.070 1.00 11.23 ? 65 PHE A CD2 1 >ATOM 85 C CA . ARG A 1 11 ? 29.015 12.742 24.851 1.00 8.70 ? 11 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >889 >ATOM 513 C CE1 . PHE A 1 65 ? 12.441 22.329 36.413 1.00 11.00 ? 65 PHE A CE1 1 >ATOM 86 C C . ARG A 1 11 ? 27.821 13.500 24.290 1.00 9.41 ? 11 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >890 >ATOM 514 C CE2 . PHE A 1 65 ? 13.847 23.645 34.984 1.00 11.69 ? 65 PHE A CE2 1 >ATOM 87 O O . ARG A 1 11 ? 26.990 14.004 25.043 1.00 9.84 ? 11 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >891 >ATOM 515 C CZ . PHE A 1 65 ? 13.593 22.461 35.655 1.00 12.20 ? 65 PHE A CZ 1 >ATOM 88 C CB . ARG A 1 11 ? 28.563 11.316 25.184 1.00 8.07 ? 11 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >892 >ATOM 516 N N . LYS A 1 66 ? 9.599 25.560 38.713 1.00 13.15 ? 66 LYS A N 1 >ATOM 89 C CG . ARG A 1 11 ? 27.912 10.616 23.998 1.00 12.26 ? 11 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >893 >ATOM 517 C CA . LYS A 1 66 ? 9.251 24.735 39.849 1.00 13.41 ? 66 LYS A CA 1 >ATOM 90 C CD . ARG A 1 11 ? 27.234 9.340 24.394 1.00 13.46 ? 11 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >894 >ATOM 518 C C . LYS A 1 66 ? 8.555 23.552 39.178 1.00 12.17 ? 66 LYS A C 1 >ATOM 91 N NE . ARG A 1 11 ? 28.157 8.304 24.847 1.00 15.44 ? 11 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >895 >ATOM 519 O O . LYS A 1 66 ? 7.763 23.747 38.251 1.00 12.93 ? 66 LYS A O 1 >ATOM 92 C CZ . ARG A 1 11 ? 28.815 7.470 24.037 1.00 19.59 ? 11 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >896 >ATOM 520 C CB . LYS A 1 66 ? 8.313 25.498 40.800 1.00 16.68 ? 66 LYS A CB 1 >ATOM 93 N NH1 . ARG A 1 11 ? 28.677 7.559 22.714 1.00 19.40 ? 11 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >897 >ATOM 521 C CG . LYS A 1 66 ? 7.722 24.639 41.907 1.00 24.60 ? 66 LYS A CG 1 >ATOM 94 N NH2 . ARG A 1 11 ? 29.521 6.467 24.547 1.00 17.50 ? 11 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >898 >ATOM 522 C CD . LYS A 1 66 ? 7.391 25.453 43.165 1.00 28.53 ? 66 LYS A CD 1 >ATOM 95 N N . SER A 1 12 ? 27.748 13.594 22.965 1.00 8.84 ? 12 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >899 >ATOM 523 C CE . LYS A 1 66 ? 6.664 24.585 44.213 1.00 32.17 ? 66 LYS A CE 1 >ATOM 96 C CA . SER A 1 12 ? 26.621 14.245 22.310 1.00 8.61 ? 12 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >900 >ATOM 524 N NZ . LYS A 1 66 ? 7.393 23.332 44.604 1.00 32.54 ? 66 LYS A NZ 1 >ATOM 97 C C . SER A 1 12 ? 26.278 13.431 21.063 1.00 9.48 ? 12 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >901 >ATOM 525 N N . VAL A 1 67 ? 8.918 22.329 39.562 1.00 11.82 ? 67 VAL A N 1 >ATOM 98 O O . SER A 1 12 ? 27.159 13.147 20.250 1.00 9.84 ? 12 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >902 >ATOM 526 C CA . VAL A 1 67 ? 8.295 21.141 38.975 1.00 10.93 ? 67 VAL A CA 1 >ATOM 99 C CB . SER A 1 12 ? 26.966 15.676 21.925 1.00 9.02 ? 12 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >903 >ATOM 527 C C . VAL A 1 67 ? 6.783 21.174 39.226 1.00 11.97 ? 67 VAL A C 1 >ATOM 100 O OG . SER A 1 12 ? 25.863 16.285 21.273 1.00 11.97 ? 12 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >904 >ATOM 528 O O . VAL A 1 67 ? 6.343 21.480 40.342 1.00 13.54 ? 67 VAL A O 1 >ATOM 101 N N . GLU A 1 13 ? 25.016 13.038 20.924 1.00 7.59 ? 13 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >905 >ATOM 529 C CB . VAL A 1 67 ? 8.908 19.827 39.541 1.00 10.09 ? 67 VAL A CB 1 >ATOM 102 C CA . GLU A 1 13 ? 24.586 12.258 19.768 1.00 9.67 ? 13 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >906 >ATOM 530 C CG1 . VAL A 1 67 ? 8.271 18.617 38.883 1.00 10.96 ? 67 VAL A CG1 1 >ATOM 103 C C . GLU A 1 13 ? 23.368 12.887 19.118 1.00 9.06 ? 13 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >907 >ATOM 531 C CG2 . VAL A 1 67 ? 10.410 19.808 39.320 1.00 10.21 ? 67 VAL A CG2 1 >ATOM 104 O O . GLU A 1 13 ? 22.457 13.343 19.815 1.00 7.34 ? 13 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >908 >ATOM 532 N N . GLY A 1 68 ? 6.006 20.965 38.160 1.00 9.80 ? 68 GLY A N 1 >ATOM 105 C CB . GLU A 1 13 ? 24.185 10.833 20.184 1.00 9.72 ? 13 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >909 >ATOM 533 C CA . GLY A 1 68 ? 4.557 20.962 38.265 1.00 9.33 ? 68 GLY A CA 1 >ATOM 106 C CG . GLU A 1 13 ? 25.257 10.018 20.895 1.00 15.17 ? 13 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >910 >ATOM 534 C C . GLY A 1 68 ? 3.887 22.298 38.031 1.00 10.60 ? 68 GLY A C 1 >ATOM 107 C CD . GLU A 1 13 ? 26.262 9.340 19.954 1.00 18.75 ? 13 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >911 >ATOM 535 O O . GLY A 1 68 ? 2.653 22.389 38.039 1.00 11.93 ? 68 GLY A O 1 >ATOM 108 O OE1 . GLU A 1 13 ? 26.031 9.310 18.726 1.00 18.53 ? 13 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >912 >ATOM 536 N N . GLU A 1 69 ? 4.688 23.337 37.809 1.00 11.12 ? 69 GLU A N 1 >ATOM 109 O OE2 . GLU A 1 13 ? 27.286 8.822 20.457 1.00 19.23 ? 13 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >913 >ATOM 537 C CA . GLU A 1 69 ? 4.165 24.682 37.553 1.00 12.64 ? 69 GLU A CA 1 >ATOM 110 N N . ASN A 1 14 ? 23.363 12.919 17.786 1.00 8.79 ? 14 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >914 >ATOM 538 C C . GLU A 1 69 ? 4.604 25.185 36.184 1.00 13.09 ? 69 GLU A C 1 >ATOM 111 C CA . ASN A 1 14 ? 22.202 13.408 17.025 1.00 8.29 ? 14 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >915 >ATOM 539 O O . GLU A 1 69 ? 5.774 25.107 35.820 1.00 12.17 ? 69 GLU A O 1 >ATOM 112 C C . ASN A 1 14 ? 21.813 14.896 17.153 1.00 7.35 ? 14 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >916 >ATOM 540 C CB . GLU A 1 69 ? 4.578 25.642 38.668 1.00 12.20 ? 69 GLU A CB 1 >ATOM 113 O O . ASN A 1 14 ? 20.681 15.245 16.860 1.00 7.00 ? 14 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >917 >ATOM 541 C CG . GLU A 1 69 ? 3.857 25.282 39.964 1.00 17.44 ? 69 GLU A CG 1 >ATOM 114 C CB . ASN A 1 14 ? 20.989 12.522 17.383 1.00 7.23 ? 14 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >918 >ATOM 542 C CD . GLU A 1 69 ? 4.116 26.211 41.138 1.00 21.02 ? 69 GLU A CD 1 >ATOM 115 C CG . ASN A 1 14 ? 20.358 11.833 16.172 1.00 9.38 ? 14 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >919 >ATOM 543 O OE1 . GLU A 1 69 ? 4.496 27.384 40.945 1.00 21.43 ? 69 GLU A OE1 1 >ATOM 116 O OD1 . ASN A 1 14 ? 20.996 11.670 15.128 1.00 10.37 ? 14 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >920 >ATOM 544 O OE2 . GLU A 1 69 ? 3.902 25.753 42.282 1.00 23.44 ? 69 GLU A OE2 1 >ATOM 117 N ND2 . ASN A 1 14 ? 19.106 11.436 16.310 1.00 6.35 ? 14 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >921 >ATOM 545 N N . GLU A 1 70 ? 3.633 25.622 35.397 1.00 14.53 ? 70 GLU A N 1 >ATOM 118 N N . PHE A 1 15 ? 22.734 15.777 17.536 1.00 7.26 ? 15 PHE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >922 >ATOM 546 C CA . GLU A 1 70 ? 3.912 26.102 34.059 1.00 15.80 ? 70 GLU A CA 1 >ATOM 119 C CA . PHE A 1 15 ? 22.385 17.198 17.681 1.00 9.06 ? 15 PHE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >923 >ATOM 547 C C . GLU A 1 70 ? 4.816 27.329 34.007 1.00 13.72 ? 70 GLU A C 1 >ATOM 120 C C . PHE A 1 15 ? 22.041 17.878 16.358 1.00 9.15 ? 15 PHE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >924 >ATOM 548 O O . GLU A 1 70 ? 4.761 28.208 34.863 1.00 13.66 ? 70 GLU A O 1 >ATOM 121 O O . PHE A 1 15 ? 21.041 18.578 16.265 1.00 8.64 ? 15 PHE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >925 >ATOM 549 C CB . GLU A 1 70 ? 2.606 26.359 33.320 1.00 19.99 ? 70 GLU A CB 1 >ATOM 122 C CB . PHE A 1 15 ? 23.497 17.990 18.379 1.00 10.05 ? 15 PHE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >926 >ATOM 550 C CG . GLU A 1 70 ? 2.814 26.634 31.851 1.00 28.23 ? 70 GLU A CG 1 >ATOM 123 C CG . PHE A 1 15 ? 23.102 19.397 18.746 1.00 10.57 ? 15 PHE A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >927 >ATOM 551 C CD . GLU A 1 70 ? 1.518 26.678 31.097 1.00 32.73 ? 70 GLU A CD 1 >ATOM 124 C CD1 . PHE A 1 15 ? 22.032 19.633 19.605 1.00 13.39 ? 15 PHE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >928 >ATOM 552 O OE1 . GLU A 1 70 ? 0.975 25.589 30.789 1.00 35.76 ? 70 GLU A OE1 1 >ATOM 125 C CD2 . PHE A 1 15 ? 23.813 20.485 18.254 1.00 11.47 ? 15 PHE A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >929 >ATOM 553 O OE2 . GLU A 1 70 ? 1.045 27.802 30.823 1.00 35.75 ? 70 GLU A OE2 1 >ATOM 126 C CE1 . PHE A 1 15 ? 21.678 20.929 19.968 1.00 13.52 ? 15 PHE A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >930 >ATOM 554 N N . PHE A 1 71 ? 5.713 27.340 33.028 1.00 12.80 ? 71 PHE A N 1 >ATOM 127 C CE2 . PHE A 1 15 ? 23.467 21.784 18.609 1.00 11.60 ? 15 PHE A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >931 >ATOM 555 C CA . PHE A 1 71 ? 6.638 28.448 32.837 1.00 12.36 ? 71 PHE A CA 1 >ATOM 128 C CZ . PHE A 1 15 ? 22.399 22.006 19.469 1.00 13.52 ? 15 PHE A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >932 >ATOM 556 C C . PHE A 1 71 ? 6.856 28.678 31.350 1.00 12.97 ? 71 PHE A C 1 >ATOM 129 N N . GLU A 1 16 ? 22.878 17.699 15.342 1.00 11.17 ? 16 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >933 >ATOM 557 O O . PHE A 1 71 ? 6.382 27.917 30.516 1.00 12.54 ? 71 PHE A O 1 >ATOM 130 C CA . GLU A 1 16 ? 22.583 18.313 14.053 1.00 12.58 ? 16 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >934 >ATOM 558 C CB . PHE A 1 71 ? 7.975 28.243 33.589 1.00 10.02 ? 71 PHE A CB 1 >ATOM 131 C C . GLU A 1 16 ? 21.271 17.797 13.468 1.00 11.71 ? 16 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >935 >ATOM 559 C CG . PHE A 1 71 ? 8.851 27.148 33.033 1.00 10.48 ? 71 PHE A CG 1 >ATOM 132 O O . GLU A 1 16 ? 20.503 18.567 12.888 1.00 12.66 ? 16 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >936 >ATOM 560 C CD1 . PHE A 1 71 ? 8.549 25.815 33.256 1.00 9.95 ? 71 PHE A CD1 1 >ATOM 133 C CB . GLU A 1 16 ? 23.711 18.081 13.060 1.00 15.91 ? 16 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >937 >ATOM 561 C CD2 . PHE A 1 71 ? 10.006 27.459 32.331 1.00 9.29 ? 71 PHE A CD2 1 >ATOM 134 C CG . GLU A 1 16 ? 23.274 18.337 11.626 1.00 21.31 ? 16 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >938 >ATOM 562 C CE1 . PHE A 1 71 ? 9.380 24.811 32.793 1.00 9.74 ? 71 PHE A CE1 1 >ATOM 135 C CD . GLU A 1 16 ? 24.376 18.878 10.757 1.00 25.39 ? 16 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >939 >ATOM 563 C CE2 . PHE A 1 71 ? 10.832 26.464 31.868 1.00 9.51 ? 71 PHE A CE2 1 >ATOM 136 O OE1 . GLU A 1 16 ? 25.526 18.984 11.240 1.00 27.92 ? 16 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >940 >ATOM 564 C CZ . PHE A 1 71 ? 10.518 25.136 32.102 1.00 8.47 ? 71 PHE A CZ 1 >ATOM 137 O OE2 . GLU A 1 16 ? 24.084 19.213 9.588 1.00 28.60 ? 16 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >941 >ATOM 565 N N . GLU A 1 72 ? 7.581 29.733 31.028 1.00 15.04 ? 72 GLU A N 1 >ATOM 138 N N . GLU A 1 17 ? 21.018 16.497 13.619 1.00 11.67 ? 17 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >942 >ATOM 566 C CA . GLU A 1 72 ? 7.826 30.063 29.644 1.00 17.19 ? 72 GLU A CA 1 >ATOM 139 C CA . GLU A 1 17 ? 19.785 15.878 13.116 1.00 13.65 ? 17 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >943 >ATOM 567 C C . GLU A 1 72 ? 9.323 30.036 29.357 1.00 15.53 ? 72 GLU A C 1 >ATOM 140 C C . GLU A 1 17 ? 18.529 16.490 13.767 1.00 13.48 ? 17 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >944 >ATOM 568 O O . GLU A 1 72 ? 10.130 30.511 30.158 1.00 16.16 ? 72 GLU A O 1 >ATOM 141 O O . GLU A 1 17 ? 17.490 16.662 13.115 1.00 11.68 ? 17 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >945 >ATOM 569 C CB . GLU A 1 72 ? 7.248 31.448 29.379 1.00 22.03 ? 72 GLU A CB 1 >ATOM 142 C CB . GLU A 1 17 ? 19.811 14.361 13.325 1.00 17.06 ? 17 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >946 >ATOM 570 C CG . GLU A 1 72 ? 6.700 31.658 28.002 1.00 30.80 ? 72 GLU A CG 1 >ATOM 143 C CG . GLU A 1 17 ? 20.806 13.602 12.430 1.00 23.45 ? 17 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >947 >ATOM 571 C CD . GLU A 1 72 ? 6.157 33.060 27.827 1.00 34.75 ? 72 GLU A CD 1 >ATOM 144 C CD . GLU A 1 17 ? 22.279 13.624 12.909 1.00 27.80 ? 17 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >948 >ATOM 572 O OE1 . GLU A 1 72 ? 5.014 33.309 28.276 1.00 35.88 ? 72 GLU A OE1 1 >ATOM 145 O OE1 . GLU A 1 17 ? 22.637 14.338 13.881 1.00 26.52 ? 17 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >949 >ATOM 573 O OE2 . GLU A 1 72 ? 6.885 33.912 27.255 1.00 38.91 ? 72 GLU A OE2 1 >ATOM 146 O OE2 . GLU A 1 17 ? 23.097 12.897 12.291 1.00 31.80 ? 17 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >950 >ATOM 574 N N . GLU A 1 73 ? 9.691 29.378 28.263 1.00 13.46 ? 73 GLU A N 1 >ATOM 147 N N . LEU A 1 18 ? 18.640 16.834 15.048 1.00 10.82 ? 18 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >951 >ATOM 575 C CA . GLU A 1 73 ? 11.088 29.302 27.836 1.00 13.89 ? 73 GLU A CA 1 >ATOM 148 C CA . LEU A 1 18 ? 17.547 17.468 15.777 1.00 9.45 ? 18 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >952 >ATOM 576 C C . GLU A 1 73 ? 11.083 29.318 26.301 1.00 13.70 ? 73 GLU A C 1 >ATOM 149 C C . LEU A 1 18 ? 17.302 18.849 15.155 1.00 9.27 ? 18 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >953 >ATOM 577 O O . GLU A 1 73 ? 10.159 29.859 25.690 1.00 13.63 ? 73 GLU A O 1 >ATOM 150 O O . LEU A 1 18 ? 16.153 19.246 14.927 1.00 9.04 ? 18 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >954 >ATOM 578 C CB . GLU A 1 73 ? 11.780 28.032 28.379 1.00 12.63 ? 73 GLU A CB 1 >ATOM 151 C CB . LEU A 1 18 ? 17.931 17.644 17.253 1.00 9.77 ? 18 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >955 >ATOM 579 C CG . GLU A 1 73 ? 11.145 26.706 27.986 1.00 10.55 ? 73 GLU A CG 1 >ATOM 152 C CG . LEU A 1 18 ? 16.921 18.358 18.163 1.00 11.36 ? 18 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >956 >ATOM 580 C CD . GLU A 1 73 ? 11.997 25.499 28.366 1.00 8.94 ? 73 GLU A CD 1 >ATOM 153 C CD1 . LEU A 1 18 ? 15.817 17.402 18.554 1.00 13.85 ? 18 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >957 >ATOM 581 O OE1 . GLU A 1 73 ? 13.191 25.650 28.642 1.00 12.29 ? 73 GLU A OE1 1 >ATOM 154 C CD2 . LEU A 1 18 ? 17.616 18.876 19.409 1.00 12.69 ? 18 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >958 >ATOM 582 O OE2 . GLU A 1 73 ? 11.485 24.374 28.363 1.00 10.37 ? 73 GLU A OE2 1 >ATOM 155 N N . LEU A 1 19 ? 18.387 19.568 14.864 1.00 10.75 ? 19 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >959 >ATOM 583 N N . GLN A 1 74 ? 12.115 28.751 25.685 1.00 13.09 ? 74 GLN A N 1 >ATOM 156 C CA . LEU A 1 19 ? 18.275 20.906 14.276 1.00 11.15 ? 19 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >960 >ATOM 584 C CA . GLN A 1 74 ? 12.187 28.691 24.239 1.00 13.16 ? 74 GLN A CA 1 >ATOM 157 C C . LEU A 1 19 ? 17.671 20.873 12.874 1.00 12.52 ? 19 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >961 >ATOM 585 C C . GLN A 1 74 ? 12.618 27.315 23.806 1.00 12.86 ? 74 GLN A C 1 >ATOM 158 O O . LEU A 1 19 ? 16.932 21.777 12.485 1.00 10.05 ? 19 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >962 >ATOM 586 O O . GLN A 1 74 ? 13.290 26.596 24.552 1.00 13.17 ? 74 GLN A O 1 >ATOM 159 C CB . LEU A 1 19 ? 19.631 21.616 14.263 1.00 12.01 ? 19 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >963 >ATOM 587 C CB . GLN A 1 74 ? 13.218 29.685 23.706 1.00 15.91 ? 74 GLN A CB 1 >ATOM 160 C CG . LEU A 1 19 ? 20.282 21.963 15.614 1.00 10.42 ? 19 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >964 >ATOM 588 C CG . GLN A 1 74 ? 12.803 31.133 23.779 1.00 19.68 ? 74 GLN A CG 1 >ATOM 161 C CD1 . LEU A 1 19 ? 21.560 22.763 15.369 1.00 13.01 ? 19 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >965 >ATOM 589 C CD . GLN A 1 74 ? 13.827 32.066 23.159 1.00 21.00 ? 74 GLN A CD 1 >ATOM 162 C CD2 . LEU A 1 19 ? 19.312 22.742 16.513 1.00 11.45 ? 19 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >966 >ATOM 590 O OE1 . GLN A 1 74 ? 15.010 31.730 23.024 1.00 22.37 ? 74 GLN A OE1 1 >ATOM 163 N N . LYS A 1 20 ? 17.944 19.795 12.150 1.00 14.41 ? 20 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >967 >ATOM 591 N NE2 . GLN A 1 74 ? 13.373 33.247 22.774 1.00 24.07 ? 74 GLN A NE2 1 >ATOM 164 C CA . LYS A 1 20 ? 17.427 19.628 10.800 1.00 16.54 ? 20 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >968 >ATOM 592 N N . THR A 1 75 ? 12.229 26.935 22.600 1.00 10.98 ? 75 THR A N 1 >ATOM 165 C C . LYS A 1 20 ? 15.902 19.512 10.832 1.00 16.17 ? 20 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >969 >ATOM 593 C CA . THR A 1 75 ? 12.664 25.656 22.056 1.00 11.83 ? 75 THR A CA 1 >ATOM 166 O O . LYS A 1 20 ? 15.201 20.164 10.053 1.00 15.90 ? 20 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >970 >ATOM 594 C C . THR A 1 75 ? 14.162 25.828 21.729 1.00 11.24 ? 75 THR A C 1 >ATOM 167 C CB . LYS A 1 20 ? 18.048 18.390 10.157 1.00 20.07 ? 20 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >971 >ATOM 595 O O . THR A 1 75 ? 14.681 26.951 21.764 1.00 9.95 ? 75 THR A O 1 >ATOM 168 C CG . LYS A 1 20 ? 18.592 18.643 8.765 1.00 26.61 ? 20 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >972 >ATOM 596 C CB . THR A 1 75 ? 11.895 25.325 20.757 1.00 11.93 ? 75 THR A CB 1 >ATOM 169 C CD . LYS A 1 20 ? 18.960 17.349 8.027 1.00 30.95 ? 20 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >973 >ATOM 597 O OG1 . THR A 1 75 ? 12.123 26.366 19.795 1.00 13.31 ? 75 THR A OG1 1 >ATOM 170 C CE . LYS A 1 20 ? 20.226 16.690 8.579 1.00 35.68 ? 20 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >974 >ATOM 598 C CG2 . THR A 1 75 ? 10.396 25.202 21.042 1.00 13.29 ? 75 THR A CG2 1 >ATOM 171 N NZ . LYS A 1 20 ? 21.485 17.466 8.342 1.00 39.27 ? 20 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >975 >ATOM 599 N N . VAL A 1 76 ? 14.841 24.731 21.377 1.00 13.77 ? 76 VAL A N 1 >ATOM 172 N N . VAL A 1 21 ? 15.395 18.700 11.759 1.00 15.31 ? 21 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >976 >ATOM 600 C CA . VAL A 1 76 ? 16.278 24.762 21.049 1.00 14.39 ? 76 VAL A CA 1 >ATOM 173 C CA . VAL A 1 21 ? 13.958 18.508 11.927 1.00 14.41 ? 21 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >977 >ATOM 601 C C . VAL A 1 76 ? 16.612 25.734 19.914 1.00 12.97 ? 76 VAL A C 1 >ATOM 174 C C . VAL A 1 21 ? 13.275 19.831 12.316 1.00 15.02 ? 21 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >978 >ATOM 602 O O . VAL A 1 76 ? 17.639 26.407 19.956 1.00 13.75 ? 76 VAL A O 1 >ATOM 175 O O . VAL A 1 21 ? 12.150 20.119 11.878 1.00 13.59 ? 21 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >979 >ATOM 603 C CB . VAL A 1 76 ? 16.827 23.351 20.680 1.00 15.44 ? 76 VAL A CB 1 >ATOM 176 C CB . VAL A 1 21 ? 13.674 17.422 12.998 1.00 14.93 ? 21 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >980 >ATOM 604 C CG1 . VAL A 1 76 ? 18.332 23.314 20.844 1.00 17.74 ? 76 VAL A CG1 1 >ATOM 177 C CG1 . VAL A 1 21 ? 12.194 17.383 13.364 1.00 17.29 ? 21 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >981 >ATOM 605 C CG2 . VAL A 1 76 ? 16.218 22.293 21.548 1.00 19.99 ? 76 VAL A CG2 1 >ATOM 178 C CG2 . VAL A 1 21 ? 14.115 16.082 12.482 1.00 15.09 ? 21 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >982 >ATOM 606 N N . ASP A 1 77 ? 15.730 25.824 18.921 1.00 13.67 ? 77 ASP A N 1 >ATOM 179 N N . LEU A 1 22 ? 13.966 20.643 13.119 1.00 14.52 ? 22 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >983 >ATOM 607 C CA . ASP A 1 77 ? 15.933 26.727 17.789 1.00 14.47 ? 77 ASP A CA 1 >ATOM 180 C CA . LEU A 1 22 ? 13.432 21.938 13.569 1.00 14.42 ? 22 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >984 >ATOM 608 C C . ASP A 1 77 ? 15.486 28.172 18.061 1.00 15.23 ? 77 ASP A C 1 >ATOM 181 C C . LEU A 1 22 ? 13.478 22.984 12.467 1.00 15.49 ? 22 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >985 >ATOM 609 O O . ASP A 1 77 ? 15.461 29.002 17.153 1.00 14.90 ? 77 ASP A O 1 >ATOM 182 O O . LEU A 1 22 ? 13.038 24.115 12.666 1.00 16.81 ? 22 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >986 >ATOM 610 C CB . ASP A 1 77 ? 15.301 26.158 16.503 1.00 15.63 ? 77 ASP A CB 1 >ATOM 183 C CB . LEU A 1 22 ? 14.180 22.440 14.818 1.00 13.61 ? 22 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >987 >ATOM 611 C CG . ASP A 1 77 ? 13.790 26.007 16.585 1.00 15.92 ? 77 ASP A CG 1 >ATOM 184 C CG . LEU A 1 22 ? 13.986 21.565 16.069 1.00 13.97 ? 22 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >988 >ATOM 612 O OD1 . ASP A 1 77 ? 13.260 25.470 17.586 1.00 14.64 ? 77 ASP A OD1 1 >ATOM 185 C CD1 . LEU A 1 22 ? 14.852 22.047 17.225 1.00 13.25 ? 22 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >989 >ATOM 613 O OD2 . ASP A 1 77 ? 13.123 26.409 15.613 1.00 17.79 ? 77 ASP A OD2 1 >ATOM 186 C CD2 . LEU A 1 22 ? 12.525 21.580 16.467 1.00 14.62 ? 22 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >990 >ATOM 614 N N . GLY A 1 78 ? 15.095 28.445 19.312 1.00 15.17 ? 78 GLY A N 1 >ATOM 187 N N . GLY A 1 23 ? 14.062 22.618 11.328 1.00 16.41 ? 23 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >991 >ATOM 615 C CA . GLY A 1 78 ? 14.709 29.790 19.726 1.00 15.90 ? 78 GLY A CA 1 >ATOM 188 C CA . GLY A 1 23 ? 14.123 23.516 10.183 1.00 17.05 ? 23 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >992 >ATOM 616 C C . GLY A 1 78 ? 13.268 30.281 19.701 1.00 16.89 ? 78 GLY A C 1 >ATOM 189 C C . GLY A 1 23 ? 15.241 24.539 10.125 1.00 18.00 ? 23 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >993 >ATOM 617 O O . GLY A 1 78 ? 13.038 31.489 19.790 1.00 19.37 ? 78 GLY A O 1 >ATOM 190 O O . GLY A 1 23 ? 15.112 25.545 9.425 1.00 19.45 ? 23 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >994 >ATOM 618 N N . ARG A 1 79 ? 12.292 29.389 19.620 1.00 16.76 ? 79 ARG A N 1 >ATOM 191 N N . VAL A 1 24 ? 16.320 24.315 10.869 1.00 14.78 ? 24 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >995 >ATOM 619 C CA . ARG A 1 79 ? 10.896 29.822 19.587 1.00 18.08 ? 79 ARG A CA 1 >ATOM 192 C CA . VAL A 1 24 ? 17.440 25.241 10.860 1.00 13.71 ? 24 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >996 >ATOM 620 C C . ARG A 1 79 ? 10.229 29.768 20.961 1.00 16.55 ? 79 ARG A C 1 >ATOM 193 C C . VAL A 1 24 ? 18.289 24.983 9.607 1.00 15.09 ? 24 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >997 >ATOM 621 O O . ARG A 1 79 ? 10.379 28.787 21.680 1.00 16.57 ? 79 ARG A O 1 >ATOM 194 O O . VAL A 1 24 ? 18.679 23.840 9.334 1.00 14.12 ? 24 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >998 >ATOM 622 C CB . ARG A 1 79 ? 10.112 28.961 18.604 1.00 20.74 ? 79 ARG A CB 1 >ATOM 195 C CB . VAL A 1 24 ? 18.297 25.081 12.139 1.00 12.19 ? 24 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >999 >ATOM 623 C CG . ARG A 1 79 ? 10.667 28.997 17.194 1.00 25.89 ? 79 ARG A CG 1 >ATOM 196 C CG1 . VAL A 1 24 ? 19.465 26.054 12.109 1.00 8.69 ? 24 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1000 >ATOM 624 C CD . ARG A 1 79 ? 9.986 27.976 16.310 1.00 29.77 ? 79 ARG A CD 1 >ATOM 197 C CG2 . VAL A 1 24 ? 17.416 25.294 13.388 1.00 11.37 ? 24 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1001 >ATOM 625 N NE . ARG A 1 79 ? 10.144 26.626 16.842 1.00 34.52 ? 79 ARG A NE 1 >ATOM 198 N N . ASN A 1 25 ? 18.595 26.047 8.866 1.00 15.37 ? 25 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1002 >ATOM 626 C CZ . ARG A 1 79 ? 10.128 25.516 16.109 1.00 35.90 ? 79 ARG A CZ 1 >ATOM 199 C CA . ASN A 1 25 ? 19.360 25.914 7.635 1.00 17.74 ? 25 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1003 >ATOM 627 N NH1 . ARG A 1 79 ? 9.971 25.580 14.789 1.00 37.70 ? 79 ARG A NH1 1 >ATOM 200 C C . ASN A 1 25 ? 20.808 25.466 7.819 1.00 18.29 ? 25 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1004 >ATOM 628 N NH2 . ARG A 1 79 ? 10.266 24.337 16.702 1.00 35.58 ? 79 ARG A NH2 1 >ATOM 201 O O . ASN A 1 25 ? 21.377 25.592 8.903 1.00 18.05 ? 25 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1005 >ATOM 629 N N . PRO A 1 80 ? 9.501 30.830 21.352 1.00 15.98 ? 80 PRO A N 1 >ATOM 202 C CB . ASN A 1 25 ? 19.230 27.172 6.742 1.00 19.41 ? 25 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1006 >ATOM 630 C CA . PRO A 1 80 ? 8.819 30.867 22.651 1.00 15.47 ? 80 PRO A CA 1 >ATOM 203 C CG . ASN A 1 25 ? 20.090 28.351 7.200 1.00 22.35 ? 25 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1007 >ATOM 631 C C . PRO A 1 80 ? 7.825 29.725 22.833 1.00 14.23 ? 80 PRO A C 1 >ATOM 204 O OD1 . ASN A 1 25 ? 21.207 28.189 7.698 1.00 22.64 ? 25 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1008 >ATOM 632 O O . PRO A 1 80 ? 7.058 29.393 21.926 1.00 14.56 ? 80 PRO A O 1 >ATOM 205 N ND2 . ASN A 1 25 ? 19.602 29.558 6.933 1.00 24.15 ? 25 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1009 >ATOM 633 C CB . PRO A 1 80 ? 8.100 32.220 22.628 1.00 15.48 ? 80 PRO A CB 1 >ATOM 206 N N . VAL A 1 26 ? 21.398 24.971 6.733 1.00 18.67 ? 26 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1010 >ATOM 634 C CG . PRO A 1 80 ? 9.010 33.057 21.846 1.00 18.18 ? 80 PRO A CG 1 >ATOM 207 C CA . VAL A 1 26 ? 22.755 24.444 6.742 1.00 19.24 ? 26 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1011 >ATOM 635 C CD . PRO A 1 80 ? 9.418 32.145 20.696 1.00 17.08 ? 80 PRO A CD 1 >ATOM 208 C C . VAL A 1 26 ? 23.825 25.280 7.421 1.00 18.39 ? 26 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1012 >ATOM 636 N N . CYS A 1 81 ? 7.817 29.148 24.028 1.00 13.52 ? 81 CYS A N 1 >ATOM 209 O O . VAL A 1 26 ? 24.558 24.764 8.261 1.00 18.50 ? 26 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1013 >ATOM 637 C CA . CYS A 1 81 ? 6.914 28.055 24.331 1.00 12.41 ? 81 CYS A CA 1 >ATOM 210 C CB . VAL A 1 26 ? 23.223 24.088 5.320 1.00 20.77 ? 26 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1014 >ATOM 638 C C . CYS A 1 81 ? 6.548 28.054 25.811 1.00 12.52 ? 81 CYS A C 1 >ATOM 211 C CG1 . VAL A 1 26 ? 24.624 23.523 5.378 1.00 22.39 ? 26 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1015 >ATOM 639 O O . CYS A 1 81 ? 7.202 28.718 26.624 1.00 11.74 ? 81 CYS A O 1 >ATOM 212 C CG2 . VAL A 1 26 ? 22.276 23.084 4.698 1.00 21.28 ? 26 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1016 >ATOM 640 C CB . CYS A 1 81 ? 7.563 26.705 23.950 1.00 11.59 ? 81 CYS A CB 1 >ATOM 213 N N . MET A 1 27 ? 23.932 26.556 7.052 1.00 19.00 ? 27 MET A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1017 >ATOM 641 S SG . CYS A 1 81 ? 9.063 26.255 24.894 1.00 12.86 ? 81 CYS A SG 1 >ATOM 214 C CA . MET A 1 27 ? 24.948 27.433 7.628 1.00 19.54 ? 27 MET A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1018 >ATOM 642 N N . LYS A 1 82 ? 5.448 27.379 26.121 1.00 13.86 ? 82 LYS A N 1 >ATOM 215 C C . MET A 1 27 ? 24.734 27.741 9.099 1.00 19.04 ? 27 MET A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1019 >ATOM 643 C CA . LYS A 1 82 ? 4.988 27.197 27.492 1.00 14.38 ? 82 LYS A CA 1 >ATOM 216 O O . MET A 1 27 ? 25.702 27.820 9.849 1.00 18.28 ? 27 MET A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1020 >ATOM 644 C C . LYS A 1 82 ? 5.436 25.779 27.839 1.00 13.51 ? 82 LYS A C 1 >ATOM 217 C CB . MET A 1 27 ? 25.104 28.736 6.830 1.00 23.31 ? 27 MET A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1021 >ATOM 645 O O . LYS A 1 82 ? 5.227 24.842 27.063 1.00 12.69 ? 82 LYS A O 1 >ATOM 218 C CG . MET A 1 27 ? 25.955 28.602 5.552 1.00 29.99 ? 27 MET A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1022 >ATOM 646 C CB . LYS A 1 82 ? 3.473 27.299 27.589 1.00 18.36 ? 82 LYS A CB 1 >ATOM 219 S SD . MET A 1 27 ? 24.975 28.527 4.010 1.00 37.48 ? 27 MET A SD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1023 >ATOM 647 C CG . LYS A 1 82 ? 2.940 28.716 27.584 1.00 26.02 ? 82 LYS A CG 1 >ATOM 220 C CE . MET A 1 27 ? 26.198 29.150 2.776 1.00 35.24 ? 27 MET A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1024 >ATOM 648 C CD . LYS A 1 82 ? 3.353 29.506 28.826 1.00 31.13 ? 82 LYS A CD 1 >ATOM 221 N N . LEU A 1 28 ? 23.480 27.932 9.507 1.00 16.74 ? 28 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1025 >ATOM 649 C CE . LYS A 1 82 ? 2.686 30.894 28.832 1.00 35.39 ? 82 LYS A CE 1 >ATOM 222 C CA . LEU A 1 28 ? 23.190 28.209 10.912 1.00 16.39 ? 28 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1026 >ATOM 650 N NZ . LYS A 1 82 ? 2.868 31.652 30.120 1.00 37.63 ? 82 LYS A NZ 1 >ATOM 223 C C . LEU A 1 28 ? 23.477 26.954 11.722 1.00 16.86 ? 28 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1027 >ATOM 651 N N . SER A 1 83 ? 6.110 25.638 28.974 1.00 11.15 ? 83 SER A N 1 >ATOM 224 O O . LEU A 1 28 ? 23.954 27.038 12.852 1.00 15.09 ? 28 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1028 >ATOM 652 C CA . SER A 1 83 ? 6.624 24.352 29.397 1.00 10.10 ? 83 SER A CA 1 >ATOM 225 C CB . LEU A 1 28 ? 21.739 28.679 11.111 1.00 15.94 ? 28 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1029 >ATOM 653 C C . SER A 1 83 ? 6.083 23.931 30.752 1.00 11.16 ? 83 SER A C 1 >ATOM 226 C CG . LEU A 1 28 ? 21.490 30.154 10.741 1.00 16.72 ? 28 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1030 >ATOM 654 O O . SER A 1 83 ? 5.721 24.769 31.575 1.00 10.21 ? 83 SER A O 1 >ATOM 227 C CD1 . LEU A 1 28 ? 20.008 30.496 10.780 1.00 14.38 ? 28 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1031 >ATOM 655 C CB . SER A 1 83 ? 8.149 24.418 29.446 1.00 10.30 ? 83 SER A CB 1 >ATOM 228 C CD2 . LEU A 1 28 ? 22.302 31.074 11.665 1.00 12.81 ? 28 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1032 >ATOM 656 O OG . SER A 1 83 ? 8.686 24.518 28.132 1.00 11.50 ? 83 SER A OG 1 >ATOM 229 N N . ARG A 1 29 ? 23.228 25.791 11.121 1.00 16.05 ? 29 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1033 >ATOM 657 N N . LEU A 1 84 ? 6.028 22.620 30.954 1.00 11.17 ? 84 LEU A N 1 >ATOM 230 C CA . ARG A 1 29 ? 23.498 24.524 11.798 1.00 18.43 ? 29 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1034 >ATOM 658 C CA . LEU A 1 84 ? 5.557 22.016 32.192 1.00 11.84 ? 84 LEU A CA 1 >ATOM 231 C C . ARG A 1 29 ? 24.980 24.377 12.076 1.00 19.22 ? 29 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1035 >ATOM 659 C C . LEU A 1 84 ? 6.427 20.793 32.470 1.00 10.42 ? 84 LEU A C 1 >ATOM 232 O O . ARG A 1 29 ? 25.383 23.987 13.171 1.00 17.97 ? 29 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1036 >ATOM 660 O O . LEU A 1 84 ? 6.444 19.846 31.684 1.00 11.20 ? 84 LEU A O 1 >ATOM 233 C CB . ARG A 1 29 ? 23.030 23.334 10.969 1.00 18.63 ? 29 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1037 >ATOM 661 C CB . LEU A 1 84 ? 4.091 21.576 32.067 1.00 13.44 ? 84 LEU A CB 1 >ATOM 234 C CG . ARG A 1 29 ? 21.596 22.983 11.189 1.00 21.26 ? 29 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1038 >ATOM 662 C CG . LEU A 1 84 ? 3.552 20.784 33.270 1.00 15.74 ? 84 LEU A CG 1 >ATOM 235 C CD . ARG A 1 29 ? 21.339 21.572 10.739 1.00 24.71 ? 29 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1039 >ATOM 663 C CD1 . LEU A 1 84 ? 3.515 21.683 34.484 1.00 16.96 ? 84 LEU A CD1 1 >ATOM 236 N NE . ARG A 1 29 ? 20.571 21.564 9.513 1.00 29.88 ? 29 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1040 >ATOM 664 C CD2 . LEU A 1 84 ? 2.178 20.231 32.982 1.00 18.76 ? 84 LEU A CD2 1 >ATOM 237 C CZ . ARG A 1 29 ? 21.019 21.147 8.340 1.00 29.19 ? 29 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1041 >ATOM 665 N N . VAL A 1 85 ? 7.146 20.828 33.589 1.00 9.60 ? 85 VAL A N 1 >ATOM 238 N NH1 . ARG A 1 29 ? 22.248 20.682 8.205 1.00 30.52 ? 29 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1042 >ATOM 666 C CA . VAL A 1 85 ? 8.028 19.738 34.006 1.00 9.50 ? 85 VAL A CA 1 >ATOM 239 N NH2 . ARG A 1 29 ? 20.232 21.233 7.295 1.00 31.61 ? 29 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1043 >ATOM 667 C C . VAL A 1 85 ? 7.344 18.878 35.082 1.00 9.74 ? 85 VAL A C 1 >ATOM 240 N N . LYS A 1 30 ? 25.790 24.709 11.078 1.00 19.76 ? 30 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1044 >ATOM 668 O O . VAL A 1 85 ? 6.680 19.404 35.985 1.00 9.28 ? 85 VAL A O 1 >ATOM 241 C CA . LYS A 1 30 ? 27.235 24.619 11.198 1.00 21.96 ? 30 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1045 >ATOM 669 C CB . VAL A 1 85 ? 9.384 20.291 34.598 1.00 8.89 ? 85 VAL A CB 1 >ATOM 242 C C . LYS A 1 30 ? 27.706 25.418 12.417 1.00 20.91 ? 30 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1046 >ATOM 670 C CG1 . VAL A 1 85 ? 10.327 19.140 34.970 1.00 8.20 ? 85 VAL A CG1 1 >ATOM 243 O O . LYS A 1 30 ? 28.470 24.916 13.239 1.00 22.15 ? 30 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1047 >ATOM 671 C CG2 . VAL A 1 85 ? 10.062 21.227 33.612 1.00 8.48 ? 85 VAL A CG2 1 >ATOM 244 C CB . LYS A 1 30 ? 27.894 25.143 9.915 1.00 25.07 ? 30 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1048 >ATOM 672 N N . LYS A 1 86 ? 7.504 17.563 34.971 1.00 9.96 ? 86 LYS A N 1 >ATOM 245 C CG . LYS A 1 30 ? 29.404 25.031 9.905 1.00 30.48 ? 30 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1049 >ATOM 673 C CA . LYS A 1 86 ? 6.946 16.621 35.945 1.00 11.92 ? 86 LYS A CA 1 >ATOM 246 C CD . LYS A 1 30 ? 30.013 25.631 8.639 1.00 35.43 ? 30 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1050 >ATOM 674 C C . LYS A 1 86 ? 8.003 15.558 36.247 1.00 11.88 ? 86 LYS A C 1 >ATOM 247 C CE . LYS A 1 30 ? 31.533 25.759 8.778 1.00 37.96 ? 30 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1051 >ATOM 675 O O . LYS A 1 86 ? 8.917 15.340 35.453 1.00 11.00 ? 86 LYS A O 1 >ATOM 248 N NZ . LYS A 1 30 ? 32.180 26.388 7.584 1.00 41.61 ? 30 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1052 >ATOM 676 C CB . LYS A 1 86 ? 5.700 15.911 35.385 1.00 12.40 ? 86 LYS A CB 1 >ATOM 249 N N . ILE A 1 31 ? 27.208 26.643 12.544 1.00 18.38 ? 31 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1053 >ATOM 677 C CG . LYS A 1 86 ? 4.538 16.819 35.058 1.00 16.01 ? 86 LYS A CG 1 >ATOM 250 C CA . ILE A 1 31 ? 27.557 27.527 13.652 1.00 16.41 ? 31 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1054 >ATOM 678 C CD . LYS A 1 86 ? 3.333 16.017 34.559 1.00 21.36 ? 86 LYS A CD 1 >ATOM 251 C C . ILE A 1 31 ? 27.105 26.932 14.989 1.00 15.39 ? 31 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1055 >ATOM 679 C CE . LYS A 1 86 ? 2.140 16.939 34.345 1.00 23.23 ? 86 LYS A CE 1 >ATOM 252 O O . ILE A 1 31 ? 27.888 26.855 15.930 1.00 14.90 ? 31 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1056 >ATOM 680 N NZ . LYS A 1 86 ? 0.919 16.212 33.929 1.00 28.41 ? 86 LYS A NZ 1 >ATOM 253 C CB . ILE A 1 31 ? 26.881 28.920 13.471 1.00 16.63 ? 31 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1057 >ATOM 681 N N . TRP A 1 87 ? 7.868 14.889 37.386 1.00 10.75 ? 87 TRP A N 1 >ATOM 254 C CG1 . ILE A 1 31 ? 27.419 29.606 12.208 1.00 18.74 ? 31 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1058 >ATOM 682 C CA . TRP A 1 87 ? 8.775 13.811 37.738 1.00 9.53 ? 87 TRP A CA 1 >ATOM 255 C CG2 . ILE A 1 31 ? 27.071 29.791 14.713 1.00 15.71 ? 31 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1059 >ATOM 683 C C . TRP A 1 87 ? 8.238 12.559 37.052 1.00 9.89 ? 87 TRP A C 1 >ATOM 256 C CD1 . ILE A 1 31 ? 26.735 30.946 11.858 1.00 17.27 ? 31 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1060 >ATOM 684 O O . TRP A 1 87 ? 7.144 12.107 37.370 1.00 11.80 ? 87 TRP A O 1 >ATOM 257 N N . ALA A 1 32 ? 25.853 26.487 15.048 1.00 13.39 ? 32 ALA A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1061 >ATOM 685 C CB . TRP A 1 87 ? 8.791 13.569 39.268 1.00 8.76 ? 87 TRP A CB 1 >ATOM 258 C CA . ALA A 1 32 ? 25.271 25.930 16.267 1.00 12.76 ? 32 ALA A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1062 >ATOM 686 C CG . TRP A 1 87 ? 9.494 14.641 40.062 1.00 8.86 ? 87 TRP A CG 1 >ATOM 259 C C . ALA A 1 32 ? 25.994 24.685 16.775 1.00 12.11 ? 32 ALA A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1063 >ATOM 687 C CD1 . TRP A 1 87 ? 8.923 15.525 40.939 1.00 8.80 ? 87 TRP A CD1 1 >ATOM 260 O O . ALA A 1 32 ? 26.325 24.598 17.946 1.00 10.54 ? 32 ALA A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1064 >ATOM 688 C CD2 . TRP A 1 87 ? 10.889 14.990 39.992 1.00 9.42 ? 87 TRP A CD2 1 >ATOM 261 C CB . ALA A 1 32 ? 23.790 25.638 16.040 1.00 12.45 ? 32 ALA A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1065 >ATOM 689 N NE1 . TRP A 1 87 ? 9.872 16.410 41.400 1.00 8.01 ? 87 TRP A NE1 1 >ATOM 262 N N . VAL A 1 33 ? 26.252 23.731 15.886 1.00 11.95 ? 33 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1066 >ATOM 690 C CE2 . TRP A 1 87 ? 11.086 16.103 40.835 1.00 10.85 ? 87 TRP A CE2 1 >ATOM 263 C CA . VAL A 1 33 ? 26.932 22.490 16.256 1.00 13.80 ? 33 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1067 >ATOM 691 C CE3 . TRP A 1 87 ? 11.985 14.475 39.283 1.00 9.60 ? 87 TRP A CE3 1 >ATOM 264 C C . VAL A 1 33 ? 28.328 22.701 16.855 1.00 14.00 ? 33 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1068 >ATOM 692 C CZ2 . TRP A 1 87 ? 12.340 16.716 40.994 1.00 11.45 ? 87 TRP A CZ2 1 >ATOM 265 O O . VAL A 1 33 ? 28.693 22.048 17.832 1.00 14.07 ? 33 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1069 >ATOM 693 C CZ3 . TRP A 1 87 ? 13.230 15.084 39.438 1.00 10.72 ? 87 TRP A CZ3 1 >ATOM 266 C CB . VAL A 1 33 ? 27.016 21.504 15.044 1.00 13.56 ? 33 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1070 >ATOM 694 C CH2 . TRP A 1 87 ? 13.395 16.192 40.289 1.00 11.78 ? 87 TRP A CH2 1 >ATOM 267 C CG1 . VAL A 1 33 ? 27.909 20.318 15.375 1.00 16.07 ? 33 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1071 >ATOM 695 N N . GLU A 1 88 ? 8.954 12.040 36.064 1.00 9.93 ? 88 GLU A N 1 >ATOM 268 C CG2 . VAL A 1 33 ? 25.621 21.006 14.684 1.00 14.96 ? 33 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1072 >ATOM 696 C CA . GLU A 1 88 ? 8.526 10.807 35.416 1.00 11.30 ? 88 GLU A CA 1 >ATOM 269 N N . ALA A 1 34 ? 29.101 23.620 16.281 1.00 14.73 ? 34 ALA A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1073 >ATOM 697 C C . GLU A 1 88 ? 8.826 9.726 36.448 1.00 11.75 ? 88 GLU A C 1 >ATOM 270 C CA . ALA A 1 34 ? 30.443 23.898 16.780 1.00 14.95 ? 34 ALA A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1074 >ATOM 698 O O . GLU A 1 88 ? 8.068 8.784 36.623 1.00 12.78 ? 88 GLU A O 1 >ATOM 271 C C . ALA A 1 34 ? 30.381 24.505 18.178 1.00 15.59 ? 34 ALA A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1075 >ATOM 699 C CB . GLU A 1 88 ? 9.337 10.541 34.156 1.00 13.50 ? 88 GLU A CB 1 >ATOM 272 O O . ALA A 1 34 ? 31.120 24.085 19.065 1.00 16.65 ? 34 ALA A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1076 >ATOM 700 C CG . GLU A 1 88 ? 8.917 9.261 33.454 1.00 18.67 ? 88 GLU A CG 1 >ATOM 273 C CB . ALA A 1 34 ? 31.191 24.844 15.833 1.00 16.10 ? 34 ALA A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1077 >ATOM 701 C CD . GLU A 1 88 ? 9.756 8.958 32.226 1.00 23.49 ? 88 GLU A CD 1 >ATOM 274 N N . ALA A 1 35 ? 29.495 25.480 18.375 1.00 13.20 ? 35 ALA A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1078 >ATOM 702 O OE1 . GLU A 1 88 ? 9.581 9.650 31.205 1.00 26.53 ? 88 GLU A OE1 1 >ATOM 275 C CA . ALA A 1 35 ? 29.371 26.134 19.671 1.00 13.04 ? 35 ALA A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1079 >ATOM 703 O OE2 . GLU A 1 88 ? 10.587 8.025 32.276 1.00 26.54 ? 88 GLU A OE2 1 >ATOM 276 C C . ALA A 1 35 ? 28.807 25.200 20.749 1.00 12.91 ? 35 ALA A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1080 >ATOM 704 N N . SER A 1 89 ? 9.972 9.870 37.103 1.00 11.49 ? 89 SER A N 1 >ATOM 277 O O . ALA A 1 35 ? 29.245 25.239 21.895 1.00 12.32 ? 35 ALA A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1081 >ATOM 705 C CA . SER A 1 89 ? 10.402 8.954 38.158 1.00 11.10 ? 89 SER A CA 1 >ATOM 278 C CB . ALA A 1 35 ? 28.517 27.387 19.552 1.00 12.14 ? 35 ALA A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1082 >ATOM 706 C C . SER A 1 89 ? 11.206 9.776 39.163 1.00 11.14 ? 89 SER A C 1 >ATOM 279 N N . ALA A 1 36 ? 27.878 24.332 20.362 1.00 11.40 ? 36 ALA A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1083 >ATOM 707 O O . SER A 1 89 ? 11.397 10.983 38.979 1.00 9.92 ? 89 SER A O 1 >ATOM 280 C CA . ALA A 1 36 ? 27.253 23.416 21.312 1.00 12.63 ? 36 ALA A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1084 >ATOM 708 C CB . SER A 1 89 ? 11.221 7.778 37.604 1.00 12.43 ? 89 SER A CB 1 >ATOM 281 C C . ALA A 1 36 ? 28.128 22.256 21.770 1.00 13.40 ? 36 ALA A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1085 >ATOM 709 O OG . SER A 1 89 ? 12.396 8.215 36.947 1.00 14.39 ? 89 SER A OG 1 >ATOM 282 O O . ALA A 1 36 ? 27.743 21.512 22.668 1.00 13.47 ? 36 ALA A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1086 >ATOM 710 N N . GLU A 1 90 ? 11.674 9.130 40.227 1.00 10.17 ? 90 GLU A N 1 >ATOM 283 C CB . ALA A 1 36 ? 25.952 22.883 20.744 1.00 11.79 ? 36 ALA A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1087 >ATOM 711 C CA . GLU A 1 90 ? 12.433 9.826 41.254 1.00 10.83 ? 90 GLU A CA 1 >ATOM 284 N N . SER A 1 37 ? 29.286 22.080 21.148 1.00 13.86 ? 37 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1088 >ATOM 712 C C . GLU A 1 90 ? 13.657 10.629 40.772 1.00 9.86 ? 90 GLU A C 1 >ATOM 285 C CA . SER A 1 37 ? 30.169 20.983 21.520 1.00 15.95 ? 37 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1089 >ATOM 713 O O . GLU A 1 90 ? 13.932 11.715 41.289 1.00 10.30 ? 90 GLU A O 1 >ATOM 286 C C . SER A 1 37 ? 30.938 21.245 22.818 1.00 16.46 ? 37 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1090 >ATOM 714 C CB . GLU A 1 90 ? 12.858 8.846 42.348 1.00 11.92 ? 90 GLU A CB 1 >ATOM 287 O O . SER A 1 37 ? 31.488 20.320 23.406 1.00 18.23 ? 37 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1091 >ATOM 715 C CG . GLU A 1 90 ? 13.536 9.572 43.487 1.00 16.53 ? 90 GLU A CG 1 >ATOM 288 C CB . SER A 1 37 ? 31.145 20.689 20.388 1.00 16.93 ? 37 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1092 >ATOM 716 C CD . GLU A 1 90 ? 13.912 8.671 44.644 1.00 19.80 ? 90 GLU A CD 1 >ATOM 289 O OG . SER A 1 37 ? 32.100 21.729 20.293 1.00 21.65 ? 37 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1093 >ATOM 717 O OE1 . GLU A 1 90 ? 14.122 7.464 44.426 1.00 21.18 ? 90 GLU A OE1 1 >ATOM 290 N N . LYS A 1 38 ? 30.957 22.496 23.272 1.00 16.91 ? 38 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1094 >ATOM 718 O OE2 . GLU A 1 90 ? 14.012 9.187 45.774 1.00 22.91 ? 90 GLU A OE2 1 >ATOM 291 C CA . LYS A 1 38 ? 31.657 22.869 24.502 1.00 18.36 ? 38 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1095 >ATOM 719 N N . ASN A 1 91 ? 14.376 10.102 39.783 1.00 8.79 ? 91 ASN A N 1 >ATOM 292 C C . LYS A 1 38 ? 30.817 23.809 25.382 1.00 15.90 ? 38 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1096 >ATOM 720 C CA . ASN A 1 91 ? 15.578 10.767 39.274 1.00 10.50 ? 91 ASN A CA 1 >ATOM 293 O O . LYS A 1 38 ? 31.175 24.975 25.591 1.00 16.72 ? 38 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1097 >ATOM 721 C C . ASN A 1 91 ? 15.455 11.289 37.855 1.00 9.69 ? 91 ASN A C 1 >ATOM 294 C CB . LYS A 1 38 ? 33.004 23.539 24.156 1.00 23.99 ? 38 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1098 >ATOM 722 O O . ASN A 1 91 ? 16.467 11.627 37.246 1.00 7.10 ? 91 ASN A O 1 >ATOM 295 C CG . LYS A 1 38 ? 32.907 24.607 23.046 1.00 30.97 ? 38 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1099 >ATOM 723 C CB . ASN A 1 91 ? 16.760 9.798 39.305 1.00 14.33 ? 91 ASN A CB 1 >ATOM 296 C CD . LYS A 1 38 ? 34.250 25.320 22.792 1.00 36.44 ? 38 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1100 >ATOM 724 C CG . ASN A 1 91 ? 17.064 9.307 40.693 1.00 17.71 ? 91 ASN A CG 1 >ATOM 297 C CE . LYS A 1 38 ? 34.266 26.098 21.456 1.00 38.70 ? 38 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1101 >ATOM 725 O OD1 . ASN A 1 91 ? 17.445 10.087 41.560 1.00 20.87 ? 91 ASN A OD1 1 >ATOM 298 N NZ . LYS A 1 38 ? 33.193 27.131 21.321 1.00 39.37 ? 38 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1102 >ATOM 726 N ND2 . ASN A 1 91 ? 16.855 8.016 40.928 1.00 19.39 ? 91 ASN A ND2 1 >ATOM 299 N N . PRO A 1 39 ? 29.669 23.321 25.906 1.00 13.53 ? 39 PRO A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1103 >ATOM 727 N N . LYS A 1 92 ? 14.230 11.387 37.352 1.00 8.60 ? 92 LYS A N 1 >ATOM 300 C CA . PRO A 1 39 ? 28.851 24.201 26.747 1.00 11.87 ? 39 PRO A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1104 >ATOM 728 C CA . LYS A 1 92 ? 14.016 11.835 35.981 1.00 8.88 ? 92 LYS A CA 1 >ATOM 301 C C . PRO A 1 39 ? 29.292 24.248 28.211 1.00 12.05 ? 39 PRO A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1105 >ATOM 729 C C . LYS A 1 92 ? 12.861 12.812 35.807 1.00 8.61 ? 92 LYS A C 1 >ATOM 302 O O . PRO A 1 39 ? 30.027 23.380 28.676 1.00 12.12 ? 39 PRO A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1106 >ATOM 730 O O . LYS A 1 92 ? 11.721 12.511 36.168 1.00 8.95 ? 92 LYS A O 1 >ATOM 303 C CB . PRO A 1 39 ? 27.469 23.560 26.649 1.00 9.34 ? 39 PRO A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1107 >ATOM 731 C CB . LYS A 1 92 ? 13.781 10.626 35.078 1.00 9.10 ? 92 LYS A CB 1 >ATOM 304 C CG . PRO A 1 39 ? 27.779 22.131 26.593 1.00 10.32 ? 39 PRO A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1108 >ATOM 732 C CG . LYS A 1 92 ? 13.566 10.996 33.618 1.00 11.95 ? 92 LYS A CG 1 >ATOM 305 C CD . PRO A 1 39 ? 29.009 22.020 25.703 1.00 10.86 ? 39 PRO A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1109 >ATOM 733 C CD . LYS A 1 92 ? 13.467 9.762 32.759 1.00 14.04 ? 92 LYS A CD 1 >ATOM 306 N N . ALA A 1 40 ? 28.921 25.316 28.898 1.00 11.52 ? 40 ALA A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1110 >ATOM 734 C CE . LYS A 1 92 ? 13.333 10.124 31.299 1.00 16.33 ? 92 LYS A CE 1 >ATOM 307 C CA . ALA A 1 40 ? 29.192 25.423 30.329 1.00 11.84 ? 40 ALA A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1111 >ATOM 735 N NZ . LYS A 1 92 ? 13.129 8.884 30.506 1.00 17.37 ? 92 LYS A NZ 1 >ATOM 308 C C . ALA A 1 40 ? 27.773 25.329 30.894 1.00 10.23 ? 40 ALA A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1112 >ATOM 736 N N . MET A 1 93 ? 13.172 13.988 35.268 1.00 7.58 ? 93 MET A N 1 >ATOM 309 O O . ALA A 1 40 ? 26.894 26.080 30.478 1.00 10.42 ? 40 ALA A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1113 >ATOM 737 C CA . MET A 1 93 ? 12.159 14.985 34.995 1.00 8.21 ? 93 MET A CA 1 >ATOM 310 C CB . ALA A 1 40 ? 29.830 26.767 30.673 1.00 11.40 ? 40 ALA A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1114 >ATOM 738 C C . MET A 1 93 ? 11.915 15.038 33.496 1.00 9.18 ? 93 MET A C 1 >ATOM 311 N N . VAL A 1 41 ? 27.518 24.345 31.750 1.00 10.73 ? 41 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1115 >ATOM 739 O O . MET A 1 93 ? 12.833 14.838 32.690 1.00 7.74 ? 93 MET A O 1 >ATOM 312 C CA . VAL A 1 41 ? 26.185 24.169 32.333 1.00 9.92 ? 41 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1116 >ATOM 740 C CB . MET A 1 93 ? 12.565 16.359 35.523 1.00 9.68 ? 93 MET A CB 1 >ATOM 313 C C . VAL A 1 41 ? 26.226 24.295 33.854 1.00 11.64 ? 41 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1117 >ATOM 741 C CG . MET A 1 93 ? 13.826 16.925 34.937 1.00 13.16 ? 93 MET A CG 1 >ATOM 314 O O . VAL A 1 41 ? 27.026 23.627 34.514 1.00 11.40 ? 41 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1118 >ATOM 742 S SD . MET A 1 93 ? 14.238 18.543 35.628 1.00 17.49 ? 93 MET A SD 1 >ATOM 315 C CB . VAL A 1 41 ? 25.594 22.772 31.987 1.00 10.67 ? 41 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1119 >ATOM 743 C CE . MET A 1 93 ? 15.009 18.106 37.076 1.00 18.53 ? 93 MET A CE 1 >ATOM 316 C CG1 . VAL A 1 41 ? 24.204 22.596 32.612 1.00 11.34 ? 41 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1120 >ATOM 744 N N . VAL A 1 94 ? 10.658 15.239 33.128 1.00 9.48 ? 94 VAL A N 1 >ATOM 317 C CG2 . VAL A 1 41 ? 25.507 22.583 30.475 1.00 11.31 ? 41 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1121 >ATOM 745 C CA . VAL A 1 94 ? 10.266 15.334 31.726 1.00 9.55 ? 94 VAL A CA 1 >ATOM 318 N N . GLU A 1 42 ? 25.364 25.147 34.399 1.00 10.94 ? 42 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1122 >ATOM 746 C C . VAL A 1 94 ? 9.516 16.639 31.528 1.00 10.10 ? 94 VAL A C 1 >ATOM 319 C CA . GLU A 1 42 ? 25.271 25.327 35.845 1.00 12.40 ? 42 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1123 >ATOM 747 O O . VAL A 1 94 ? 8.683 17.024 32.364 1.00 9.47 ? 94 VAL A O 1 >ATOM 320 C C . GLU A 1 42 ? 23.837 25.095 36.316 1.00 11.42 ? 42 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1124 >ATOM 748 C CB . VAL A 1 94 ? 9.371 14.164 31.315 1.00 11.05 ? 94 VAL A CB 1 >ATOM 321 O O . GLU A 1 42 ? 22.898 25.720 35.825 1.00 10.46 ? 42 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1125 >ATOM 749 C CG1 . VAL A 1 94 ? 8.878 14.354 29.878 1.00 12.88 ? 94 VAL A CG1 1 >ATOM 322 C CB . GLU A 1 42 ? 25.711 26.721 36.270 1.00 16.26 ? 42 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1126 >ATOM 750 C CG2 . VAL A 1 94 ? 10.147 12.866 31.420 1.00 14.00 ? 94 VAL A CG2 1 >ATOM 323 C CG . GLU A 1 42 ? 25.495 26.947 37.768 1.00 23.78 ? 42 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1127 >ATOM 751 N N . CYS A 1 95 ? 9.802 17.312 30.413 1.00 9.49 ? 95 CYS A N 1 >ATOM 324 C CD . GLU A 1 42 ? 25.944 28.311 38.242 1.00 27.94 ? 42 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1128 >ATOM 752 C CA . CYS A 1 95 ? 9.169 18.582 30.094 1.00 8.82 ? 95 CYS A CA 1 >ATOM 325 O OE1 . GLU A 1 42 ? 25.308 29.329 37.872 1.00 29.92 ? 42 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1129 >ATOM 753 C C . CYS A 1 95 ? 8.431 18.559 28.758 1.00 11.70 ? 95 CYS A C 1 >ATOM 326 O OE2 . GLU A 1 42 ? 26.935 28.351 39.002 1.00 32.64 ? 42 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1130 >ATOM 754 O O . CYS A 1 95 ? 9.014 18.215 27.723 1.00 12.29 ? 95 CYS A O 1 >ATOM 327 N N . ILE A 1 43 ? 23.673 24.176 37.261 1.00 10.55 ? 43 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1131 >ATOM 755 C CB . CYS A 1 95 ? 10.229 19.679 30.059 1.00 8.79 ? 95 CYS A CB 1 >ATOM 328 C CA . ILE A 1 43 ? 22.362 23.864 37.794 1.00 10.69 ? 43 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1132 >ATOM 756 S SG . CYS A 1 95 ? 9.620 21.322 29.690 1.00 10.97 ? 95 CYS A SG 1 >ATOM 329 C C . ILE A 1 43 ? 22.360 24.120 39.300 1.00 11.07 ? 43 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1133 >ATOM 757 N N . GLU A 1 96 ? 7.149 18.902 28.791 1.00 10.87 ? 96 GLU A N 1 >ATOM 330 O O . ILE A 1 43 ? 23.307 23.764 39.992 1.00 10.83 ? 43 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1134 >ATOM 758 C CA . GLU A 1 96 ? 6.342 18.962 27.587 1.00 14.78 ? 96 GLU A CA 1 >ATOM 331 C CB . ILE A 1 43 ? 21.996 22.374 37.552 1.00 10.47 ? 43 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1135 >ATOM 759 C C . GLU A 1 96 ? 6.267 20.439 27.182 1.00 13.83 ? 96 GLU A C 1 >ATOM 332 C CG1 . ILE A 1 43 ? 21.974 22.072 36.056 1.00 10.46 ? 43 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1136 >ATOM 760 O O . GLU A 1 96 ? 6.044 21.311 28.030 1.00 12.79 ? 96 GLU A O 1 >ATOM 333 C CG2 . ILE A 1 43 ? 20.636 22.031 38.186 1.00 10.34 ? 43 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1137 >ATOM 761 C CB . GLU A 1 96 ? 4.957 18.397 27.885 1.00 20.21 ? 96 GLU A CB 1 >ATOM 334 C CD1 . ILE A 1 43 ? 21.607 20.639 35.726 1.00 9.00 ? 43 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1138 >ATOM 762 C CG . GLU A 1 96 ? 3.981 18.432 26.726 1.00 32.46 ? 96 GLU A CG 1 >ATOM 335 N N . LYS A 1 44 ? 21.315 24.784 39.778 1.00 12.26 ? 44 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1139 >ATOM 763 C CD . GLU A 1 96 ? 2.646 17.765 27.065 1.00 38.97 ? 96 GLU A CD 1 >ATOM 336 C CA . LYS A 1 44 ? 21.127 25.051 41.201 1.00 13.96 ? 44 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1140 >ATOM 764 O OE1 . GLU A 1 96 ? 2.053 18.108 28.128 1.00 42.61 ? 96 GLU A OE1 1 >ATOM 337 C C . LYS A 1 44 ? 19.729 24.528 41.516 1.00 14.16 ? 44 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1141 >ATOM 765 O OE2 . GLU A 1 96 ? 2.201 16.892 26.271 1.00 42.17 ? 96 GLU A OE2 1 >ATOM 338 O O . LYS A 1 44 ? 18.749 24.920 40.873 1.00 14.12 ? 44 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1142 >ATOM 766 N N . GLN A 1 97 ? 6.513 20.725 25.903 1.00 13.39 ? 97 GLN A N 1 >ATOM 339 C CB . LYS A 1 44 ? 21.220 26.545 41.503 1.00 16.58 ? 44 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1143 >ATOM 767 C CA . GLN A 1 97 ? 6.489 22.100 25.402 1.00 13.55 ? 97 GLN A CA 1 >ATOM 340 C CG . LYS A 1 44 ? 22.580 27.150 41.170 1.00 22.90 ? 44 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1144 >ATOM 768 C C . GLN A 1 97 ? 5.357 22.334 24.400 1.00 15.88 ? 97 GLN A C 1 >ATOM 341 C CD . LYS A 1 44 ? 22.571 28.654 41.385 1.00 29.01 ? 44 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1145 >ATOM 769 O O . GLN A 1 97 ? 5.013 21.455 23.591 1.00 16.25 ? 97 GLN A O 1 >ATOM 342 C CE . LYS A 1 44 ? 23.890 29.293 40.982 1.00 31.56 ? 44 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1146 >ATOM 770 C CB . GLN A 1 97 ? 7.823 22.465 24.747 1.00 12.20 ? 97 GLN A CB 1 >ATOM 343 N NZ . LYS A 1 44 ? 23.818 30.781 41.111 1.00 34.70 ? 44 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1147 >ATOM 771 C CG . GLN A 1 97 ? 9.033 22.324 25.650 1.00 12.55 ? 97 GLN A CG 1 >ATOM 344 N N . GLN A 1 45 ? 19.649 23.594 42.460 1.00 15.66 ? 45 GLN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1148 >ATOM 772 C CD . GLN A 1 97 ? 10.321 22.613 24.927 1.00 14.20 ? 97 GLN A CD 1 >ATOM 345 C CA . GLN A 1 45 ? 18.377 22.993 42.852 1.00 16.03 ? 45 GLN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1149 >ATOM 773 O OE1 . GLN A 1 97 ? 10.478 22.288 23.749 1.00 12.94 ? 97 GLN A OE1 1 >ATOM 346 C C . GLN A 1 45 ? 18.098 23.182 44.342 1.00 17.60 ? 45 GLN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1150 >ATOM 774 N NE2 . GLN A 1 97 ? 11.260 23.235 25.627 1.00 14.75 ? 97 GLN A NE2 1 >ATOM 347 O O . GLN A 1 45 ? 18.989 23.024 45.164 1.00 17.17 ? 45 GLN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1151 >ATOM 775 N N . LYS A 1 98 ? 4.801 23.541 24.450 1.00 17.30 ? 98 LYS A N 1 >ATOM 348 C CB . GLN A 1 45 ? 18.397 21.498 42.544 1.00 15.51 ? 45 GLN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1152 >ATOM 776 C CA . LYS A 1 98 ? 3.696 23.952 23.582 1.00 19.78 ? 98 LYS A CA 1 >ATOM 349 C CG . GLN A 1 45 ? 17.168 20.744 43.015 1.00 13.62 ? 45 GLN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1153 >ATOM 777 C C . LYS A 1 98 ? 3.990 25.340 23.019 1.00 18.56 ? 98 LYS A C 1 >ATOM 350 C CD . GLN A 1 45 ? 17.312 19.256 42.838 1.00 15.68 ? 45 GLN A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1154 >ATOM 778 O O . LYS A 1 98 ? 4.162 26.293 23.771 1.00 17.70 ? 98 LYS A O 1 >ATOM 351 O OE1 . GLN A 1 45 ? 18.348 18.769 42.397 1.00 18.84 ? 45 GLN A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1155 >ATOM 779 C CB . LYS A 1 98 ? 2.389 23.953 24.389 1.00 23.30 ? 98 LYS A CB 1 >ATOM 352 N NE2 . GLN A 1 45 ? 16.276 18.521 43.177 1.00 16.73 ? 45 GLN A NE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1156 >ATOM 780 C CG . LYS A 1 98 ? 1.294 24.857 23.867 1.00 30.94 ? 98 LYS A CG 1 >ATOM 353 N N . GLU A 1 46 ? 16.868 23.551 44.670 1.00 18.48 ? 46 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1157 >ATOM 781 C CD . LYS A 1 98 ? 0.210 25.047 24.934 1.00 37.10 ? 98 LYS A CD 1 >ATOM 354 C CA . GLU A 1 46 ? 16.441 23.718 46.062 1.00 21.26 ? 46 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1158 >ATOM 782 C CE . LYS A 1 98 ? -0.849 26.072 24.520 1.00 39.73 ? 98 LYS A CE 1 >ATOM 355 C C . GLU A 1 46 ? 15.108 23.004 46.105 1.00 19.06 ? 46 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1159 >ATOM 783 N NZ . LYS A 1 98 ? -0.326 27.476 24.541 1.00 42.46 ? 98 LYS A NZ 1 >ATOM 356 O O . GLU A 1 46 ? 14.080 23.589 45.784 1.00 20.08 ? 46 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1160 >ATOM 784 N N . LEU A 1 99 ? 4.073 25.445 21.696 1.00 19.35 ? 99 LEU A N 1 >ATOM 357 C CB . GLU A 1 46 ? 16.239 25.194 46.408 1.00 26.45 ? 46 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1161 >ATOM 785 C CA . LEU A 1 99 ? 4.357 26.721 21.041 1.00 21.32 ? 99 LEU A CA 1 >ATOM 358 C CG . GLU A 1 46 ? 17.284 25.787 47.361 1.00 37.46 ? 46 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1162 >ATOM 786 C C . LEU A 1 99 ? 3.307 27.770 21.351 1.00 22.86 ? 99 LEU A C 1 >ATOM 359 C CD . GLU A 1 46 ? 17.093 25.374 48.832 1.00 42.24 ? 46 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1163 >ATOM 787 O O . LEU A 1 99 ? 2.108 27.496 21.261 1.00 23.41 ? 99 LEU A O 1 >ATOM 360 O OE1 . GLU A 1 46 ? 16.192 25.944 49.501 1.00 44.05 ? 46 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1164 >ATOM 788 C CB . LEU A 1 99 ? 4.466 26.542 19.526 1.00 22.09 ? 99 LEU A CB 1 >ATOM 361 O OE2 . GLU A 1 46 ? 17.867 24.507 49.320 1.00 44.14 ? 46 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1165 >ATOM 789 C CG . LEU A 1 99 ? 5.692 25.792 18.997 1.00 22.72 ? 99 LEU A CG 1 >ATOM 362 N N . GLY A 1 47 ? 15.131 21.720 46.429 1.00 18.35 ? 47 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1166 >ATOM 790 C CD1 . LEU A 1 99 ? 5.585 25.639 17.490 1.00 23.04 ? 99 LEU A CD1 1 >ATOM 363 C CA . GLY A 1 47 ? 13.893 20.970 46.463 1.00 18.96 ? 47 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1167 >ATOM 791 C CD2 . LEU A 1 99 ? 6.951 26.548 19.372 1.00 23.61 ? 99 LEU A CD2 1 >ATOM 364 C C . GLY A 1 47 ? 13.382 20.755 45.053 1.00 18.27 ? 47 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1168 >ATOM 792 N N . LEU A 1 100 ? 3.767 28.962 21.722 1.00 24.11 ? 100 LEU A N 1 >ATOM 365 O O . GLY A 1 47 ? 14.067 20.157 44.238 1.00 18.05 ? 47 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1169 >ATOM 793 C CA . LEU A 1 100 ? 2.879 30.070 22.051 1.00 27.59 ? 100 LEU A CA 1 >ATOM 366 N N . ASP A 1 48 ? 12.194 21.262 44.755 1.00 16.66 ? 48 ASP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1170 >ATOM 794 C C . LEU A 1 100 ? 2.130 30.545 20.815 1.00 30.94 ? 100 LEU A C 1 >ATOM 367 C CA . ASP A 1 48 ? 11.617 21.107 43.420 1.00 16.86 ? 48 ASP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1171 >ATOM 795 O O . LEU A 1 100 ? 0.951 30.908 20.877 1.00 31.34 ? 100 LEU A O 1 >ATOM 368 C C . ASP A 1 48 ? 11.771 22.378 42.566 1.00 15.92 ? 48 ASP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1172 >ATOM 796 C CB . LEU A 1 100 ? 3.680 31.227 22.640 1.00 25.50 ? 100 LEU A CB 1 >ATOM 369 O O . ASP A 1 48 ? 11.139 22.511 41.504 1.00 14.50 ? 48 ASP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1173 >ATOM 797 C CG . LEU A 1 100 ? 4.254 30.947 24.020 1.00 24.80 ? 100 LEU A CG 1 >ATOM 370 C CB . ASP A 1 48 ? 10.136 20.694 43.513 1.00 19.00 ? 48 ASP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1174 >ATOM 798 C CD1 . LEU A 1 100 ? 4.960 32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 >ATOM 371 C CG . ASP A 1 48 ? 9.943 19.221 43.897 1.00 21.49 ? 48 ASP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1175 >ATOM 799 C CD2 . LEU A 1 100 ? 3.141 30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 >ATOM 372 O OD1 . ASP A 1 48 ? 10.901 18.406 43.840 1.00 23.51 ? 48 ASP A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1176 >ATOM 800 N N . LYS A 1 101 ? 2.835 30.531 19.689 1.00 34.60 ? 101 LYS A N 1 >ATOM 373 O OD2 . ASP A 1 48 ? 8.802 18.868 44.243 1.00 25.04 ? 48 ASP A OD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1177 >ATOM 801 C CA . LYS A 1 101 ? 2.282 30.961 18.413 1.00 37.81 ? 101 LYS A CA 1 >ATOM 374 N N . THR A 1 49 ? 12.610 23.299 43.042 1.00 13.75 ? 49 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1178 >ATOM 802 C C . LYS A 1 101 ? 2.847 30.088 17.292 1.00 37.39 ? 101 LYS A C 1 >ATOM 375 C CA . THR A 1 49 ? 12.870 24.551 42.348 1.00 13.82 ? 49 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1179 >ATOM 803 O O . LYS A 1 101 ? 4.019 29.687 17.319 1.00 37.22 ? 101 LYS A O 1 >ATOM 376 C C . THR A 1 49 ? 14.231 24.460 41.678 1.00 13.22 ? 49 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1180 >ATOM 804 C CB . LYS A 1 101 ? 2.653 32.429 18.147 1.00 40.57 ? 101 LYS A CB 1 >ATOM 377 O O . THR A 1 49 ? 15.235 24.152 42.322 1.00 12.56 ? 49 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1181 >ATOM 805 C CG . LYS A 1 101 ? 2.182 33.426 19.212 1.00 45.13 ? 101 LYS A CG 1 >ATOM 378 C CB . THR A 1 49 ? 12.847 25.741 43.316 1.00 16.10 ? 49 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1182 >ATOM 806 C CD . LYS A 1 101 ? 2.955 34.741 19.125 1.00 48.57 ? 101 LYS A CD 1 >ATOM 379 O OG1 . THR A 1 49 ? 11.556 25.815 43.941 1.00 17.94 ? 49 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1183 >ATOM 807 C CE . LYS A 1 101 ? 4.479 34.527 19.248 1.00 51.31 ? 101 LYS A CE 1 >ATOM 380 C CG2 . THR A 1 49 ? 13.100 27.037 42.571 1.00 16.15 ? 49 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1184 >ATOM 808 N NZ . LYS A 1 101 ? 4.917 33.952 20.559 1.00 51.14 ? 101 LYS A NZ 1 >ATOM 381 N N . PHE A 1 50 ? 14.266 24.794 40.392 1.00 12.20 ? 50 PHE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1185 >ATOM 809 N N . GLY A 1 102 ? 1.997 29.786 16.318 1.00 37.21 ? 102 GLY A N 1 >ATOM 382 C CA . PHE A 1 50 ? 15.485 24.704 39.602 1.00 10.82 ? 50 PHE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1186 >ATOM 810 C CA . GLY A 1 102 ? 2.423 28.993 15.184 1.00 36.82 ? 102 GLY A CA 1 >ATOM 383 C C . PHE A 1 50 ? 15.842 25.979 38.855 1.00 10.40 ? 50 PHE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1187 >ATOM 811 C C . GLY A 1 102 ? 2.333 27.494 15.344 1.00 36.36 ? 102 GLY A C 1 >ATOM 384 O O . PHE A 1 50 ? 14.968 26.758 38.460 1.00 9.90 ? 50 PHE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1188 >ATOM 812 O O . GLY A 1 102 ? 1.690 26.977 16.265 1.00 35.74 ? 102 GLY A O 1 >ATOM 385 C CB . PHE A 1 50 ? 15.338 23.591 38.547 1.00 10.78 ? 50 PHE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1189 >ATOM 813 N N . GLU A 1 103 ? 2.954 26.803 14.395 1.00 35.74 ? 103 GLU A N 1 >ATOM 386 C CG . PHE A 1 50 ? 15.316 22.192 39.107 1.00 13.13 ? 50 PHE A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1190 >ATOM 814 C CA . GLU A 1 103 ? 2.988 25.348 14.377 1.00 35.50 ? 103 GLU A CA 1 >ATOM 387 C CD1 . PHE A 1 50 ? 14.146 21.653 39.634 1.00 11.97 ? 50 PHE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1191 >ATOM 815 C C . GLU A 1 103 ? 4.418 24.880 14.140 1.00 31.92 ? 103 GLU A C 1 >ATOM 388 C CD2 . PHE A 1 50 ? 16.464 21.401 39.079 1.00 14.34 ? 50 PHE A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1192 >ATOM 816 O O . GLU A 1 103 ? 5.281 25.654 13.723 1.00 31.61 ? 103 GLU A O 1 >ATOM 389 C CE1 . PHE A 1 50 ? 14.113 20.367 40.120 1.00 12.69 ? 50 PHE A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1193 >ATOM 817 C CB . GLU A 1 103 ? 2.077 24.784 13.274 1.00 39.37 ? 103 GLU A CB 1 >ATOM 390 C CE2 . PHE A 1 50 ? 16.439 20.098 39.569 1.00 14.64 ? 50 PHE A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1194 >ATOM 818 C CG . GLU A 1 103 ? 0.652 24.422 13.712 1.00 45.52 ? 103 GLU A CG 1 >ATOM 391 C CZ . PHE A 1 50 ? 15.258 19.582 40.092 1.00 13.15 ? 50 PHE A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1195 >ATOM 819 C CD . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD 1 >ATOM 392 N N . TYR A 1 51 ? 17.147 26.165 38.678 1.00 10.37 ? 51 TYR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1196 >ATOM 820 O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 >ATOM 393 C CA . TYR A 1 51 ? 17.709 27.258 37.910 1.00 10.95 ? 51 TYR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1197 >ATOM 821 O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 >ATOM 394 C C . TYR A 1 51 ? 18.714 26.513 37.039 1.00 9.84 ? 51 TYR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1198 >ATOM 822 N N . GLY A 1 104 ? 4.653 23.604 14.414 1.00 28.97 ? 104 GLY A N 1 >ATOM 395 O O . TYR A 1 51 ? 19.540 25.761 37.547 1.00 9.78 ? 51 TYR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1199 >ATOM 823 C CA . GLY A 1 104 ? 5.967 23.024 14.231 1.00 25.41 ? 104 GLY A CA 1 >ATOM 396 C CB . TYR A 1 51 ? 18.436 28.284 38.790 1.00 12.57 ? 51 TYR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1200 >ATOM 824 C C . GLY A 1 104 ? 6.012 21.648 14.863 1.00 22.09 ? 104 GLY A C 1 >ATOM 397 C CG . TYR A 1 51 ? 19.396 29.178 38.014 1.00 12.91 ? 51 TYR A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1201 >ATOM 825 O O . GLY A 1 104 ? 4.987 21.160 15.347 1.00 21.89 ? 104 GLY A O 1 >ATOM 398 C CD1 . TYR A 1 51 ? 18.939 30.302 37.327 1.00 15.83 ? 51 TYR A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1202 >ATOM 826 N N . PRO A 1 105 ? 7.176 20.976 14.832 1.00 19.50 ? 105 PRO A N 1 >ATOM 399 C CD2 . TYR A 1 51 ? 20.762 28.896 37.974 1.00 14.05 ? 51 TYR A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1203 >ATOM 827 C CA . PRO A 1 105 ? 7.338 19.640 15.418 1.00 17.92 ? 105 PRO A CA 1 >ATOM 400 C CE1 . TYR A 1 51 ? 19.822 31.126 36.621 1.00 16.52 ? 51 TYR A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1204 >ATOM 828 C C . PRO A 1 105 ? 7.020 19.664 16.914 1.00 15.61 ? 105 PRO A C 1 >ATOM 401 C CE2 . TYR A 1 51 ? 21.655 29.705 37.275 1.00 14.62 ? 51 TYR A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1205 >ATOM 829 O O . PRO A 1 105 ? 7.170 20.696 17.567 1.00 14.42 ? 105 PRO A O 1 >ATOM 402 C CZ . TYR A 1 51 ? 21.179 30.818 36.604 1.00 16.59 ? 51 TYR A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1206 >ATOM 830 C CB . PRO A 1 105 ? 8.828 19.348 15.202 1.00 18.86 ? 105 PRO A CB 1 >ATOM 403 O OH . TYR A 1 51 ? 22.060 31.633 35.932 1.00 17.52 ? 51 TYR A OH 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1207 >ATOM 831 C CG . PRO A 1 105 ? 9.188 20.164 14.005 1.00 18.76 ? 105 PRO A CG 1 >ATOM 404 N N . ILE A 1 52 ? 18.610 26.676 35.726 1.00 10.57 ? 52 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1208 >ATOM 832 C CD . PRO A 1 105 ? 8.423 21.440 14.199 1.00 18.40 ? 105 PRO A CD 1 >ATOM 405 C CA . ILE A 1 52 ? 19.520 26.004 34.801 1.00 9.09 ? 52 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1209 >ATOM 833 N N . LYS A 1 106 ? 6.552 18.541 17.444 1.00 16.02 ? 106 LYS A N 1 >ATOM 406 C C . ILE A 1 52 ? 20.066 27.020 33.801 1.00 8.55 ? 52 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1210 >ATOM 834 C CA . LYS A 1 106 ? 6.255 18.453 18.868 1.00 16.93 ? 106 LYS A CA 1 >ATOM 407 O O . ILE A 1 52 ? 19.296 27.652 33.086 1.00 10.49 ? 52 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1211 >ATOM 835 C C . LYS A 1 106 ? 7.609 18.305 19.554 1.00 15.49 ? 106 LYS A C 1 >ATOM 408 C CB . ILE A 1 52 ? 18.807 24.859 34.026 1.00 8.96 ? 52 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1212 >ATOM 836 O O . LYS A 1 106 ? 8.397 17.437 19.183 1.00 14.76 ? 106 LYS A O 1 >ATOM 409 C CG1 . ILE A 1 52 ? 18.242 23.814 35.013 1.00 9.15 ? 52 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1213 >ATOM 837 C CB . LYS A 1 106 ? 5.387 17.229 19.174 1.00 20.98 ? 106 LYS A CB 1 >ATOM 410 C CG2 . ILE A 1 52 ? 19.792 24.189 33.070 1.00 10.39 ? 52 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1214 >ATOM 838 C CG . LYS A 1 106 ? 5.015 17.097 20.662 1.00 27.98 ? 106 LYS A CG 1 >ATOM 411 C CD1 . ILE A 1 52 ? 17.585 22.616 34.366 1.00 8.10 ? 52 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1215 >ATOM 839 C CD . LYS A 1 106 ? 4.463 18.433 21.229 1.00 33.23 ? 106 LYS A CD 1 >ATOM 412 N N . LYS A 1 53 ? 21.388 27.197 33.791 1.00 8.61 ? 53 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1216 >ATOM 840 C CE . LYS A 1 106 ? 4.250 18.417 22.764 1.00 35.21 ? 106 LYS A CE 1 >ATOM 413 C CA . LYS A 1 53 ? 22.049 28.115 32.868 1.00 9.66 ? 53 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1217 >ATOM 841 N NZ . LYS A 1 106 ? 5.519 18.251 23.566 1.00 33.75 ? 106 LYS A NZ 1 >ATOM 414 C C . LYS A 1 53 ? 22.939 27.319 31.924 1.00 8.71 ? 53 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1218 >ATOM 842 N N . THR A 1 107 ? 7.907 19.167 20.515 1.00 13.91 ? 107 THR A N 1 >ATOM 415 O O . LYS A 1 53 ? 23.815 26.583 32.362 1.00 7.58 ? 53 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1219 >ATOM 843 C CA . THR A 1 107 ? 9.203 19.086 21.190 1.00 12.14 ? 107 THR A CA 1 >ATOM 416 C CB . LYS A 1 53 ? 22.909 29.120 33.611 1.00 10.60 ? 53 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1220 >ATOM 844 C C . THR A 1 107 ? 9.083 18.819 22.681 1.00 11.66 ? 107 THR A C 1 >ATOM 417 C CG . LYS A 1 53 ? 23.580 30.135 32.688 1.00 14.21 ? 53 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1221 >ATOM 845 O O . THR A 1 107 ? 8.061 19.120 23.295 1.00 10.59 ? 107 THR A O 1 >ATOM 418 C CD . LYS A 1 53 ? 24.496 31.006 33.505 1.00 20.27 ? 53 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1222 >ATOM 846 C CB . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB 1 >ATOM 419 C CE . LYS A 1 53 ? 24.831 32.319 32.828 1.00 26.91 ? 53 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1223 >ATOM 847 O OG1 . THR A 1 107 ? 9.263 21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 >ATOM 420 N NZ . LYS A 1 53 ? 25.878 33.009 33.659 1.00 29.12 ? 53 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1224 >ATOM 848 C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 >ATOM 421 N N . THR A 1 54 ? 22.686 27.445 30.625 1.00 8.49 ? 54 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1225 >ATOM 849 N N . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N 1 >ATOM 422 C CA . THR A 1 54 ? 23.478 26.747 29.628 1.00 7.98 ? 54 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1226 >ATOM 850 C CA . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98 ? 108 SER A CA 1 >ATOM 423 C C . THR A 1 54 ? 24.118 27.820 28.764 1.00 8.23 ? 54 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1227 >ATOM 851 C C . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90 ? 108 SER A C 1 >ATOM 424 O O . THR A 1 54 ? 23.433 28.584 28.087 1.00 8.40 ? 54 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1228 >ATOM 852 O O . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48 ? 108 SER A O 1 >ATOM 425 C CB . THR A 1 54 ? 22.621 25.817 28.789 1.00 8.33 ? 54 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1229 >ATOM 853 C CB . SER A 1 108 ? 9.370 16.729 25.024 1.00 9.84 ? 108 SER A CB 1 >ATOM 426 O OG1 . THR A 1 54 ? 21.896 24.946 29.660 1.00 9.95 ? 54 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1230 >ATOM 854 O OG . SER A 1 108 ? 9.844 15.601 24.313 1.00 13.87 ? 108 SER A OG 1 >ATOM 427 C CG2 . THR A 1 54 ? 23.505 24.976 27.873 1.00 4.95 ? 54 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1231 >ATOM 855 N N . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96 ? 109 TRP A N 1 >ATOM 428 N N . SER A 1 55 ? 25.444 27.840 28.758 1.00 8.75 ? 55 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1232 >ATOM 856 C CA . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85 ? 109 TRP A CA 1 >ATOM 429 C CA . SER A 1 55 ? 26.171 28.865 28.047 1.00 10.50 ? 55 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1233 >ATOM 857 C C . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56 ? 109 TRP A C 1 >ATOM 430 C C . SER A 1 55 ? 27.116 28.382 26.950 1.00 9.24 ? 55 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1234 >ATOM 858 O O . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14 ? 109 TRP A O 1 >ATOM 431 O O . SER A 1 55 ? 27.802 27.370 27.101 1.00 8.98 ? 55 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1235 >ATOM 859 C CB . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25 ? 109 TRP A CB 1 >ATOM 432 C CB . SER A 1 55 ? 26.934 29.694 29.082 1.00 13.09 ? 55 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1236 >ATOM 860 C CG . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07 ? 109 TRP A CG 1 >ATOM 433 O OG . SER A 1 55 ? 27.781 30.646 28.473 1.00 23.11 ? 55 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1237 >ATOM 861 C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28 ? 109 TRP A CD1 1 >ATOM 434 N N . THR A 1 56 ? 27.091 29.094 25.825 1.00 8.86 ? 56 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1238 >ATOM 862 C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31 ? 109 TRP A CD2 1 >ATOM 435 C CA . THR A 1 56 ? 27.978 28.831 24.684 1.00 8.05 ? 56 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1239 >ATOM 863 N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69 ? 109 TRP A NE1 1 >ATOM 436 C C . THR A 1 56 ? 28.393 30.215 24.138 1.00 8.09 ? 56 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1240 >ATOM 864 C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04 ? 109 TRP A CE2 1 >ATOM 437 O O . THR A 1 56 ? 27.834 31.237 24.525 1.00 7.17 ? 56 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1241 >ATOM 865 C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92 ? 109 TRP A CE3 1 >ATOM 438 C CB . THR A 1 56 ? 27.296 28.024 23.534 1.00 6.70 ? 56 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1242 >ATOM 866 C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72 ? 109 TRP A CZ2 1 >ATOM 439 O OG1 . THR A 1 56 ? 26.294 28.829 22.909 1.00 9.76 ? 56 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1243 >ATOM 867 C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 >ATOM 440 C CG2 . THR A 1 56 ? 26.653 26.751 24.049 1.00 7.76 ? 56 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1244 >ATOM 868 C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 >ATOM 441 N N . THR A 1 57 ? 29.381 30.242 23.249 1.00 9.17 ? 57 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1245 >ATOM 869 N N . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39 ? 110 THR A N 1 >ATOM 442 C CA . THR A 1 57 ? 29.871 31.485 22.644 1.00 8.49 ? 57 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1246 >ATOM 870 C CA . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23 ? 110 THR A CA 1 >ATOM 443 C C . THR A 1 57 ? 28.820 32.222 21.802 1.00 7.50 ? 57 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1247 >ATOM 871 C C . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40 ? 110 THR A C 1 >ATOM 444 O O . THR A 1 57 ? 28.952 33.412 21.565 1.00 9.40 ? 57 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1248 >ATOM 872 O O . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43 ? 110 THR A O 1 >ATOM 445 C CB . THR A 1 57 ? 31.091 31.205 21.716 1.00 9.12 ? 57 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1249 >ATOM 873 C CB . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17 ? 110 THR A CB 1 >ATOM 446 O OG1 . THR A 1 57 ? 30.758 30.171 20.786 1.00 9.41 ? 57 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1250 >ATOM 874 O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49 ? 110 THR A OG1 1 >ATOM 447 C CG2 . THR A 1 57 ? 32.297 30.775 22.516 1.00 11.48 ? 57 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1251 >ATOM 875 C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64 ? 110 THR A CG2 1 >ATOM 448 N N . VAL A 1 58 ? 27.786 31.510 21.356 1.00 8.04 ? 58 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1252 >ATOM 876 N N . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72 ? 111 ARG A N 1 >ATOM 449 C CA . VAL A 1 58 ? 26.733 32.090 20.500 1.00 9.09 ? 58 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1253 >ATOM 877 C CA . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27 ? 111 ARG A CA 1 >ATOM 450 C C . VAL A 1 58 ? 25.328 32.224 21.102 1.00 8.67 ? 58 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1254 >ATOM 878 C C . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89 ? 111 ARG A C 1 >ATOM 451 O O . VAL A 1 58 ? 24.466 32.892 20.531 1.00 6.97 ? 58 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1255 >ATOM 879 O O . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35 ? 111 ARG A O 1 >ATOM 452 C CB . VAL A 1 58 ? 26.602 31.287 19.155 1.00 9.96 ? 58 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1256 >ATOM 880 C CB . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20 ? 111 ARG A CB 1 >ATOM 453 C CG1 . VAL A 1 58 ? 27.976 31.161 18.454 1.00 11.08 ? 58 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1257 >ATOM 881 C CG . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38 ? 111 ARG A CG 1 >ATOM 454 C CG2 . VAL A 1 58 ? 26.010 29.890 19.404 1.00 9.41 ? 58 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1258 >ATOM 882 C CD . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70 ? 111 ARG A CD 1 >ATOM 455 N N . ARG A 1 59 ? 25.100 31.620 22.266 1.00 8.88 ? 59 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1259 >ATOM 883 N NE . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83 ? 111 ARG A NE 1 >ATOM 456 C CA . ARG A 1 59 ? 23.783 31.655 22.882 1.00 9.95 ? 59 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1260 >ATOM 884 C CZ . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ 1 >ATOM 457 C C . ARG A 1 59 ? 23.843 31.140 24.303 1.00 10.14 ? 59 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1261 >ATOM 885 N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 >ATOM 458 O O . ARG A 1 59 ? 24.440 30.108 24.556 1.00 10.10 ? 59 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1262 >ATOM 886 N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 >ATOM 459 C CB . ARG A 1 59 ? 22.837 30.751 22.074 1.00 13.11 ? 59 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1263 >ATOM 887 N N . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64 ? 112 GLU A N 1 >ATOM 460 C CG . ARG A 1 59 ? 21.417 30.569 22.623 1.00 16.80 ? 59 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1264 >ATOM 888 C CA . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA 1 >ATOM 461 C CD . ARG A 1 59 ? 20.521 29.961 21.535 1.00 18.74 ? 59 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1265 >ATOM 889 C C . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93 ? 112 GLU A C 1 >ATOM 462 N NE . ARG A 1 59 ? 19.250 29.440 22.032 1.00 20.63 ? 59 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1266 >ATOM 890 O O . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92 ? 112 GLU A O 1 >ATOM 463 C CZ . ARG A 1 59 ? 18.147 30.165 22.193 1.00 22.94 ? 59 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1267 >ATOM 891 C CB . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB 1 >ATOM 464 N NH1 . ARG A 1 59 ? 18.138 31.462 21.894 1.00 22.55 ? 59 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1268 >ATOM 892 C CG . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG 1 >ATOM 465 N NH2 . ARG A 1 59 ? 17.051 29.594 22.686 1.00 23.68 ? 59 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1269 >ATOM 893 C CD . GLU A 1 112 ? 17.484 9.325 32.177 1.00 25.09 ? 112 GLU A CD 1 >ATOM 466 N N . THR A 1 60 ? 23.183 31.849 25.211 1.00 11.23 ? 60 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1270 >ATOM 894 O OE1 . GLU A 1 112 ? 17.223 8.308 32.883 1.00 22.36 ? 112 GLU A OE1 1 >ATOM 467 C CA . THR A 1 60 ? 23.120 31.458 26.611 1.00 11.84 ? 60 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1271 >ATOM 895 O OE2 . GLU A 1 112 ? 17.175 9.443 30.955 1.00 25.10 ? 112 GLU A OE2 1 >ATOM 468 C C . THR A 1 60 ? 21.650 31.500 27.005 1.00 11.73 ? 60 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1272 >ATOM 896 N N . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96 ? 113 LEU A N 1 >ATOM 469 O O . THR A 1 60 ? 20.934 32.423 26.620 1.00 13.69 ? 60 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1273 >ATOM 897 C CA . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA 1 >ATOM 470 C CB . THR A 1 60 ? 23.916 32.451 27.519 1.00 10.13 ? 60 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1274 >ATOM 898 C C . LEU A 1 113 ? 20.789 9.991 37.081 1.00 12.06 ? 113 LEU A C 1 >ATOM 471 O OG1 . THR A 1 60 ? 25.320 32.302 27.276 1.00 10.55 ? 60 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1275 >ATOM 899 O O . LEU A 1 113 ? 19.906 9.270 37.559 1.00 12.08 ? 113 LEU A O 1 >ATOM 472 C CG2 . THR A 1 60 ? 23.632 32.181 29.003 1.00 11.01 ? 60 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1276 >ATOM 900 C CB . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB 1 >ATOM 473 N N . THR A 1 61 ? 21.183 30.470 27.706 1.00 11.78 ? 61 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1277 >ATOM 901 C CG . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG 1 >ATOM 474 C CA . THR A 1 61 ? 19.797 30.413 28.175 1.00 11.54 ? 61 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1278 >ATOM 902 C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 >ATOM 475 C C . THR A 1 61 ? 19.831 30.214 29.686 1.00 10.88 ? 61 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1279 >ATOM 903 C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 >ATOM 476 O O . THR A 1 61 ? 20.734 29.570 30.205 1.00 9.63 ? 61 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1280 >ATOM 904 N N . THR A 1 114 ? 21.895 9.502 36.535 1.00 11.06 ? 114 THR A N 1 >ATOM 477 C CB . THR A 1 61 ? 18.965 29.229 27.539 1.00 12.65 ? 61 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1281 >ATOM 905 C CA . THR A 1 114 ? 22.110 8.062 36.452 1.00 11.74 ? 114 THR A CA 1 >ATOM 478 O OG1 . THR A 1 61 ? 19.563 27.976 27.874 1.00 14.13 ? 61 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1282 >ATOM 906 C C . THR A 1 114 ? 22.816 7.522 37.686 1.00 11.41 ? 114 THR A C 1 >ATOM 479 C CG2 . THR A 1 61 ? 18.889 29.336 26.012 1.00 14.15 ? 61 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1283 >ATOM 907 O O . THR A 1 114 ? 23.327 8.282 38.501 1.00 11.47 ? 114 THR A O 1 >ATOM 480 N N . GLU A 1 62 ? 18.878 30.828 30.382 1.00 12.14 ? 62 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1284 >ATOM 908 C CB . THR A 1 114 ? 22.894 7.700 35.188 1.00 12.89 ? 114 THR A CB 1 >ATOM 481 C CA . GLU A 1 62 ? 18.749 30.698 31.833 1.00 12.88 ? 62 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1285 >ATOM 909 O OG1 . THR A 1 114 ? 24.109 8.451 35.164 1.00 15.50 ? 114 THR A OG1 1 >ATOM 482 C C . GLU A 1 62 ? 17.283 30.444 32.100 1.00 12.21 ? 62 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1286 >ATOM 910 C CG2 . THR A 1 114 ? 22.075 8.037 33.951 1.00 14.75 ? 114 THR A CG2 1 >ATOM 483 O O . GLU A 1 62 ? 16.450 31.270 31.745 1.00 13.95 ? 62 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1287 >ATOM 911 N N . ASN A 1 115 ? 22.834 6.202 37.808 1.00 13.23 ? 115 ASN A N 1 >ATOM 484 C CB . GLU A 1 62 ? 19.151 31.990 32.538 1.00 16.15 ? 62 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1288 >ATOM 912 C CA . ASN A 1 115 ? 23.441 5.538 38.951 1.00 16.19 ? 115 ASN A CA 1 >ATOM 485 C CG . GLU A 1 62 ? 20.585 32.344 32.326 1.00 23.65 ? 62 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1289 >ATOM 913 C C . ASN A 1 115 ? 24.930 5.761 39.139 1.00 14.24 ? 115 ASN A C 1 >ATOM 486 C CD . GLU A 1 62 ? 20.961 33.649 32.979 1.00 29.90 ? 62 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1290 >ATOM 914 O O . ASN A 1 115 ? 25.432 5.626 40.256 1.00 14.74 ? 115 ASN A O 1 >ATOM 487 O OE1 . GLU A 1 62 ? 20.969 33.703 34.229 1.00 31.84 ? 62 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1291 >ATOM 915 C CB . ASN A 1 115 ? 23.123 4.047 38.918 1.00 21.89 ? 115 ASN A CB 1 >ATOM 488 O OE2 . GLU A 1 62 ? 21.258 34.616 32.236 1.00 33.89 ? 62 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1292 >ATOM 916 C CG . ASN A 1 115 ? 21.703 3.754 39.357 1.00 29.77 ? 115 ASN A CG 1 >ATOM 489 N N . ILE A 1 63 ? 16.943 29.292 32.657 1.00 10.43 ? 63 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1293 >ATOM 917 O OD1 . ASN A 1 115 ? 20.955 3.046 38.669 1.00 34.83 ? 115 ASN A OD1 1 >ATOM 490 C CA . ILE A 1 63 ? 15.548 29.021 32.946 1.00 11.02 ? 63 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1294 >ATOM 918 N ND2 . ASN A 1 115 ? 21.313 4.310 40.516 1.00 32.90 ? 115 ASN A ND2 1 >ATOM 491 C C . ILE A 1 63 ? 15.352 28.816 34.446 1.00 11.60 ? 63 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1295 >ATOM 919 N N . ASP A 1 116 ? 25.626 6.095 38.055 1.00 12.05 ? 116 ASP A N 1 >ATOM 492 O O . ILE A 1 63 ? 16.286 28.434 35.144 1.00 9.20 ? 63 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1296 >ATOM 920 C CA . ASP A 1 116 ? 27.061 6.364 38.094 1.00 11.99 ? 116 ASP A CA 1 >ATOM 493 C CB . ILE A 1 63 ? 14.976 27.816 32.125 1.00 11.28 ? 63 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1297 >ATOM 921 C C . ASP A 1 116 ? 27.424 7.821 38.397 1.00 11.45 ? 116 ASP A C 1 >ATOM 494 C CG1 . ILE A 1 63 ? 15.717 26.519 32.431 1.00 10.60 ? 63 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1298 >ATOM 922 O O . ASP A 1 116 ? 28.592 8.184 38.393 1.00 12.23 ? 116 ASP A O 1 >ATOM 495 C CG2 . ILE A 1 63 ? 15.020 28.129 30.638 1.00 11.62 ? 63 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1299 >ATOM 923 C CB . ASP A 1 116 ? 27.764 5.875 36.806 1.00 13.89 ? 116 ASP A CB 1 >ATOM 496 C CD1 . ILE A 1 63 ? 15.126 25.293 31.720 1.00 13.40 ? 63 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1300 >ATOM 924 C CG . ASP A 1 116 ? 27.177 6.474 35.512 1.00 16.58 ? 116 ASP A CG 1 >ATOM 497 N N . ASN A 1 64 ? 14.184 29.219 34.933 1.00 12.13 ? 64 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1301 >ATOM 925 O OD1 . ASP A 1 116 ? 26.263 7.303 35.569 1.00 19.66 ? 116 ASP A OD1 1 >ATOM 498 C CA . ASN A 1 64 ? 13.824 29.083 36.343 1.00 14.79 ? 64 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1302 >ATOM 926 O OD2 . ASP A 1 116 ? 27.651 6.113 34.422 1.00 20.14 ? 116 ASP A OD2 1 >ATOM 499 C C . ASN A 1 64 ? 12.451 28.441 36.375 1.00 13.29 ? 64 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1303 >ATOM 927 N N . GLY A 1 117 ? 26.420 8.647 38.675 1.00 10.58 ? 117 GLY A N 1 >ATOM 500 O O . ASN A 1 64 ? 11.490 28.976 35.802 1.00 13.29 ? 64 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1304 >ATOM 928 C CA . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83 ? 117 GLY A CA 1 >ATOM 501 C CB . ASN A 1 64 ? 13.732 30.450 37.054 1.00 16.87 ? 64 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1305 >ATOM 929 C C . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97 ? 117 GLY A C 1 >ATOM 502 C CG . ASN A 1 64 ? 15.079 31.089 37.279 1.00 20.91 ? 64 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1306 >ATOM 930 O O . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O 1 >ATOM 503 O OD1 . ASN A 1 64 ? 15.775 30.764 38.238 1.00 22.91 ? 64 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1307 >ATOM 931 N N . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43 ? 118 GLU A N 1 >ATOM 504 N ND2 . ASN A 1 64 ? 15.459 32.007 36.393 1.00 22.20 ? 64 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1308 >ATOM 932 C CA . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79 ? 118 GLU A CA 1 >ATOM 505 N N . PHE A 1 65 ? 12.347 27.301 37.044 1.00 12.90 ? 65 PHE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1309 >ATOM 933 C C . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60 ? 118 GLU A C 1 >ATOM 506 C CA . PHE A 1 65 ? 11.058 26.641 37.132 1.00 12.63 ? 65 PHE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1310 >ATOM 934 O O . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05 ? 118 GLU A O 1 >ATOM 507 C C . PHE A 1 65 ? 10.858 25.841 38.410 1.00 13.07 ? 65 PHE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1311 >ATOM 935 C CB . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86 ? 118 GLU A CB 1 >ATOM 508 O O . PHE A 1 65 ? 11.811 25.531 39.121 1.00 12.50 ? 65 PHE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1312 >ATOM 936 C CG . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64 ? 118 GLU A CG 1 >ATOM 509 C CB . PHE A 1 65 ? 10.829 25.731 35.922 1.00 11.31 ? 65 PHE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1313 >ATOM 937 C CD . GLU A 1 118 ? 28.770 9.370 33.310 1.00 13.39 ? 118 GLU A CD 1 >ATOM 510 C CG . PHE A 1 65 ? 11.794 24.586 35.825 1.00 12.32 ? 65 PHE A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1314 >ATOM 938 O OE1 . GLU A 1 118 ? 28.036 9.043 32.355 1.00 11.90 ? 118 GLU A OE1 1 >ATOM 511 C CD1 . PHE A 1 65 ? 11.549 23.386 36.494 1.00 10.31 ? 65 PHE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1315 >ATOM 939 O OE2 . GLU A 1 118 ? 29.956 8.998 33.405 1.00 16.59 ? 118 GLU A OE2 1 >ATOM 512 C CD2 . PHE A 1 65 ? 12.947 24.706 35.070 1.00 11.23 ? 65 PHE A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1316 >ATOM 940 N N . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57 ? 119 LEU A N 1 >ATOM 513 C CE1 . PHE A 1 65 ? 12.441 22.329 36.413 1.00 11.00 ? 65 PHE A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1317 >ATOM 941 C CA . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94 ? 119 LEU A CA 1 >ATOM 514 C CE2 . PHE A 1 65 ? 13.847 23.645 34.984 1.00 11.69 ? 65 PHE A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1318 >ATOM 942 C C . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29 ? 119 LEU A C 1 >ATOM 515 C CZ . PHE A 1 65 ? 13.593 22.461 35.655 1.00 12.20 ? 65 PHE A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1319 >ATOM 943 O O . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23 ? 119 LEU A O 1 >ATOM 516 N N . LYS A 1 66 ? 9.599 25.560 38.713 1.00 13.15 ? 66 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1320 >ATOM 944 C CB . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83 ? 119 LEU A CB 1 >ATOM 517 C CA . LYS A 1 66 ? 9.251 24.735 39.849 1.00 13.41 ? 66 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1321 >ATOM 945 C CG . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54 ? 119 LEU A CG 1 >ATOM 518 C C . LYS A 1 66 ? 8.555 23.552 39.178 1.00 12.17 ? 66 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1322 >ATOM 946 C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 >ATOM 519 O O . LYS A 1 66 ? 7.763 23.747 38.251 1.00 12.93 ? 66 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1323 >ATOM 947 C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 >ATOM 520 C CB . LYS A 1 66 ? 8.313 25.498 40.800 1.00 16.68 ? 66 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1324 >ATOM 948 N N . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17 ? 120 ILE A N 1 >ATOM 521 C CG . LYS A 1 66 ? 7.722 24.639 41.907 1.00 24.60 ? 66 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1325 >ATOM 949 C CA . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22 ? 120 ILE A CA 1 >ATOM 522 C CD . LYS A 1 66 ? 7.391 25.453 43.165 1.00 28.53 ? 66 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1326 >ATOM 950 C C . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47 ? 120 ILE A C 1 >ATOM 523 C CE . LYS A 1 66 ? 6.664 24.585 44.213 1.00 32.17 ? 66 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1327 >ATOM 951 O O . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54 ? 120 ILE A O 1 >ATOM 524 N NZ . LYS A 1 66 ? 7.393 23.332 44.604 1.00 32.54 ? 66 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1328 >ATOM 952 C CB . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19 ? 120 ILE A CB 1 >ATOM 525 N N . VAL A 1 67 ? 8.918 22.329 39.562 1.00 11.82 ? 67 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1329 >ATOM 953 C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26 ? 120 ILE A CG1 1 >ATOM 526 C CA . VAL A 1 67 ? 8.295 21.141 38.975 1.00 10.93 ? 67 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1330 >ATOM 954 C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54 ? 120 ILE A CG2 1 >ATOM 527 C C . VAL A 1 67 ? 6.783 21.174 39.226 1.00 11.97 ? 67 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1331 >ATOM 955 C CD1 . ILE A 1 120 ? 21.668 8.658 30.600 1.00 9.35 ? 120 ILE A CD1 1 >ATOM 528 O O . VAL A 1 67 ? 6.343 21.480 40.342 1.00 13.54 ? 67 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1332 >ATOM 956 N N . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41 ? 121 LEU A N 1 >ATOM 529 C CB . VAL A 1 67 ? 8.908 19.827 39.541 1.00 10.09 ? 67 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1333 >ATOM 957 C CA . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25 ? 121 LEU A CA 1 >ATOM 530 C CG1 . VAL A 1 67 ? 8.271 18.617 38.883 1.00 10.96 ? 67 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1334 >ATOM 958 C C . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41 ? 121 LEU A C 1 >ATOM 531 C CG2 . VAL A 1 67 ? 10.410 19.808 39.320 1.00 10.21 ? 67 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1335 >ATOM 959 O O . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01 ? 121 LEU A O 1 >ATOM 532 N N . GLY A 1 68 ? 6.006 20.965 38.160 1.00 9.80 ? 68 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1336 >ATOM 960 C CB . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37 ? 121 LEU A CB 1 >ATOM 533 C CA . GLY A 1 68 ? 4.557 20.962 38.265 1.00 9.33 ? 68 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1337 >ATOM 961 C CG . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96 ? 121 LEU A CG 1 >ATOM 534 C C . GLY A 1 68 ? 3.887 22.298 38.031 1.00 10.60 ? 68 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1338 >ATOM 962 C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91 ? 121 LEU A CD1 1 >ATOM 535 O O . GLY A 1 68 ? 2.653 22.389 38.039 1.00 11.93 ? 68 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1339 >ATOM 963 C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96 ? 121 LEU A CD2 1 >ATOM 536 N N . GLU A 1 69 ? 4.688 23.337 37.809 1.00 11.12 ? 69 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1340 >ATOM 964 N N . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71 ? 122 THR A N 1 >ATOM 537 C CA . GLU A 1 69 ? 4.165 24.682 37.553 1.00 12.64 ? 69 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1341 >ATOM 965 C CA . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80 ? 122 THR A CA 1 >ATOM 538 C C . GLU A 1 69 ? 4.604 25.185 36.184 1.00 13.09 ? 69 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1342 >ATOM 966 C C . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58 ? 122 THR A C 1 >ATOM 539 O O . GLU A 1 69 ? 5.774 25.107 35.820 1.00 12.17 ? 69 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1343 >ATOM 967 O O . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21 ? 122 THR A O 1 >ATOM 540 C CB . GLU A 1 69 ? 4.578 25.642 38.668 1.00 12.20 ? 69 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1344 >ATOM 968 C CB . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51 ? 122 THR A CB 1 >ATOM 541 C CG . GLU A 1 69 ? 3.857 25.282 39.964 1.00 17.44 ? 69 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1345 >ATOM 969 O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27 ? 122 THR A OG1 1 >ATOM 542 C CD . GLU A 1 69 ? 4.116 26.211 41.138 1.00 21.02 ? 69 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1346 >ATOM 970 C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86 ? 122 THR A CG2 1 >ATOM 543 O OE1 . GLU A 1 69 ? 4.496 27.384 40.945 1.00 21.43 ? 69 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1347 >ATOM 971 N N . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87 ? 123 MET A N 1 >ATOM 544 O OE2 . GLU A 1 69 ? 3.902 25.753 42.282 1.00 23.44 ? 69 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1348 >ATOM 972 C CA . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22 ? 123 MET A CA 1 >ATOM 545 N N . GLU A 1 70 ? 3.633 25.622 35.397 1.00 14.53 ? 70 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1349 >ATOM 973 C C . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66 ? 123 MET A C 1 >ATOM 546 C CA . GLU A 1 70 ? 3.912 26.102 34.059 1.00 15.80 ? 70 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1350 >ATOM 974 O O . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09 ? 123 MET A O 1 >ATOM 547 C C . GLU A 1 70 ? 4.816 27.329 34.007 1.00 13.72 ? 70 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1351 >ATOM 975 C CB . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37 ? 123 MET A CB 1 >ATOM 548 O O . GLU A 1 70 ? 4.761 28.208 34.863 1.00 13.66 ? 70 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1352 >ATOM 976 C CG . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG 1 >ATOM 549 C CB . GLU A 1 70 ? 2.606 26.359 33.320 1.00 19.99 ? 70 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1353 >ATOM 977 S SD . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD 1 >ATOM 550 C CG . GLU A 1 70 ? 2.814 26.634 31.851 1.00 28.23 ? 70 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1354 >ATOM 978 C CE . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE 1 >ATOM 551 C CD . GLU A 1 70 ? 1.518 26.678 31.097 1.00 32.73 ? 70 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1355 >ATOM 979 N N . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20 ? 124 THR A N 1 >ATOM 552 O OE1 . GLU A 1 70 ? 0.975 25.589 30.789 1.00 35.76 ? 70 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1356 >ATOM 980 C CA . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54 ? 124 THR A CA 1 >ATOM 553 O OE2 . GLU A 1 70 ? 1.045 27.802 30.823 1.00 35.75 ? 70 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1357 >ATOM 981 C C . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C 1 >ATOM 554 N N . PHE A 1 71 ? 5.713 27.340 33.028 1.00 12.80 ? 71 PHE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1358 >ATOM 982 O O . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54 ? 124 THR A O 1 >ATOM 555 C CA . PHE A 1 71 ? 6.638 28.448 32.837 1.00 12.36 ? 71 PHE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1359 >ATOM 983 C CB . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB 1 >ATOM 556 C C . PHE A 1 71 ? 6.856 28.678 31.350 1.00 12.97 ? 71 PHE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1360 >ATOM 984 O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 >ATOM 557 O O . PHE A 1 71 ? 6.382 27.917 30.516 1.00 12.54 ? 71 PHE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1361 >ATOM 985 C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 >ATOM 558 C CB . PHE A 1 71 ? 7.975 28.243 33.589 1.00 10.02 ? 71 PHE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1362 >ATOM 986 N N . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N 1 >ATOM 559 C CG . PHE A 1 71 ? 8.851 27.148 33.033 1.00 10.48 ? 71 PHE A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1363 >ATOM 987 C CA . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA 1 >ATOM 560 C CD1 . PHE A 1 71 ? 8.549 25.815 33.256 1.00 9.95 ? 71 PHE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1364 >ATOM 988 C C . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C 1 >ATOM 561 C CD2 . PHE A 1 71 ? 10.006 27.459 32.331 1.00 9.29 ? 71 PHE A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1365 >ATOM 989 O O . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O 1 >ATOM 562 C CE1 . PHE A 1 71 ? 9.380 24.811 32.793 1.00 9.74 ? 71 PHE A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1366 >ATOM 990 C CB . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB 1 >ATOM 563 C CE2 . PHE A 1 71 ? 10.832 26.464 31.868 1.00 9.51 ? 71 PHE A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1367 >ATOM 991 N N . ASP A 1 126 ? 9.664 15.754 17.216 1.00 14.63 ? 126 ASP A N 1 >ATOM 564 C CZ . PHE A 1 71 ? 10.518 25.136 32.102 1.00 8.47 ? 71 PHE A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1368 >ATOM 992 C CA . ASP A 1 126 ? 8.901 14.721 16.536 1.00 17.86 ? 126 ASP A CA 1 >ATOM 565 N N . GLU A 1 72 ? 7.581 29.733 31.028 1.00 15.04 ? 72 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1369 >ATOM 993 C C . ASP A 1 126 ? 9.512 13.364 16.905 1.00 18.66 ? 126 ASP A C 1 >ATOM 566 C CA . GLU A 1 72 ? 7.826 30.063 29.644 1.00 17.19 ? 72 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1370 >ATOM 994 O O . ASP A 1 126 ? 9.519 13.006 18.080 1.00 19.38 ? 126 ASP A O 1 >ATOM 567 C C . GLU A 1 72 ? 9.323 30.036 29.357 1.00 15.53 ? 72 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1371 >ATOM 995 C CB . ASP A 1 126 ? 8.835 14.982 15.023 1.00 18.40 ? 126 ASP A CB 1 >ATOM 568 O O . GLU A 1 72 ? 10.130 30.511 30.158 1.00 16.16 ? 72 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1372 >ATOM 996 C CG . ASP A 1 126 ? 7.786 16.032 14.660 1.00 22.34 ? 126 ASP A CG 1 >ATOM 569 C CB . GLU A 1 72 ? 7.248 31.448 29.379 1.00 22.03 ? 72 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1373 >ATOM 997 O OD1 . ASP A 1 126 ? 6.800 16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 >ATOM 570 C CG . GLU A 1 72 ? 6.700 31.658 28.002 1.00 30.80 ? 72 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1374 >ATOM 998 O OD2 . ASP A 1 126 ? 7.940 16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 >ATOM 571 C CD . GLU A 1 72 ? 6.157 33.060 27.827 1.00 34.75 ? 72 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1375 >ATOM 999 N N . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N 1 >ATOM 572 O OE1 . GLU A 1 72 ? 5.014 33.309 28.276 1.00 35.88 ? 72 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1376 >ATOM 1000 C CA . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA 1 >ATOM 573 O OE2 . GLU A 1 72 ? 6.885 33.912 27.255 1.00 38.91 ? 72 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1377 >ATOM 1001 C C . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C 1 >ATOM 574 N N . GLU A 1 73 ? 9.691 29.378 28.263 1.00 13.46 ? 73 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1378 >ATOM 1002 O O . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O 1 >ATOM 575 C CA . GLU A 1 73 ? 11.088 29.302 27.836 1.00 13.89 ? 73 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1379 >ATOM 1003 C CB . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB 1 >ATOM 576 C C . GLU A 1 73 ? 11.083 29.318 26.301 1.00 13.70 ? 73 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1380 >ATOM 1004 C CG . ASP A 1 127 ? 9.043 9.450 15.880 1.00 33.21 ? 127 ASP A CG 1 >ATOM 577 O O . GLU A 1 73 ? 10.159 29.859 25.690 1.00 13.63 ? 73 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1381 >ATOM 1005 O OD1 . ASP A 1 127 ? 7.892 9.959 15.934 1.00 36.08 ? 127 ASP A OD1 1 >ATOM 578 C CB . GLU A 1 73 ? 11.780 28.032 28.379 1.00 12.63 ? 73 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1382 >ATOM 1006 O OD2 . ASP A 1 127 ? 9.318 8.308 16.318 1.00 38.35 ? 127 ASP A OD2 1 >ATOM 579 C CG . GLU A 1 73 ? 11.145 26.706 27.986 1.00 10.55 ? 73 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1383 >ATOM 1007 N N . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N 1 >ATOM 580 C CD . GLU A 1 73 ? 11.997 25.499 28.366 1.00 8.94 ? 73 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1384 >ATOM 1008 C CA . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA 1 >ATOM 581 O OE1 . GLU A 1 73 ? 13.191 25.650 28.642 1.00 12.29 ? 73 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1385 >ATOM 1009 C C . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C 1 >ATOM 582 O OE2 . GLU A 1 73 ? 11.485 24.374 28.363 1.00 10.37 ? 73 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1386 >ATOM 1010 O O . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74 ? 128 VAL A O 1 >ATOM 583 N N . GLN A 1 74 ? 12.115 28.751 25.685 1.00 13.09 ? 74 GLN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1387 >ATOM 1011 C CB . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB 1 >ATOM 584 C CA . GLN A 1 74 ? 12.187 28.691 24.239 1.00 13.16 ? 74 GLN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1388 >ATOM 1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 >ATOM 585 C C . GLN A 1 74 ? 12.618 27.315 23.806 1.00 12.86 ? 74 GLN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1389 >ATOM 1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 >ATOM 586 O O . GLN A 1 74 ? 13.290 26.596 24.552 1.00 13.17 ? 74 GLN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1390 >ATOM 1014 N N . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29 ? 129 VAL A N 1 >ATOM 587 C CB . GLN A 1 74 ? 13.218 29.685 23.706 1.00 15.91 ? 74 GLN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1391 >ATOM 1015 C CA . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95 ? 129 VAL A CA 1 >ATOM 588 C CG . GLN A 1 74 ? 12.803 31.133 23.779 1.00 19.68 ? 74 GLN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1392 >ATOM 1016 C C . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49 ? 129 VAL A C 1 >ATOM 589 C CD . GLN A 1 74 ? 13.827 32.066 23.159 1.00 21.00 ? 74 GLN A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1393 >ATOM 1017 O O . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73 ? 129 VAL A O 1 >ATOM 590 O OE1 . GLN A 1 74 ? 15.010 31.730 23.024 1.00 22.37 ? 74 GLN A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1394 >ATOM 1018 C CB . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43 ? 129 VAL A CB 1 >ATOM 591 N NE2 . GLN A 1 74 ? 13.373 33.247 22.774 1.00 24.07 ? 74 GLN A NE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1395 >ATOM 1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09 ? 129 VAL A CG1 1 >ATOM 592 N N . THR A 1 75 ? 12.229 26.935 22.600 1.00 10.98 ? 75 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1396 >ATOM 1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45 ? 129 VAL A CG2 1 >ATOM 593 C CA . THR A 1 75 ? 12.664 25.656 22.056 1.00 11.83 ? 75 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1397 >ATOM 1021 N N . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54 ? 130 CYS A N 1 >ATOM 594 C C . THR A 1 75 ? 14.162 25.828 21.729 1.00 11.24 ? 75 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1398 >ATOM 1022 C CA . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47 ? 130 CYS A CA 1 >ATOM 595 O O . THR A 1 75 ? 14.681 26.951 21.764 1.00 9.95 ? 75 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1399 >ATOM 1023 C C . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61 ? 130 CYS A C 1 >ATOM 596 C CB . THR A 1 75 ? 11.895 25.325 20.757 1.00 11.93 ? 75 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1400 >ATOM 1024 O O . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53 ? 130 CYS A O 1 >ATOM 597 O OG1 . THR A 1 75 ? 12.123 26.366 19.795 1.00 13.31 ? 75 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1401 >ATOM 1025 C CB . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05 ? 130 CYS A CB 1 >ATOM 598 C CG2 . THR A 1 75 ? 10.396 25.202 21.042 1.00 13.29 ? 75 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1402 >ATOM 1026 S SG . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82 ? 130 CYS A SG 1 >ATOM 599 N N . VAL A 1 76 ? 14.841 24.731 21.377 1.00 13.77 ? 76 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1403 >ATOM 1027 N N . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58 ? 131 THR A N 1 >ATOM 600 C CA . VAL A 1 76 ? 16.278 24.762 21.049 1.00 14.39 ? 76 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1404 >ATOM 1028 C CA . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93 ? 131 THR A CA 1 >ATOM 601 C C . VAL A 1 76 ? 16.612 25.734 19.914 1.00 12.97 ? 76 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1405 >ATOM 1029 C C . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18 ? 131 THR A C 1 >ATOM 602 O O . VAL A 1 76 ? 17.639 26.407 19.956 1.00 13.75 ? 76 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1406 >ATOM 1030 O O . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77 ? 131 THR A O 1 >ATOM 603 C CB . VAL A 1 76 ? 16.827 23.351 20.680 1.00 15.44 ? 76 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1407 >ATOM 1031 C CB . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63 ? 131 THR A CB 1 >ATOM 604 C CG1 . VAL A 1 76 ? 18.332 23.314 20.844 1.00 17.74 ? 76 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1408 >ATOM 1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60 ? 131 THR A OG1 1 >ATOM 605 C CG2 . VAL A 1 76 ? 16.218 22.293 21.548 1.00 19.99 ? 76 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1409 >ATOM 1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76 ? 131 THR A CG2 1 >ATOM 606 N N . ASP A 1 77 ? 15.730 25.824 18.921 1.00 13.67 ? 77 ASP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1410 >ATOM 1034 N N . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29 ? 132 ARG A N 1 >ATOM 607 C CA . ASP A 1 77 ? 15.933 26.727 17.789 1.00 14.47 ? 77 ASP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1411 >ATOM 1035 C CA . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67 ? 132 ARG A CA 1 >ATOM 608 C C . ASP A 1 77 ? 15.486 28.172 18.061 1.00 15.23 ? 77 ASP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1412 >ATOM 1036 C C . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19 ? 132 ARG A C 1 >ATOM 609 O O . ASP A 1 77 ? 15.461 29.002 17.153 1.00 14.90 ? 77 ASP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1413 >ATOM 1037 O O . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65 ? 132 ARG A O 1 >ATOM 610 C CB . ASP A 1 77 ? 15.301 26.158 16.503 1.00 15.63 ? 77 ASP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1414 >ATOM 1038 C CB . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67 ? 132 ARG A CB 1 >ATOM 611 C CG . ASP A 1 77 ? 13.790 26.007 16.585 1.00 15.92 ? 77 ASP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1415 >ATOM 1039 C CG . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG 1 >ATOM 612 O OD1 . ASP A 1 77 ? 13.260 25.470 17.586 1.00 14.64 ? 77 ASP A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1416 >ATOM 1040 C CD . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD 1 >ATOM 613 O OD2 . ASP A 1 77 ? 13.123 26.409 15.613 1.00 17.79 ? 77 ASP A OD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1417 >ATOM 1041 N NE . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE 1 >ATOM 614 N N . GLY A 1 78 ? 15.095 28.445 19.312 1.00 15.17 ? 78 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1418 >ATOM 1042 C CZ . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ 1 >ATOM 615 C CA . GLY A 1 78 ? 14.709 29.790 19.726 1.00 15.90 ? 78 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1419 >ATOM 1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 >ATOM 616 C C . GLY A 1 78 ? 13.268 30.281 19.701 1.00 16.89 ? 78 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1420 >ATOM 1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 >ATOM 617 O O . GLY A 1 78 ? 13.038 31.489 19.790 1.00 19.37 ? 78 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1421 >ATOM 1045 N N . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99 ? 133 VAL A N 1 >ATOM 618 N N . ARG A 1 79 ? 12.292 29.389 19.620 1.00 16.76 ? 79 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1422 >ATOM 1046 C CA . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92 ? 133 VAL A CA 1 >ATOM 619 C CA . ARG A 1 79 ? 10.896 29.822 19.587 1.00 18.08 ? 79 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1423 >ATOM 1047 C C . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85 ? 133 VAL A C 1 >ATOM 620 C C . ARG A 1 79 ? 10.229 29.768 20.961 1.00 16.55 ? 79 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1424 >ATOM 1048 O O . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50 ? 133 VAL A O 1 >ATOM 621 O O . ARG A 1 79 ? 10.379 28.787 21.680 1.00 16.57 ? 79 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1425 >ATOM 1049 C CB . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37 ? 133 VAL A CB 1 >ATOM 622 C CB . ARG A 1 79 ? 10.112 28.961 18.604 1.00 20.74 ? 79 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1426 >ATOM 1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95 ? 133 VAL A CG1 1 >ATOM 623 C CG . ARG A 1 79 ? 10.667 28.997 17.194 1.00 25.89 ? 79 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1427 >ATOM 1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46 ? 133 VAL A CG2 1 >ATOM 624 C CD . ARG A 1 79 ? 9.986 27.976 16.310 1.00 29.77 ? 79 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1428 >ATOM 1052 N N . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35 ? 134 TYR A N 1 >ATOM 625 N NE . ARG A 1 79 ? 10.144 26.626 16.842 1.00 34.52 ? 79 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1429 >ATOM 1053 C CA . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57 ? 134 TYR A CA 1 >ATOM 626 C CZ . ARG A 1 79 ? 10.128 25.516 16.109 1.00 35.90 ? 79 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1430 >ATOM 1054 C C . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30 ? 134 TYR A C 1 >ATOM 627 N NH1 . ARG A 1 79 ? 9.971 25.580 14.789 1.00 37.70 ? 79 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1431 >ATOM 1055 O O . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92 ? 134 TYR A O 1 >ATOM 628 N NH2 . ARG A 1 79 ? 10.266 24.337 16.702 1.00 35.58 ? 79 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1432 >ATOM 1056 C CB . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84 ? 134 TYR A CB 1 >ATOM 629 N N . PRO A 1 80 ? 9.501 30.830 21.352 1.00 15.98 ? 80 PRO A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1433 >ATOM 1057 C CG . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89 ? 134 TYR A CG 1 >ATOM 630 C CA . PRO A 1 80 ? 8.819 30.867 22.651 1.00 15.47 ? 80 PRO A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1434 >ATOM 1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 >ATOM 631 C C . PRO A 1 80 ? 7.825 29.725 22.833 1.00 14.23 ? 80 PRO A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1435 >ATOM 1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 >ATOM 632 O O . PRO A 1 80 ? 7.058 29.393 21.926 1.00 14.56 ? 80 PRO A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1436 >ATOM 1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 >ATOM 633 C CB . PRO A 1 80 ? 8.100 32.220 22.628 1.00 15.48 ? 80 PRO A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1437 >ATOM 1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 >ATOM 634 C CG . PRO A 1 80 ? 9.010 33.057 21.846 1.00 18.18 ? 80 PRO A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1438 >ATOM 1062 C CZ . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ 1 >ATOM 635 C CD . PRO A 1 80 ? 9.418 32.145 20.696 1.00 17.08 ? 80 PRO A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1439 >ATOM 1063 O OH . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH 1 >ATOM 636 N N . CYS A 1 81 ? 7.817 29.148 24.028 1.00 13.52 ? 81 CYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1440 >ATOM 1064 N N . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63 ? 135 VAL A N 1 >ATOM 637 C CA . CYS A 1 81 ? 6.914 28.055 24.331 1.00 12.41 ? 81 CYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1441 >ATOM 1065 C CA . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42 ? 135 VAL A CA 1 >ATOM 638 C C . CYS A 1 81 ? 6.548 28.054 25.811 1.00 12.52 ? 81 CYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1442 >ATOM 1066 C C . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05 ? 135 VAL A C 1 >ATOM 639 O O . CYS A 1 81 ? 7.202 28.718 26.624 1.00 11.74 ? 81 CYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1443 >ATOM 1067 O O . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02 ? 135 VAL A O 1 >ATOM 640 C CB . CYS A 1 81 ? 7.563 26.705 23.950 1.00 11.59 ? 81 CYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1444 >ATOM 1068 C CB . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05 ? 135 VAL A CB 1 >ATOM 641 S SG . CYS A 1 81 ? 9.063 26.255 24.894 1.00 12.86 ? 81 CYS A SG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1445 >ATOM 1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27 ? 135 VAL A CG1 1 >ATOM 642 N N . LYS A 1 82 ? 5.448 27.379 26.121 1.00 13.86 ? 82 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1446 >ATOM 1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 >ATOM 643 C CA . LYS A 1 82 ? 4.988 27.197 27.492 1.00 14.38 ? 82 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1447 >ATOM 1071 N N . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57 ? 136 ARG A N 1 >ATOM 644 C C . LYS A 1 82 ? 5.436 25.779 27.839 1.00 13.51 ? 82 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1448 >ATOM 1072 C CA . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA 1 >ATOM 645 O O . LYS A 1 82 ? 5.227 24.842 27.063 1.00 12.69 ? 82 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1449 >ATOM 1073 C C . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C 1 >ATOM 646 C CB . LYS A 1 82 ? 3.473 27.299 27.589 1.00 18.36 ? 82 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1450 >ATOM 1074 O O . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O 1 >ATOM 647 C CG . LYS A 1 82 ? 2.940 28.716 27.584 1.00 26.02 ? 82 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1451 >ATOM 1075 C CB . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB 1 >ATOM 648 C CD . LYS A 1 82 ? 3.353 29.506 28.826 1.00 31.13 ? 82 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1452 >ATOM 1076 C CG . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG 1 >ATOM 649 C CE . LYS A 1 82 ? 2.686 30.894 28.832 1.00 35.39 ? 82 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1453 >ATOM 1077 C CD . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD 1 >ATOM 650 N NZ . LYS A 1 82 ? 2.868 31.652 30.120 1.00 37.63 ? 82 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1454 >ATOM 1078 N NE . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE 1 >ATOM 651 N N . SER A 1 83 ? 6.110 25.638 28.974 1.00 11.15 ? 83 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1455 >ATOM 1079 C CZ . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ 1 >ATOM 652 C CA . SER A 1 83 ? 6.624 24.352 29.397 1.00 10.10 ? 83 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1456 >ATOM 1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 >ATOM 653 C C . SER A 1 83 ? 6.083 23.931 30.752 1.00 11.16 ? 83 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1457 >ATOM 1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 >ATOM 654 O O . SER A 1 83 ? 5.721 24.769 31.575 1.00 10.21 ? 83 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1458 >ATOM 1082 N N . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N 1 >ATOM 655 C CB . SER A 1 83 ? 8.149 24.418 29.446 1.00 10.30 ? 83 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1459 >ATOM 1083 C CA . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA 1 >ATOM 656 O OG . SER A 1 83 ? 8.686 24.518 28.132 1.00 11.50 ? 83 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1460 >ATOM 1084 C C . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C 1 >ATOM 657 N N . LEU A 1 84 ? 6.028 22.620 30.954 1.00 11.17 ? 84 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1461 >ATOM 1085 O O . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O 1 >ATOM 658 C CA . LEU A 1 84 ? 5.557 22.016 32.192 1.00 11.84 ? 84 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1462 >ATOM 1086 C CB . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB 1 >ATOM 659 C C . LEU A 1 84 ? 6.427 20.793 32.470 1.00 10.42 ? 84 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1463 >ATOM 1087 C CG . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG 1 >ATOM 660 O O . LEU A 1 84 ? 6.444 19.846 31.684 1.00 11.20 ? 84 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1464 >ATOM 1088 C CD . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD 1 >ATOM 661 C CB . LEU A 1 84 ? 4.091 21.576 32.067 1.00 13.44 ? 84 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1465 >ATOM 1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 >ATOM 662 C CG . LEU A 1 84 ? 3.552 20.784 33.270 1.00 15.74 ? 84 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1466 >ATOM 1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 >ATOM 663 C CD1 . LEU A 1 84 ? 3.515 21.683 34.484 1.00 16.96 ? 84 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1467 >ATOM 1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 >ATOM 664 C CD2 . LEU A 1 84 ? 2.178 20.231 32.982 1.00 18.76 ? 84 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1468 >HETATM 1092 C C1 . REA B 2 . ? 21.972 29.831 16.739 1.00 15.25 ? 200 REA A C1 1 >ATOM 665 N N . VAL A 1 85 ? 7.146 20.828 33.589 1.00 9.60 ? 85 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1469 >HETATM 1093 C C2 . REA B 2 . ? 20.921 30.524 15.841 1.00 15.61 ? 200 REA A C2 1 >ATOM 666 C CA . VAL A 1 85 ? 8.028 19.738 34.006 1.00 9.50 ? 85 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1470 >HETATM 1094 C C3 . REA B 2 . ? 20.245 29.635 14.848 1.00 16.19 ? 200 REA A C3 1 >ATOM 667 C C . VAL A 1 85 ? 7.344 18.878 35.082 1.00 9.74 ? 85 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1471 >HETATM 1095 C C4 . REA B 2 . ? 19.555 28.479 15.488 1.00 14.59 ? 200 REA A C4 1 >ATOM 668 O O . VAL A 1 85 ? 6.680 19.404 35.985 1.00 9.28 ? 85 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1472 >HETATM 1096 C C5 . REA B 2 . ? 20.389 27.812 16.587 1.00 14.10 ? 200 REA A C5 1 >ATOM 669 C CB . VAL A 1 85 ? 9.384 20.291 34.598 1.00 8.89 ? 85 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1473 >HETATM 1097 C C6 . REA B 2 . ? 21.425 28.446 17.218 1.00 14.42 ? 200 REA A C6 1 >ATOM 670 C CG1 . VAL A 1 85 ? 10.327 19.140 34.970 1.00 8.20 ? 85 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1474 >HETATM 1098 C C7 . REA B 2 . ? 22.242 27.851 18.297 1.00 13.89 ? 200 REA A C7 1 >ATOM 671 C CG2 . VAL A 1 85 ? 10.062 21.227 33.612 1.00 8.48 ? 85 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1475 >HETATM 1099 C C8 . REA B 2 . ? 21.868 26.977 19.240 1.00 11.86 ? 200 REA A C8 1 >ATOM 672 N N . LYS A 1 86 ? 7.504 17.563 34.971 1.00 9.96 ? 86 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1476 >HETATM 1100 C C9 . REA B 2 . ? 22.705 26.434 20.286 1.00 10.87 ? 200 REA A C9 1 >ATOM 673 C CA . LYS A 1 86 ? 6.946 16.621 35.945 1.00 11.92 ? 86 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1477 >HETATM 1101 C C10 . REA B 2 . ? 22.159 25.536 21.131 1.00 9.19 ? 200 REA A C10 1 >ATOM 674 C C . LYS A 1 86 ? 8.003 15.558 36.247 1.00 11.88 ? 86 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1478 >HETATM 1102 C C11 . REA B 2 . ? 22.875 24.924 22.234 1.00 10.35 ? 200 REA A C11 1 >ATOM 675 O O . LYS A 1 86 ? 8.917 15.340 35.453 1.00 11.00 ? 86 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1479 >HETATM 1103 C C12 . REA B 2 . ? 22.237 24.026 22.990 1.00 10.53 ? 200 REA A C12 1 >ATOM 676 C CB . LYS A 1 86 ? 5.700 15.911 35.385 1.00 12.40 ? 86 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1480 >HETATM 1104 C C13 . REA B 2 . ? 22.856 23.377 24.125 1.00 10.91 ? 200 REA A C13 1 >ATOM 677 C CG . LYS A 1 86 ? 4.538 16.819 35.058 1.00 16.01 ? 86 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1481 >HETATM 1105 C C14 . REA B 2 . ? 22.135 22.473 24.834 1.00 11.88 ? 200 REA A C14 1 >ATOM 678 C CD . LYS A 1 86 ? 3.333 16.017 34.559 1.00 21.36 ? 86 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1482 >HETATM 1106 C C15 . REA B 2 . ? 22.563 21.710 26.016 1.00 14.86 ? 200 REA A C15 1 >ATOM 679 C CE . LYS A 1 86 ? 2.140 16.939 34.345 1.00 23.23 ? 86 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1483 >HETATM 1107 C C16 . REA B 2 . ? 22.238 30.737 17.948 1.00 15.47 ? 200 REA A C16 1 >ATOM 680 N NZ . LYS A 1 86 ? 0.919 16.212 33.929 1.00 28.41 ? 86 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1484 >HETATM 1108 C C17 . REA B 2 . ? 23.292 29.620 15.948 1.00 13.42 ? 200 REA A C17 1 >ATOM 681 N N . TRP A 1 87 ? 7.868 14.889 37.386 1.00 10.75 ? 87 TRP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1485 >HETATM 1109 C C18 . REA B 2 . ? 19.791 26.449 16.947 1.00 12.61 ? 200 REA A C18 1 >ATOM 682 C CA . TRP A 1 87 ? 8.775 13.811 37.738 1.00 9.53 ? 87 TRP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1486 >HETATM 1110 C C19 . REA B 2 . ? 24.181 26.841 20.385 1.00 10.08 ? 200 REA A C19 1 >ATOM 683 C C . TRP A 1 87 ? 8.238 12.559 37.052 1.00 9.89 ? 87 TRP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1487 >HETATM 1111 C C20 . REA B 2 . ? 24.303 23.747 24.489 1.00 10.10 ? 200 REA A C20 1 >ATOM 684 O O . TRP A 1 87 ? 7.144 12.107 37.370 1.00 11.80 ? 87 TRP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1488 >HETATM 1112 O O1 . REA B 2 . ? 23.640 21.075 25.978 1.00 13.29 ? 200 REA A O1 1 >ATOM 685 C CB . TRP A 1 87 ? 8.791 13.569 39.268 1.00 8.76 ? 87 TRP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1489 >HETATM 1113 O O2 . REA B 2 . ? 21.840 21.712 27.037 1.00 10.99 ? 200 REA A O2 1 >ATOM 686 C CG . TRP A 1 87 ? 9.494 14.641 40.062 1.00 8.86 ? 87 TRP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1490 >HETATM 1114 O O . HOH C 3 . ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O 1 >ATOM 687 C CD1 . TRP A 1 87 ? 8.923 15.525 40.939 1.00 8.80 ? 87 TRP A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1491 >HETATM 1115 O O . HOH C 3 . ? 7.617 26.892 37.107 1.00 12.66 ? 301 HOH A O 1 >ATOM 688 C CD2 . TRP A 1 87 ? 10.889 14.990 39.992 1.00 9.42 ? 87 TRP A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1492 >HETATM 1116 O O . HOH C 3 . ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O 1 >ATOM 689 N NE1 . TRP A 1 87 ? 9.872 16.410 41.400 1.00 8.01 ? 87 TRP A NE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1493 >HETATM 1117 O O . HOH C 3 . ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O 1 >ATOM 690 C CE2 . TRP A 1 87 ? 11.086 16.103 40.835 1.00 10.85 ? 87 TRP A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1494 >HETATM 1118 O O . HOH C 3 . ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O 1 >ATOM 691 C CE3 . TRP A 1 87 ? 11.985 14.475 39.283 1.00 9.60 ? 87 TRP A CE3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1495 >HETATM 1119 O O . HOH C 3 . ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O 1 >ATOM 692 C CZ2 . TRP A 1 87 ? 12.340 16.716 40.994 1.00 11.45 ? 87 TRP A CZ2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1496 >HETATM 1120 O O . HOH C 3 . ? 19.459 26.601 30.320 1.00 9.81 ? 306 HOH A O 1 >ATOM 693 C CZ3 . TRP A 1 87 ? 13.230 15.084 39.438 1.00 10.72 ? 87 TRP A CZ3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1497 >HETATM 1121 O O . HOH C 3 . ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O 1 >ATOM 694 C CH2 . TRP A 1 87 ? 13.395 16.192 40.289 1.00 11.78 ? 87 TRP A CH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1498 >HETATM 1122 O O . HOH C 3 . ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O 1 >ATOM 695 N N . GLU A 1 88 ? 8.954 12.040 36.064 1.00 9.93 ? 88 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1499 >HETATM 1123 O O . HOH C 3 . ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O 1 >ATOM 696 C CA . GLU A 1 88 ? 8.526 10.807 35.416 1.00 11.30 ? 88 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1500 >HETATM 1124 O O . HOH C 3 . ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O 1 >ATOM 697 C C . GLU A 1 88 ? 8.826 9.726 36.448 1.00 11.75 ? 88 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1501 >HETATM 1125 O O . HOH C 3 . ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O 1 >ATOM 698 O O . GLU A 1 88 ? 8.068 8.784 36.623 1.00 12.78 ? 88 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1502 >HETATM 1126 O O . HOH C 3 . ? 7.344 23.059 35.600 1.00 8.82 ? 312 HOH A O 1 >ATOM 699 C CB . GLU A 1 88 ? 9.337 10.541 34.156 1.00 13.50 ? 88 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1503 >HETATM 1127 O O . HOH C 3 . ? 6.876 22.668 20.375 1.00 29.74 ? 313 HOH A O 1 >ATOM 700 C CG . GLU A 1 88 ? 8.917 9.261 33.454 1.00 18.67 ? 88 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1504 >HETATM 1128 O O . HOH C 3 . ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O 1 >ATOM 701 C CD . GLU A 1 88 ? 9.756 8.958 32.226 1.00 23.49 ? 88 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1505 >HETATM 1129 O O . HOH C 3 . ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O 1 >ATOM 702 O OE1 . GLU A 1 88 ? 9.581 9.650 31.205 1.00 26.53 ? 88 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1506 >HETATM 1130 O O . HOH C 3 . ? 28.721 7.425 30.043 1.00 14.94 ? 316 HOH A O 1 >ATOM 703 O OE2 . GLU A 1 88 ? 10.587 8.025 32.276 1.00 26.54 ? 88 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1507 >HETATM 1131 O O . HOH C 3 . ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O 1 >ATOM 704 N N . SER A 1 89 ? 9.972 9.870 37.103 1.00 11.49 ? 89 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1508 >HETATM 1132 O O . HOH C 3 . ? 6.094 9.777 39.151 1.00 13.98 ? 318 HOH A O 1 >ATOM 705 C CA . SER A 1 89 ? 10.402 8.954 38.158 1.00 11.10 ? 89 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1509 >HETATM 1133 O O . HOH C 3 . ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O 1 >ATOM 706 C C . SER A 1 89 ? 11.206 9.776 39.163 1.00 11.14 ? 89 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1510 >HETATM 1134 O O . HOH C 3 . ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O 1 >ATOM 707 O O . SER A 1 89 ? 11.397 10.983 38.979 1.00 9.92 ? 89 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1511 >HETATM 1135 O O . HOH C 3 . ? 25.244 34.269 18.193 1.00 9.65 ? 321 HOH A O 1 >ATOM 708 C CB . SER A 1 89 ? 11.221 7.778 37.604 1.00 12.43 ? 89 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1512 >HETATM 1136 O O . HOH C 3 . ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O 1 >ATOM 709 O OG . SER A 1 89 ? 12.396 8.215 36.947 1.00 14.39 ? 89 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1513 >HETATM 1137 O O . HOH C 3 . ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O 1 >ATOM 710 N N . GLU A 1 90 ? 11.674 9.130 40.227 1.00 10.17 ? 90 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1514 >HETATM 1138 O O . HOH C 3 . ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O 1 >ATOM 711 C CA . GLU A 1 90 ? 12.433 9.826 41.254 1.00 10.83 ? 90 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1515 >HETATM 1139 O O . HOH C 3 . ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O 1 >ATOM 712 C C . GLU A 1 90 ? 13.657 10.629 40.772 1.00 9.86 ? 90 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1516 >HETATM 1140 O O . HOH C 3 . ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O 1 >ATOM 713 O O . GLU A 1 90 ? 13.932 11.715 41.289 1.00 10.30 ? 90 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1517 >HETATM 1141 O O . HOH C 3 . ? 4.514 21.426 18.685 1.00 45.94 ? 327 HOH A O 1 >ATOM 714 C CB . GLU A 1 90 ? 12.858 8.846 42.348 1.00 11.92 ? 90 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1518 >HETATM 1142 O O . HOH C 3 . ? 8.081 23.201 17.690 1.00 30.16 ? 328 HOH A O 1 >ATOM 715 C CG . GLU A 1 90 ? 13.536 9.572 43.487 1.00 16.53 ? 90 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1519 >HETATM 1143 O O . HOH C 3 . ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O 1 >ATOM 716 C CD . GLU A 1 90 ? 13.912 8.671 44.644 1.00 19.80 ? 90 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1520 >HETATM 1144 O O . HOH C 3 . ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O 1 >ATOM 717 O OE1 . GLU A 1 90 ? 14.122 7.464 44.426 1.00 21.18 ? 90 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1521 >HETATM 1145 O O . HOH C 3 . ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O 1 >ATOM 718 O OE2 . GLU A 1 90 ? 14.012 9.187 45.774 1.00 22.91 ? 90 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1522 >HETATM 1146 O O . HOH C 3 . ? 5.189 16.418 31.375 1.00 35.78 ? 332 HOH A O 1 >ATOM 719 N N . ASN A 1 91 ? 14.376 10.102 39.783 1.00 8.79 ? 91 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1523 >HETATM 1147 O O . HOH C 3 . ? 0.738 25.633 36.349 1.00 29.00 ? 333 HOH A O 1 >ATOM 720 C CA . ASN A 1 91 ? 15.578 10.767 39.274 1.00 10.50 ? 91 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1524 >HETATM 1148 O O . HOH C 3 . ? 2.976 28.966 37.321 1.00 40.14 ? 334 HOH A O 1 >ATOM 721 C C . ASN A 1 91 ? 15.455 11.289 37.855 1.00 9.69 ? 91 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1525 >HETATM 1149 O O . HOH C 3 . ? 6.424 28.750 38.849 1.00 32.17 ? 335 HOH A O 1 >ATOM 722 O O . ASN A 1 91 ? 16.467 11.627 37.246 1.00 7.10 ? 91 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1526 >HETATM 1150 O O . HOH C 3 . ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O 1 >ATOM 723 C CB . ASN A 1 91 ? 16.760 9.798 39.305 1.00 14.33 ? 91 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1527 >HETATM 1151 O O . HOH C 3 . ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O 1 >ATOM 724 C CG . ASN A 1 91 ? 17.064 9.307 40.693 1.00 17.71 ? 91 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1528 >HETATM 1152 O O . HOH C 3 . ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O 1 >ATOM 725 O OD1 . ASN A 1 91 ? 17.445 10.087 41.560 1.00 20.87 ? 91 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1529 >HETATM 1153 O O . HOH C 3 . ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O 1 >ATOM 726 N ND2 . ASN A 1 91 ? 16.855 8.016 40.928 1.00 19.39 ? 91 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1530 >HETATM 1154 O O . HOH C 3 . ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O 1 >ATOM 727 N N . LYS A 1 92 ? 14.230 11.387 37.352 1.00 8.60 ? 92 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1531 >HETATM 1155 O O . HOH C 3 . ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O 1 >ATOM 728 C CA . LYS A 1 92 ? 14.016 11.835 35.981 1.00 8.88 ? 92 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1532 >HETATM 1156 O O . HOH C 3 . ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O 1 >ATOM 729 C C . LYS A 1 92 ? 12.861 12.812 35.807 1.00 8.61 ? 92 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1533 >HETATM 1157 O O . HOH C 3 . ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O 1 >ATOM 730 O O . LYS A 1 92 ? 11.721 12.511 36.168 1.00 8.95 ? 92 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1534 >HETATM 1158 O O . HOH C 3 . ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O 1 >ATOM 731 C CB . LYS A 1 92 ? 13.781 10.626 35.078 1.00 9.10 ? 92 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1535 >HETATM 1159 O O . HOH C 3 . ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O 1 >ATOM 732 C CG . LYS A 1 92 ? 13.566 10.996 33.618 1.00 11.95 ? 92 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1536 >HETATM 1160 O O . HOH C 3 . ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O 1 >ATOM 733 C CD . LYS A 1 92 ? 13.467 9.762 32.759 1.00 14.04 ? 92 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1537 >HETATM 1161 O O . HOH C 3 . ? 3.502 22.911 43.083 1.00 30.15 ? 347 HOH A O 1 >ATOM 734 C CE . LYS A 1 92 ? 13.333 10.124 31.299 1.00 16.33 ? 92 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1538 >HETATM 1162 O O . HOH C 3 . ? 20.610 7.668 40.212 1.00 49.06 ? 348 HOH A O 1 >ATOM 735 N NZ . LYS A 1 92 ? 13.129 8.884 30.506 1.00 17.37 ? 92 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1539 >HETATM 1163 O O . HOH C 3 . ? 24.813 2.899 36.403 1.00 48.98 ? 349 HOH A O 1 >ATOM 736 N N . MET A 1 93 ? 13.172 13.988 35.268 1.00 7.58 ? 93 MET A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1540 >HETATM 1164 O O . HOH C 3 . ? 29.900 5.163 26.918 1.00 23.60 ? 350 HOH A O 1 >ATOM 737 C CA . MET A 1 93 ? 12.159 14.985 34.995 1.00 8.21 ? 93 MET A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1541 >HETATM 1165 O O . HOH C 3 . ? 14.333 5.466 42.757 1.00 22.90 ? 351 HOH A O 1 >ATOM 738 C C . MET A 1 93 ? 11.915 15.038 33.496 1.00 9.18 ? 93 MET A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1542 >HETATM 1166 O O . HOH C 3 . ? 8.914 5.771 35.515 1.00 35.92 ? 352 HOH A O 1 >ATOM 739 O O . MET A 1 93 ? 12.833 14.838 32.690 1.00 7.74 ? 93 MET A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1543 >HETATM 1167 O O . HOH C 3 . ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O 1 >ATOM 740 C CB . MET A 1 93 ? 12.565 16.359 35.523 1.00 9.68 ? 93 MET A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1544 >HETATM 1168 O O . HOH C 3 . ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O 1 >ATOM 741 C CG . MET A 1 93 ? 13.826 16.925 34.937 1.00 13.16 ? 93 MET A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1545 >HETATM 1169 O O . HOH C 3 . ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O 1 >ATOM 742 S SD . MET A 1 93 ? 14.238 18.543 35.628 1.00 17.49 ? 93 MET A SD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1546 >HETATM 1170 O O . HOH C 3 . ? 12.491 24.840 7.594 1.00 39.45 ? 356 HOH A O 1 >ATOM 743 C CE . MET A 1 93 ? 15.009 18.106 37.076 1.00 18.53 ? 93 MET A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1547 >HETATM 1171 O O . HOH C 3 . ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O 1 >ATOM 744 N N . VAL A 1 94 ? 10.658 15.239 33.128 1.00 9.48 ? 94 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1548 >HETATM 1172 O O . HOH C 3 . ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O 1 >ATOM 745 C CA . VAL A 1 94 ? 10.266 15.334 31.726 1.00 9.55 ? 94 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1549 >HETATM 1173 O O . HOH C 3 . ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O 1 >ATOM 746 C C . VAL A 1 94 ? 9.516 16.639 31.528 1.00 10.10 ? 94 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1550 >HETATM 1174 O O . HOH C 3 . ? 11.358 8.880 19.119 1.00 24.31 ? 360 HOH A O 1 >ATOM 747 O O . VAL A 1 94 ? 8.683 17.024 32.364 1.00 9.47 ? 94 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1551 >HETATM 1175 O O . HOH C 3 . ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O 1 >ATOM 748 C CB . VAL A 1 94 ? 9.371 14.164 31.315 1.00 11.05 ? 94 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1552 >HETATM 1176 O O . HOH C 3 . ? 22.049 27.870 4.565 1.00 25.37 ? 362 HOH A O 1 >ATOM 749 C CG1 . VAL A 1 94 ? 8.878 14.354 29.878 1.00 12.88 ? 94 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1553 >HETATM 1177 O O . HOH C 3 . ? 11.533 6.689 34.501 1.00 29.92 ? 363 HOH A O 1 >ATOM 750 C CG2 . VAL A 1 94 ? 10.147 12.866 31.420 1.00 14.00 ? 94 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1554 >HETATM 1178 O O . HOH C 3 . ? 13.269 4.551 36.338 1.00 45.75 ? 364 HOH A O 1 >ATOM 751 N N . CYS A 1 95 ? 9.802 17.312 30.413 1.00 9.49 ? 95 CYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1555 >HETATM 1179 O O . HOH C 3 . ? 23.149 9.493 41.173 1.00 30.10 ? 365 HOH A O 1 >ATOM 752 C CA . CYS A 1 95 ? 9.169 18.582 30.094 1.00 8.82 ? 95 CYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1556 >HETATM 1180 O O . HOH C 3 . ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O 1 >ATOM 753 C C . CYS A 1 95 ? 8.431 18.559 28.758 1.00 11.70 ? 95 CYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1557 >HETATM 1181 O O . HOH C 3 . ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O 1 >ATOM 754 O O . CYS A 1 95 ? 9.014 18.215 27.723 1.00 12.29 ? 95 CYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1558 >HETATM 1182 O O . HOH C 3 . ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O 1 >ATOM 755 C CB . CYS A 1 95 ? 10.229 19.679 30.059 1.00 8.79 ? 95 CYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1559 >HETATM 1183 O O . HOH C 3 . ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O 1 >ATOM 756 S SG . CYS A 1 95 ? 9.620 21.322 29.690 1.00 10.97 ? 95 CYS A SG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1560 >HETATM 1184 O O . HOH C 3 . ? 31.928 9.444 23.294 1.00 46.07 ? 370 HOH A O 1 >ATOM 757 N N . GLU A 1 96 ? 7.149 18.902 28.791 1.00 10.87 ? 96 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1561 >HETATM 1185 O O . HOH C 3 . ? 25.699 10.933 9.557 1.00 44.12 ? 371 HOH A O 1 >ATOM 758 C CA . GLU A 1 96 ? 6.342 18.962 27.587 1.00 14.78 ? 96 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1562 >HETATM 1186 O O . HOH C 3 . ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O 1 >ATOM 759 C C . GLU A 1 96 ? 6.267 20.439 27.182 1.00 13.83 ? 96 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1563 >HETATM 1187 O O . HOH C 3 . ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O 1 >ATOM 760 O O . GLU A 1 96 ? 6.044 21.311 28.030 1.00 12.79 ? 96 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1564 >HETATM 1188 O O . HOH C 3 . ? 20.596 32.070 6.807 1.00 36.38 ? 374 HOH A O 1 >ATOM 761 C CB . GLU A 1 96 ? 4.957 18.397 27.885 1.00 20.21 ? 96 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1565 >HETATM 1189 O O . HOH C 3 . ? 17.126 28.421 9.515 1.00 23.81 ? 375 HOH A O 1 >ATOM 762 C CG . GLU A 1 96 ? 3.981 18.432 26.726 1.00 32.46 ? 96 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1566 >HETATM 1190 O O . HOH C 3 . ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O 1 >ATOM 763 C CD . GLU A 1 96 ? 2.646 17.765 27.065 1.00 38.97 ? 96 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1567 >HETATM 1191 O O . HOH C 3 . ? 6.046 30.510 19.639 1.00 29.02 ? 377 HOH A O 1 >ATOM 764 O OE1 . GLU A 1 96 ? 2.053 18.108 28.128 1.00 42.61 ? 96 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1568 >HETATM 1192 O O . HOH C 3 . ? 9.543 16.072 11.145 1.00 50.91 ? 378 HOH A O 1 >ATOM 765 O OE2 . GLU A 1 96 ? 2.201 16.892 26.271 1.00 42.17 ? 96 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1569 >HETATM 1193 O O . HOH C 3 . ? 8.174 14.289 20.240 1.00 54.21 ? 379 HOH A O 1 >ATOM 766 N N . GLN A 1 97 ? 6.513 20.725 25.903 1.00 13.39 ? 97 GLN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1570 >HETATM 1194 O O . HOH C 3 . ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O 1 >ATOM 767 C CA . GLN A 1 97 ? 6.489 22.100 25.402 1.00 13.55 ? 97 GLN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1571 >HETATM 1195 O O . HOH C 3 . ? 5.486 15.385 24.922 1.00 50.19 ? 381 HOH A O 1 >ATOM 768 C C . GLN A 1 97 ? 5.357 22.334 24.400 1.00 15.88 ? 97 GLN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1572 >HETATM 1196 O O . HOH C 3 . ? 6.038 21.424 43.276 1.00 46.64 ? 382 HOH A O 1 >ATOM 769 O O . GLN A 1 97 ? 5.013 21.455 23.591 1.00 16.25 ? 97 GLN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1573 >HETATM 1197 O O . HOH C 3 . ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O 1 >ATOM 770 C CB . GLN A 1 97 ? 7.823 22.465 24.747 1.00 12.20 ? 97 GLN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1574 >HETATM 1198 O O . HOH C 3 . ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O 1 >ATOM 771 C CG . GLN A 1 97 ? 9.033 22.324 25.650 1.00 12.55 ? 97 GLN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1575 >HETATM 1199 O O . HOH C 3 . ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O 1 >ATOM 772 C CD . GLN A 1 97 ? 10.321 22.613 24.927 1.00 14.20 ? 97 GLN A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1576 >HETATM 1200 O O . HOH C 3 . ? 31.446 7.504 31.389 1.00 28.93 ? 386 HOH A O 1 >ATOM 773 O OE1 . GLN A 1 97 ? 10.478 22.288 23.749 1.00 12.94 ? 97 GLN A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1577 >HETATM 1201 O O . HOH C 3 . ? 18.212 20.893 5.892 1.00 29.90 ? 387 HOH A O 1 >ATOM 774 N NE2 . GLN A 1 97 ? 11.260 23.235 25.627 1.00 14.75 ? 97 GLN A NE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1578 >HETATM 1202 O O . HOH C 3 . ? 15.148 27.608 7.685 1.00 30.91 ? 388 HOH A O 1 >ATOM 775 N N . LYS A 1 98 ? 4.801 23.541 24.450 1.00 17.30 ? 98 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1579 >HETATM 1203 O O . HOH C 3 . ? 2.656 23.148 20.117 1.00 35.98 ? 389 HOH A O 1 >ATOM 776 C CA . LYS A 1 98 ? 3.696 23.952 23.582 1.00 19.78 ? 98 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1580 >HETATM 1204 O O . HOH C 3 . ? 3.100 22.690 28.640 1.00 31.31 ? 390 HOH A O 1 >ATOM 777 C C . LYS A 1 98 ? 3.990 25.340 23.019 1.00 18.56 ? 98 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1581 >HETATM 1205 O O . HOH C 3 . ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O 1 >ATOM 778 O O . LYS A 1 98 ? 4.162 26.293 23.771 1.00 17.70 ? 98 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1582 >HETATM 1206 O O . HOH C 3 . ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O 1 >ATOM 779 C CB . LYS A 1 98 ? 2.389 23.953 24.389 1.00 23.30 ? 98 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1583 >HETATM 1207 O O . HOH C 3 . ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O 1 >ATOM 780 C CG . LYS A 1 98 ? 1.294 24.857 23.867 1.00 30.94 ? 98 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1584 >HETATM 1208 O O . HOH C 3 . ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O 1 >ATOM 781 C CD . LYS A 1 98 ? 0.210 25.047 24.934 1.00 37.10 ? 98 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1585 >HETATM 1209 O O . HOH C 3 . ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O 1 >ATOM 782 C CE . LYS A 1 98 ? -0.849 26.072 24.520 1.00 39.73 ? 98 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1586 >HETATM 1210 O O . HOH C 3 . ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O 1 >ATOM 783 N NZ . LYS A 1 98 ? -0.326 27.476 24.541 1.00 42.46 ? 98 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1587 >HETATM 1211 O O . HOH C 3 . ? 1.988 27.992 43.589 1.00 33.97 ? 397 HOH A O 1 >ATOM 784 N N . LEU A 1 99 ? 4.073 25.445 21.696 1.00 19.35 ? 99 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1588 >HETATM 1212 O O . HOH C 3 . ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O 1 >ATOM 785 C CA . LEU A 1 99 ? 4.357 26.721 21.041 1.00 21.32 ? 99 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1589 >HETATM 1213 O O . HOH C 3 . ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O 1 >ATOM 786 C C . LEU A 1 99 ? 3.307 27.770 21.351 1.00 22.86 ? 99 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1590 ># >ATOM 787 O O . LEU A 1 99 ? 2.108 27.496 21.261 1.00 23.41 ? 99 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1591 >loop_ >ATOM 788 C CB . LEU A 1 99 ? 4.466 26.542 19.526 1.00 22.09 ? 99 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1592 >_pdbx_entity_nonpoly.entity_id >ATOM 789 C CG . LEU A 1 99 ? 5.692 25.792 18.997 1.00 22.72 ? 99 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1593 >_pdbx_entity_nonpoly.name >ATOM 790 C CD1 . LEU A 1 99 ? 5.585 25.639 17.490 1.00 23.04 ? 99 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1594 >_pdbx_entity_nonpoly.comp_id >ATOM 791 C CD2 . LEU A 1 99 ? 6.951 26.548 19.372 1.00 23.61 ? 99 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1595 >2 'RETINOIC ACID' REA >ATOM 792 N N . LEU A 1 100 ? 3.767 28.962 21.722 1.00 24.11 ? 100 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1596 >3 water HOH >ATOM 793 C CA . LEU A 1 100 ? 2.879 30.070 22.051 1.00 27.59 ? 100 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1597 ># >ATOM 794 C C . LEU A 1 100 ? 2.130 30.545 20.815 1.00 30.94 ? 100 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1598 >loop_ >ATOM 795 O O . LEU A 1 100 ? 0.951 30.908 20.877 1.00 31.34 ? 100 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1599 >_pdbx_validate_torsion.id >ATOM 796 C CB . LEU A 1 100 ? 3.680 31.227 22.640 1.00 25.50 ? 100 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1600 >_pdbx_validate_torsion.PDB_model_num >ATOM 797 C CG . LEU A 1 100 ? 4.254 30.947 24.020 1.00 24.80 ? 100 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1601 >_pdbx_validate_torsion.auth_comp_id >ATOM 798 C CD1 . LEU A 1 100 ? 4.960 32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1602 >_pdbx_validate_torsion.auth_asym_id >ATOM 799 C CD2 . LEU A 1 100 ? 3.141 30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1603 >_pdbx_validate_torsion.auth_seq_id >ATOM 800 N N . LYS A 1 101 ? 2.835 30.531 19.689 1.00 34.60 ? 101 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1604 >_pdbx_validate_torsion.PDB_ins_code >ATOM 801 C CA . LYS A 1 101 ? 2.282 30.961 18.413 1.00 37.81 ? 101 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1605 >_pdbx_validate_torsion.label_alt_id >ATOM 802 C C . LYS A 1 101 ? 2.847 30.088 17.292 1.00 37.39 ? 101 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1606 >_pdbx_validate_torsion.phi >ATOM 803 O O . LYS A 1 101 ? 4.019 29.687 17.319 1.00 37.22 ? 101 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1607 >_pdbx_validate_torsion.psi >ATOM 804 C CB . LYS A 1 101 ? 2.653 32.429 18.147 1.00 40.57 ? 101 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1608 >1 1 GLU A 73 ? ? -144.94 -154.28 >ATOM 805 C CG . LYS A 1 101 ? 2.182 33.426 19.212 1.00 45.13 ? 101 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1609 >2 1 ASP A 126 ? ? 55.69 -115.96 >ATOM 806 C CD . LYS A 1 101 ? 2.955 34.741 19.125 1.00 48.57 ? 101 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1610 ># >ATOM 807 C CE . LYS A 1 101 ? 4.479 34.527 19.248 1.00 51.31 ? 101 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1611 >loop_ >ATOM 808 N NZ . LYS A 1 101 ? 4.917 33.952 20.559 1.00 51.14 ? 101 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1612 >_pdbx_audit_revision_group.ordinal >ATOM 809 N N . GLY A 1 102 ? 1.997 29.786 16.318 1.00 37.21 ? 102 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1613 >_pdbx_audit_revision_group.revision_ordinal >ATOM 810 C CA . GLY A 1 102 ? 2.423 28.993 15.184 1.00 36.82 ? 102 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1614 >_pdbx_audit_revision_group.data_content_type >ATOM 811 C C . GLY A 1 102 ? 2.333 27.494 15.344 1.00 36.36 ? 102 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1615 >_pdbx_audit_revision_group.group >ATOM 812 O O . GLY A 1 102 ? 1.690 26.977 16.265 1.00 35.74 ? 102 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1616 >1 2 'Structure model' 'Version format compliance' >ATOM 813 N N . GLU A 1 103 ? 2.954 26.803 14.395 1.00 35.74 ? 103 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1617 >2 3 'Structure model' 'Version format compliance' >ATOM 814 C CA . GLU A 1 103 ? 2.988 25.348 14.377 1.00 35.50 ? 103 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1618 ># >ATOM 815 C C . GLU A 1 103 ? 4.418 24.880 14.140 1.00 31.92 ? 103 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1619 >_pdbx_audit_revision_details.ordinal 1 >ATOM 816 O O . GLU A 1 103 ? 5.281 25.654 13.723 1.00 31.61 ? 103 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1620 >_pdbx_audit_revision_details.revision_ordinal 1 >ATOM 817 C CB . GLU A 1 103 ? 2.077 24.784 13.274 1.00 39.37 ? 103 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1621 >_pdbx_audit_revision_details.data_content_type 'Structure model' >ATOM 818 C CG . GLU A 1 103 ? 0.652 24.422 13.712 1.00 45.52 ? 103 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1622 >_pdbx_audit_revision_details.provider repository >ATOM 819 C CD . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1623 >_pdbx_audit_revision_details.type 'Initial release' >ATOM 820 O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1624 >_pdbx_audit_revision_details.description ? >ATOM 821 O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1625 ># >ATOM 822 N N . GLY A 1 104 ? 4.653 23.604 14.414 1.00 28.97 ? 104 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1626 >loop_ >ATOM 823 C CA . GLY A 1 104 ? 5.967 23.024 14.231 1.00 25.41 ? 104 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1627 >_pdbx_audit_revision_history.ordinal >ATOM 824 C C . GLY A 1 104 ? 6.012 21.648 14.863 1.00 22.09 ? 104 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1628 >_pdbx_audit_revision_history.data_content_type >ATOM 825 O O . GLY A 1 104 ? 4.987 21.160 15.347 1.00 21.89 ? 104 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1629 >_pdbx_audit_revision_history.major_revision >ATOM 826 N N . PRO A 1 105 ? 7.176 20.976 14.832 1.00 19.50 ? 105 PRO A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1630 >_pdbx_audit_revision_history.minor_revision >ATOM 827 C CA . PRO A 1 105 ? 7.338 19.640 15.418 1.00 17.92 ? 105 PRO A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1631 >_pdbx_audit_revision_history.revision_date >ATOM 828 C C . PRO A 1 105 ? 7.020 19.664 16.914 1.00 15.61 ? 105 PRO A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1632 >1 'Structure model' 1 0 1995-01-26 >ATOM 829 O O . PRO A 1 105 ? 7.170 20.696 17.567 1.00 14.42 ? 105 PRO A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1633 >2 'Structure model' 1 1 2008-03-24 >ATOM 830 C CB . PRO A 1 105 ? 8.828 19.348 15.202 1.00 18.86 ? 105 PRO A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1634 >3 'Structure model' 1 2 2011-07-13 >ATOM 831 C CG . PRO A 1 105 ? 9.188 20.164 14.005 1.00 18.76 ? 105 PRO A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1635 ># >ATOM 832 C CD . PRO A 1 105 ? 8.423 21.440 14.199 1.00 18.40 ? 105 PRO A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1636 >_pdbx_struct_oper_list.id 1 >ATOM 833 N N . LYS A 1 106 ? 6.552 18.541 17.444 1.00 16.02 ? 106 LYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1637 >_pdbx_struct_oper_list.type 'identity operation' >ATOM 834 C CA . LYS A 1 106 ? 6.255 18.453 18.868 1.00 16.93 ? 106 LYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1638 >_pdbx_struct_oper_list.name 1_555 >ATOM 835 C C . LYS A 1 106 ? 7.609 18.305 19.554 1.00 15.49 ? 106 LYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1639 >_pdbx_struct_oper_list.symmetry_operation x,y,z >ATOM 836 O O . LYS A 1 106 ? 8.397 17.437 19.183 1.00 14.76 ? 106 LYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1640 >_pdbx_struct_oper_list.matrix[1][1] 1.0000000000 >ATOM 837 C CB . LYS A 1 106 ? 5.387 17.229 19.174 1.00 20.98 ? 106 LYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1641 >_pdbx_struct_oper_list.matrix[1][2] 0.0000000000 >ATOM 838 C CG . LYS A 1 106 ? 5.015 17.097 20.662 1.00 27.98 ? 106 LYS A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1642 >_pdbx_struct_oper_list.matrix[1][3] 0.0000000000 >ATOM 839 C CD . LYS A 1 106 ? 4.463 18.433 21.229 1.00 33.23 ? 106 LYS A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1643 >_pdbx_struct_oper_list.vector[1] 0.0000000000 >ATOM 840 C CE . LYS A 1 106 ? 4.250 18.417 22.764 1.00 35.21 ? 106 LYS A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1644 >_pdbx_struct_oper_list.matrix[2][1] 0.0000000000 >ATOM 841 N NZ . LYS A 1 106 ? 5.519 18.251 23.566 1.00 33.75 ? 106 LYS A NZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1645 >_pdbx_struct_oper_list.matrix[2][2] 1.0000000000 >ATOM 842 N N . THR A 1 107 ? 7.907 19.167 20.515 1.00 13.91 ? 107 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1646 >_pdbx_struct_oper_list.matrix[2][3] 0.0000000000 >ATOM 843 C CA . THR A 1 107 ? 9.203 19.086 21.190 1.00 12.14 ? 107 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1647 >_pdbx_struct_oper_list.vector[2] 0.0000000000 >ATOM 844 C C . THR A 1 107 ? 9.083 18.819 22.681 1.00 11.66 ? 107 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1648 >_pdbx_struct_oper_list.matrix[3][1] 0.0000000000 >ATOM 845 O O . THR A 1 107 ? 8.061 19.120 23.295 1.00 10.59 ? 107 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1649 >_pdbx_struct_oper_list.matrix[3][2] 0.0000000000 >ATOM 846 C CB . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1650 >_pdbx_struct_oper_list.matrix[3][3] 1.0000000000 >ATOM 847 O OG1 . THR A 1 107 ? 9.263 21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1651 >_pdbx_struct_oper_list.vector[3] 0.0000000000 >ATOM 848 C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1652 ># >ATOM 849 N N . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1653 >_pdbx_struct_assembly_gen.assembly_id 1 >ATOM 850 C CA . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98 ? 108 SER A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1654 >_pdbx_struct_assembly_gen.oper_expression 1 >ATOM 851 C C . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90 ? 108 SER A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1655 >_pdbx_struct_assembly_gen.asym_id_list A,B,C >ATOM 852 O O . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48 ? 108 SER A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1656 ># >ATOM 853 C CB . SER A 1 108 ? 9.370 16.729 25.024 1.00 9.84 ? 108 SER A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1657 >_pdbx_struct_assembly.id 1 >ATOM 854 O OG . SER A 1 108 ? 9.844 15.601 24.313 1.00 13.87 ? 108 SER A OG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1658 >_pdbx_struct_assembly.details author_defined_assembly >ATOM 855 N N . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96 ? 109 TRP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1659 >_pdbx_struct_assembly.method_details ? >ATOM 856 C CA . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85 ? 109 TRP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1660 >_pdbx_struct_assembly.oligomeric_details monomeric >ATOM 857 C C . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56 ? 109 TRP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1661 >_pdbx_struct_assembly.oligomeric_count 1 >ATOM 858 O O . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14 ? 109 TRP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1662 ># >ATOM 859 C CB . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25 ? 109 TRP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1663 >loop_ >ATOM 860 C CG . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07 ? 109 TRP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1664 >_atom_type.symbol >ATOM 861 C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28 ? 109 TRP A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1665 >C >ATOM 862 C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31 ? 109 TRP A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1666 >N >ATOM 863 N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69 ? 109 TRP A NE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1667 >O >ATOM 864 C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04 ? 109 TRP A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1668 >S >ATOM 865 C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92 ? 109 TRP A CE3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1669 ># >ATOM 866 C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72 ? 109 TRP A CZ2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1670 >_atom_sites.entry_id 1CBS >ATOM 867 C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1671 >_atom_sites.fract_transf_matrix[1][1] 0.021906 >ATOM 868 C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1672 >_atom_sites.fract_transf_matrix[1][2] 0.000000 >ATOM 869 N N . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39 ? 110 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1673 >_atom_sites.fract_transf_matrix[1][3] 0.000000 >ATOM 870 C CA . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23 ? 110 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1674 >_atom_sites.fract_transf_matrix[2][1] 0.000000 >ATOM 871 C C . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40 ? 110 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1675 >_atom_sites.fract_transf_matrix[2][2] 0.021026 >ATOM 872 O O . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43 ? 110 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1676 >_atom_sites.fract_transf_matrix[2][3] 0.000000 >ATOM 873 C CB . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17 ? 110 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1677 >_atom_sites.fract_transf_matrix[3][1] 0.000000 >ATOM 874 O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49 ? 110 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1678 >_atom_sites.fract_transf_matrix[3][2] 0.000000 >ATOM 875 C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64 ? 110 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1679 >_atom_sites.fract_transf_matrix[3][3] 0.012885 >ATOM 876 N N . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72 ? 111 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1680 >_atom_sites.fract_transf_vector[1] 0.00000 >ATOM 877 C CA . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27 ? 111 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1681 >_atom_sites.fract_transf_vector[2] 0.00000 >ATOM 878 C C . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89 ? 111 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1682 >_atom_sites.fract_transf_vector[3] 0.00000 >ATOM 879 O O . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35 ? 111 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1683 ># >ATOM 880 C CB . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20 ? 111 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1684 >_database_PDB_matrix.entry_id 1CBS >ATOM 881 C CG . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38 ? 111 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1685 >_database_PDB_matrix.origx[1][1] 1.000000 >ATOM 882 C CD . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70 ? 111 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1686 >_database_PDB_matrix.origx[1][2] 0.000000 >ATOM 883 N NE . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83 ? 111 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1687 >_database_PDB_matrix.origx[1][3] 0.000000 >ATOM 884 C CZ . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1688 >_database_PDB_matrix.origx[2][1] 0.000000 >ATOM 885 N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1689 >_database_PDB_matrix.origx[2][2] 1.000000 >ATOM 886 N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1690 >_database_PDB_matrix.origx[2][3] 0.000000 >ATOM 887 N N . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64 ? 112 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1691 >_database_PDB_matrix.origx[3][1] 0.000000 >ATOM 888 C CA . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1692 >_database_PDB_matrix.origx[3][2] 0.000000 >ATOM 889 C C . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93 ? 112 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1693 >_database_PDB_matrix.origx[3][3] 1.000000 >ATOM 890 O O . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92 ? 112 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1694 >_database_PDB_matrix.origx_vector[1] 0.00000 >ATOM 891 C CB . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1695 >_database_PDB_matrix.origx_vector[2] 0.00000 >ATOM 892 C CG . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1696 >_database_PDB_matrix.origx_vector[3] 0.00000 >ATOM 893 C CD . GLU A 1 112 ? 17.484 9.325 32.177 1.00 25.09 ? 112 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1697 ># >ATOM 894 O OE1 . GLU A 1 112 ? 17.223 8.308 32.883 1.00 22.36 ? 112 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1698 >loop_ >ATOM 895 O OE2 . GLU A 1 112 ? 17.175 9.443 30.955 1.00 25.10 ? 112 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1699 >_struct_site_gen.id >ATOM 896 N N . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96 ? 113 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1700 >_struct_site_gen.site_id >ATOM 897 C CA . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1701 >_struct_site_gen.pdbx_num_res >ATOM 898 C C . LEU A 1 113 ? 20.789 9.991 37.081 1.00 12.06 ? 113 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1702 >_struct_site_gen.label_comp_id >ATOM 899 O O . LEU A 1 113 ? 19.906 9.270 37.559 1.00 12.08 ? 113 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1703 >_struct_site_gen.label_asym_id >ATOM 900 C CB . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1704 >_struct_site_gen.label_seq_id >ATOM 901 C CG . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1705 >_struct_site_gen.pdbx_auth_ins_code >ATOM 902 C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1706 >_struct_site_gen.auth_comp_id >ATOM 903 C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1707 >_struct_site_gen.auth_asym_id >ATOM 904 N N . THR A 1 114 ? 21.895 9.502 36.535 1.00 11.06 ? 114 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1708 >_struct_site_gen.auth_seq_id >ATOM 905 C CA . THR A 1 114 ? 22.110 8.062 36.452 1.00 11.74 ? 114 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1709 >_struct_site_gen.label_atom_id >ATOM 906 C C . THR A 1 114 ? 22.816 7.522 37.686 1.00 11.41 ? 114 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1710 >_struct_site_gen.label_alt_id >ATOM 907 O O . THR A 1 114 ? 23.327 8.282 38.501 1.00 11.47 ? 114 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1711 >_struct_site_gen.symmetry >ATOM 908 C CB . THR A 1 114 ? 22.894 7.700 35.188 1.00 12.89 ? 114 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1712 >_struct_site_gen.details >ATOM 909 O OG1 . THR A 1 114 ? 24.109 8.451 35.164 1.00 15.50 ? 114 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1713 >1 AC1 10 GLU A 13 ? GLU A 13 . ? 3_655 ? >ATOM 910 C CG2 . THR A 1 114 ? 22.075 8.037 33.951 1.00 14.75 ? 114 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1714 >2 AC1 10 ALA A 32 ? ALA A 32 . ? 1_555 ? >ATOM 911 N N . ASN A 1 115 ? 22.834 6.202 37.808 1.00 13.23 ? 115 ASN A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1715 >3 AC1 10 THR A 54 ? THR A 54 . ? 1_555 ? >ATOM 912 C CA . ASN A 1 115 ? 23.441 5.538 38.951 1.00 16.19 ? 115 ASN A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1716 >4 AC1 10 VAL A 58 ? VAL A 58 . ? 1_555 ? >ATOM 913 C C . ASN A 1 115 ? 24.930 5.761 39.139 1.00 14.24 ? 115 ASN A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1717 >5 AC1 10 VAL A 76 ? VAL A 76 . ? 1_555 ? >ATOM 914 O O . ASN A 1 115 ? 25.432 5.626 40.256 1.00 14.74 ? 115 ASN A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1718 >6 AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? >ATOM 915 C CB . ASN A 1 115 ? 23.123 4.047 38.918 1.00 21.89 ? 115 ASN A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1719 >7 AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? >ATOM 916 C CG . ASN A 1 115 ? 21.703 3.754 39.357 1.00 29.77 ? 115 ASN A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1720 >8 AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? >ATOM 917 O OD1 . ASN A 1 115 ? 20.955 3.046 38.669 1.00 34.83 ? 115 ASN A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1721 >9 AC1 10 HOH C . ? HOH A 309 . ? 1_555 ? >ATOM 918 N ND2 . ASN A 1 115 ? 21.313 4.310 40.516 1.00 32.90 ? 115 ASN A ND2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1722 >10 AC1 10 HOH C . ? HOH A 343 . ? 1_555 ? >ATOM 919 N N . ASP A 1 116 ? 25.626 6.095 38.055 1.00 12.05 ? 116 ASP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1723 ># >ATOM 920 C CA . ASP A 1 116 ? 27.061 6.364 38.094 1.00 11.99 ? 116 ASP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1724 >_struct_site.id AC1 >ATOM 921 C C . ASP A 1 116 ? 27.424 7.821 38.397 1.00 11.45 ? 116 ASP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1725 >_struct_site.pdbx_evidence_code Software >ATOM 922 O O . ASP A 1 116 ? 28.592 8.184 38.393 1.00 12.23 ? 116 ASP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1726 >_struct_site.pdbx_auth_asym_id ? >ATOM 923 C CB . ASP A 1 116 ? 27.764 5.875 36.806 1.00 13.89 ? 116 ASP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1727 >_struct_site.pdbx_auth_comp_id ? >ATOM 924 C CG . ASP A 1 116 ? 27.177 6.474 35.512 1.00 16.58 ? 116 ASP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1728 >_struct_site.pdbx_auth_seq_id ? >ATOM 925 O OD1 . ASP A 1 116 ? 26.263 7.303 35.569 1.00 19.66 ? 116 ASP A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1729 >_struct_site.pdbx_auth_ins_code ? >ATOM 926 O OD2 . ASP A 1 116 ? 27.651 6.113 34.422 1.00 20.14 ? 116 ASP A OD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1730 >_struct_site.pdbx_num_residues 10 >ATOM 927 N N . GLY A 1 117 ? 26.420 8.647 38.675 1.00 10.58 ? 117 GLY A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1731 >_struct_site.details 'BINDING SITE FOR RESIDUE REA A 200' >ATOM 928 C CA . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83 ? 117 GLY A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1732 ># >ATOM 929 C C . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97 ? 117 GLY A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1733 >loop_ >ATOM 930 O O . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1734 >_pdbx_struct_sheet_hbond.sheet_id >ATOM 931 N N . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43 ? 118 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1735 >_pdbx_struct_sheet_hbond.range_id_1 >ATOM 932 C CA . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79 ? 118 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1736 >_pdbx_struct_sheet_hbond.range_id_2 >ATOM 933 C C . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60 ? 118 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1737 >_pdbx_struct_sheet_hbond.range_1_label_atom_id >ATOM 934 O O . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05 ? 118 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1738 >_pdbx_struct_sheet_hbond.range_1_label_comp_id >ATOM 935 C CB . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86 ? 118 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1739 >_pdbx_struct_sheet_hbond.range_1_label_asym_id >ATOM 936 C CG . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64 ? 118 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1740 >_pdbx_struct_sheet_hbond.range_1_label_seq_id >ATOM 937 C CD . GLU A 1 118 ? 28.770 9.370 33.310 1.00 13.39 ? 118 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1741 >_pdbx_struct_sheet_hbond.range_1_PDB_ins_code >ATOM 938 O OE1 . GLU A 1 118 ? 28.036 9.043 32.355 1.00 11.90 ? 118 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1742 >_pdbx_struct_sheet_hbond.range_1_auth_atom_id >ATOM 939 O OE2 . GLU A 1 118 ? 29.956 8.998 33.405 1.00 16.59 ? 118 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1743 >_pdbx_struct_sheet_hbond.range_1_auth_comp_id >ATOM 940 N N . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57 ? 119 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1744 >_pdbx_struct_sheet_hbond.range_1_auth_asym_id >ATOM 941 C CA . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94 ? 119 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1745 >_pdbx_struct_sheet_hbond.range_1_auth_seq_id >ATOM 942 C C . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29 ? 119 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1746 >_pdbx_struct_sheet_hbond.range_2_label_atom_id >ATOM 943 O O . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23 ? 119 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1747 >_pdbx_struct_sheet_hbond.range_2_label_comp_id >ATOM 944 C CB . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83 ? 119 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1748 >_pdbx_struct_sheet_hbond.range_2_label_asym_id >ATOM 945 C CG . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54 ? 119 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1749 >_pdbx_struct_sheet_hbond.range_2_label_seq_id >ATOM 946 C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1750 >_pdbx_struct_sheet_hbond.range_2_PDB_ins_code >ATOM 947 C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1751 >_pdbx_struct_sheet_hbond.range_2_auth_atom_id >ATOM 948 N N . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17 ? 120 ILE A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1752 >_pdbx_struct_sheet_hbond.range_2_auth_comp_id >ATOM 949 C CA . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22 ? 120 ILE A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1753 >_pdbx_struct_sheet_hbond.range_2_auth_asym_id >ATOM 950 C C . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47 ? 120 ILE A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1754 >_pdbx_struct_sheet_hbond.range_2_auth_seq_id >ATOM 951 O O . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54 ? 120 ILE A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1755 >A 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 >ATOM 952 C CB . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19 ? 120 ILE A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1756 >A 2 3 N SER A 55 ? N SER A 55 O ALA A 40 ? O ALA A 40 >ATOM 953 C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26 ? 120 ILE A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1757 >A 3 4 N ILE A 43 ? N ILE A 43 O GLY A 5 ? O GLY A 5 >ATOM 954 C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54 ? 120 ILE A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1758 >A 4 5 N GLU A 13 ? N GLU A 13 O THR A 131 ? O THR A 131 >ATOM 955 C CD1 . ILE A 1 120 ? 21.668 8.658 30.600 1.00 9.35 ? 120 ILE A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1759 >A 5 6 N TYR A 134 ? N TYR A 134 O LEU A 119 ? O LEU A 119 >ATOM 956 N N . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41 ? 121 LEU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1760 >A 6 7 N THR A 124 ? N THR A 124 O SER A 108 ? O SER A 108 >ATOM 957 C CA . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25 ? 121 LEU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1761 >A 7 8 O ARG A 111 ? O ARG A 111 N MET A 93 ? N MET A 93 >ATOM 958 C C . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41 ? 121 LEU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1762 >A 8 9 O LYS A 98 ? O LYS A 98 N LYS A 82 ? N LYS A 82 >ATOM 959 O O . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01 ? 121 LEU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1763 >A 9 10 N SER A 83 ? N SER A 83 O PHE A 71 ? O PHE A 71 >ATOM 960 C CB . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37 ? 121 LEU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1764 ># >ATOM 961 C CG . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96 ? 121 LEU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1765 >loop_ >ATOM 962 C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91 ? 121 LEU A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1766 >_struct_sheet_range.sheet_id >ATOM 963 C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96 ? 121 LEU A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1767 >_struct_sheet_range.id >ATOM 964 N N . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71 ? 122 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1768 >_struct_sheet_range.beg_label_comp_id >ATOM 965 C CA . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80 ? 122 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1769 >_struct_sheet_range.beg_label_asym_id >ATOM 966 C C . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58 ? 122 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1770 >_struct_sheet_range.beg_label_seq_id >ATOM 967 O O . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21 ? 122 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1771 >_struct_sheet_range.pdbx_beg_PDB_ins_code >ATOM 968 C CB . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51 ? 122 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1772 >_struct_sheet_range.end_label_comp_id >ATOM 969 O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27 ? 122 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1773 >_struct_sheet_range.end_label_asym_id >ATOM 970 C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86 ? 122 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1774 >_struct_sheet_range.end_label_seq_id >ATOM 971 N N . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87 ? 123 MET A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1775 >_struct_sheet_range.pdbx_end_PDB_ins_code >ATOM 972 C CA . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22 ? 123 MET A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1776 >_struct_sheet_range.beg_auth_comp_id >ATOM 973 C C . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66 ? 123 MET A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1777 >_struct_sheet_range.beg_auth_asym_id >ATOM 974 O O . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09 ? 123 MET A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1778 >_struct_sheet_range.beg_auth_seq_id >ATOM 975 C CB . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37 ? 123 MET A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1779 >_struct_sheet_range.end_auth_comp_id >ATOM 976 C CG . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1780 >_struct_sheet_range.end_auth_asym_id >ATOM 977 S SD . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1781 >_struct_sheet_range.end_auth_seq_id >ATOM 978 C CE . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1782 >A 1 THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 >ATOM 979 N N . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20 ? 124 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1783 >A 2 THR A 49 ? SER A 55 ? THR A 49 SER A 55 >ATOM 980 C CA . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54 ? 124 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1784 >A 3 ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 >ATOM 981 C C . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1785 >A 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 >ATOM 982 O O . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54 ? 124 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1786 >A 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 >ATOM 983 C CB . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1787 >A 6 LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 >ATOM 984 O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1788 >A 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 >ATOM 985 C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1789 >A 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 >ATOM 986 N N . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1790 >A 9 PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 >ATOM 987 C CA . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1791 >A 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 >ATOM 988 C C . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1792 ># >ATOM 989 O O . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1793 >loop_ >ATOM 990 C CB . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1794 >_struct_sheet_order.sheet_id >ATOM 991 N N . ASP A 1 126 ? 9.664 15.754 17.216 1.00 14.63 ? 126 ASP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1795 >_struct_sheet_order.range_id_1 >ATOM 992 C CA . ASP A 1 126 ? 8.901 14.721 16.536 1.00 17.86 ? 126 ASP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1796 >_struct_sheet_order.range_id_2 >ATOM 993 C C . ASP A 1 126 ? 9.512 13.364 16.905 1.00 18.66 ? 126 ASP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1797 >_struct_sheet_order.offset >ATOM 994 O O . ASP A 1 126 ? 9.519 13.006 18.080 1.00 19.38 ? 126 ASP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1798 >_struct_sheet_order.sense >ATOM 995 C CB . ASP A 1 126 ? 8.835 14.982 15.023 1.00 18.40 ? 126 ASP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1799 >A 1 2 ? anti-parallel >ATOM 996 C CG . ASP A 1 126 ? 7.786 16.032 14.660 1.00 22.34 ? 126 ASP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1800 >A 2 3 ? anti-parallel >ATOM 997 O OD1 . ASP A 1 126 ? 6.800 16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1801 >A 3 4 ? anti-parallel >ATOM 998 O OD2 . ASP A 1 126 ? 7.940 16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1802 >A 4 5 ? anti-parallel >ATOM 999 N N . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1803 >A 5 6 ? anti-parallel >ATOM 1000 C CA . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1804 >A 6 7 ? anti-parallel >ATOM 1001 C C . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1805 >A 7 8 ? anti-parallel >ATOM 1002 O O . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1806 >A 8 9 ? anti-parallel >ATOM 1003 C CB . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1807 >A 9 10 ? anti-parallel >ATOM 1004 C CG . ASP A 1 127 ? 9.043 9.450 15.880 1.00 33.21 ? 127 ASP A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1808 ># >ATOM 1005 O OD1 . ASP A 1 127 ? 7.892 9.959 15.934 1.00 36.08 ? 127 ASP A OD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1809 >_struct_sheet.id A >ATOM 1006 O OD2 . ASP A 1 127 ? 9.318 8.308 16.318 1.00 38.35 ? 127 ASP A OD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1810 >_struct_sheet.type ? >ATOM 1007 N N . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1811 >_struct_sheet.number_strands 10 >ATOM 1008 C CA . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1812 >_struct_sheet.details ? >ATOM 1009 C C . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1813 ># >ATOM 1010 O O . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74 ? 128 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1814 >_struct_biol.id 1 >ATOM 1011 C CB . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1815 ># >ATOM 1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1816 >loop_ >ATOM 1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1817 >_struct_asym.id >ATOM 1014 N N . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29 ? 129 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1818 >_struct_asym.pdbx_blank_PDB_chainid_flag >ATOM 1015 C CA . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95 ? 129 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1819 >_struct_asym.pdbx_modified >ATOM 1016 C C . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49 ? 129 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1820 >_struct_asym.entity_id >ATOM 1017 O O . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73 ? 129 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1821 >_struct_asym.details >ATOM 1018 C CB . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43 ? 129 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1822 >A N N 1 ? >ATOM 1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09 ? 129 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1823 >B N N 2 ? >ATOM 1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45 ? 129 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1824 >C N N 3 ? >ATOM 1021 N N . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54 ? 130 CYS A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1825 ># >ATOM 1022 C CA . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47 ? 130 CYS A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1826 >_struct_keywords.entry_id 1CBS >ATOM 1023 C C . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61 ? 130 CYS A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1827 >_struct_keywords.pdbx_keywords 'RETINOIC-ACID TRANSPORT' >ATOM 1024 O O . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53 ? 130 CYS A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1828 >_struct_keywords.text 'RETINOIC-ACID TRANSPORT' >ATOM 1025 C CB . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05 ? 130 CYS A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1829 ># >ATOM 1026 S SG . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82 ? 130 CYS A SG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1830 >_struct.entry_id 1CBS >ATOM 1027 N N . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58 ? 131 THR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1831 >_struct.title >ATOM 1028 C CA . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93 ? 131 THR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1832 >;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID >ATOM 1029 C C . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18 ? 131 THR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1833 >; >ATOM 1030 O O . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77 ? 131 THR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1834 >_struct.pdbx_descriptor >ATOM 1031 C CB . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63 ? 131 THR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1835 >'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' >ATOM 1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60 ? 131 THR A OG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1836 >_struct.pdbx_model_details ? >ATOM 1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76 ? 131 THR A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1837 >_struct.pdbx_CASP_flag ? >ATOM 1034 N N . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29 ? 132 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1838 >_struct.pdbx_model_type_details ? >ATOM 1035 C CA . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67 ? 132 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1839 ># >ATOM 1036 C C . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19 ? 132 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1840 >loop_ >ATOM 1037 O O . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65 ? 132 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1841 >_refine_ls_restr.type >ATOM 1038 C CB . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67 ? 132 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1842 >_refine_ls_restr.dev_ideal >ATOM 1039 C CG . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1843 >_refine_ls_restr.dev_ideal_target >ATOM 1040 C CD . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1844 >_refine_ls_restr.weight >ATOM 1041 N NE . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1845 >_refine_ls_restr.number >ATOM 1042 C CZ . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1846 >_refine_ls_restr.pdbx_refine_id >ATOM 1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1847 >_refine_ls_restr.pdbx_restraint_function >ATOM 1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1848 >x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1045 N N . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99 ? 133 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1849 >x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1046 C CA . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92 ? 133 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1850 >x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1047 C C . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85 ? 133 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1851 >x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1048 O O . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50 ? 133 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1852 >x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1049 C CB . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37 ? 133 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1853 >x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95 ? 133 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1854 >x_angle_deg 1.51 ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46 ? 133 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1855 >x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1052 N N . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35 ? 134 TYR A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1856 >x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1053 C CA . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57 ? 134 TYR A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1857 >x_dihedral_angle_d 27.4 ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1054 C C . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30 ? 134 TYR A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1858 >x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1055 O O . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92 ? 134 TYR A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1859 >x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1056 C CB . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84 ? 134 TYR A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1860 >x_improper_angle_d 1.32 ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1057 C CG . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89 ? 134 TYR A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1861 >x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1862 >x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1863 >x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1864 >x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1865 >x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1062 C CZ . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1866 >x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? >ATOM 1063 O OH . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1867 ># >ATOM 1064 N N . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63 ? 135 VAL A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1868 >_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' >ATOM 1065 C CA . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42 ? 135 VAL A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1869 >_refine_hist.cycle_id LAST >ATOM 1066 C C . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05 ? 135 VAL A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1870 >_refine_hist.pdbx_number_atoms_protein 1091 >ATOM 1067 O O . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02 ? 135 VAL A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1871 >_refine_hist.pdbx_number_atoms_nucleic_acid 0 >ATOM 1068 C CB . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05 ? 135 VAL A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1872 >_refine_hist.pdbx_number_atoms_ligand 22 >ATOM 1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27 ? 135 VAL A CG1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1873 >_refine_hist.number_atoms_solvent 100 >ATOM 1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1874 >_refine_hist.number_atoms_total 1213 >ATOM 1071 N N . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57 ? 136 ARG A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1875 >_refine_hist.d_res_high 1.8 >ATOM 1072 C CA . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1876 >_refine_hist.d_res_low 8.0 >ATOM 1073 C C . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1877 ># >ATOM 1074 O O . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1878 >_refine_analyze.entry_id 1CBS >ATOM 1075 C CB . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1879 >_refine_analyze.Luzzati_coordinate_error_obs 0.2 >ATOM 1076 C CG . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1880 >_refine_analyze.Luzzati_sigma_a_obs ? >ATOM 1077 C CD . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1881 >_refine_analyze.Luzzati_d_res_low_obs ? >ATOM 1078 N NE . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1882 >_refine_analyze.Luzzati_coordinate_error_free ? >ATOM 1079 C CZ . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1883 >_refine_analyze.Luzzati_sigma_a_free ? >ATOM 1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1884 >_refine_analyze.Luzzati_d_res_low_free ? >ATOM 1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1885 >_refine_analyze.number_disordered_residues ? >ATOM 1082 N N . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1886 >_refine_analyze.occupancy_sum_hydrogen ? >ATOM 1083 C CA . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1887 >_refine_analyze.occupancy_sum_non_hydrogen ? >ATOM 1084 C C . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1888 >_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' >ATOM 1085 O O . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1889 ># >ATOM 1086 C CB . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1890 >_refine.entry_id 1CBS >ATOM 1087 C CG . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1891 >_refine.ls_number_reflns_obs 14312 >ATOM 1088 C CD . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1892 >_refine.ls_number_reflns_all ? >ATOM 1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1893 >_refine.pdbx_ls_sigma_I ? >ATOM 1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1894 >_refine.pdbx_ls_sigma_F 2. >ATOM 1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1895 >_refine.pdbx_data_cutoff_high_absF ? >HETATM 1092 C C1 . REA B 2 . ? 21.972 29.831 16.739 1.00 15.25 ? 200 REA A C1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1896 >_refine.pdbx_data_cutoff_low_absF ? >HETATM 1093 C C2 . REA B 2 . ? 20.921 30.524 15.841 1.00 15.61 ? 200 REA A C2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1897 >_refine.pdbx_data_cutoff_high_rms_absF ? >HETATM 1094 C C3 . REA B 2 . ? 20.245 29.635 14.848 1.00 16.19 ? 200 REA A C3 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1898 >_refine.ls_d_res_low 8.0 >HETATM 1095 C C4 . REA B 2 . ? 19.555 28.479 15.488 1.00 14.59 ? 200 REA A C4 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1899 >_refine.ls_d_res_high 1.8 >HETATM 1096 C C5 . REA B 2 . ? 20.389 27.812 16.587 1.00 14.10 ? 200 REA A C5 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1900 >_refine.ls_percent_reflns_obs 90.3 >HETATM 1097 C C6 . REA B 2 . ? 21.425 28.446 17.218 1.00 14.42 ? 200 REA A C6 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1901 >_refine.ls_R_factor_obs 0.2000000 >HETATM 1098 C C7 . REA B 2 . ? 22.242 27.851 18.297 1.00 13.89 ? 200 REA A C7 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1902 >_refine.ls_R_factor_all ? >HETATM 1099 C C8 . REA B 2 . ? 21.868 26.977 19.240 1.00 11.86 ? 200 REA A C8 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1903 >_refine.ls_R_factor_R_work 0.2000000 >HETATM 1100 C C9 . REA B 2 . ? 22.705 26.434 20.286 1.00 10.87 ? 200 REA A C9 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1904 >_refine.ls_R_factor_R_free 0.2370000 >HETATM 1101 C C10 . REA B 2 . ? 22.159 25.536 21.131 1.00 9.19 ? 200 REA A C10 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1905 >_refine.ls_R_factor_R_free_error ? >HETATM 1102 C C11 . REA B 2 . ? 22.875 24.924 22.234 1.00 10.35 ? 200 REA A C11 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1906 >_refine.ls_R_factor_R_free_error_details ? >HETATM 1103 C C12 . REA B 2 . ? 22.237 24.026 22.990 1.00 10.53 ? 200 REA A C12 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1907 >_refine.ls_percent_reflns_R_free ? >HETATM 1104 C C13 . REA B 2 . ? 22.856 23.377 24.125 1.00 10.91 ? 200 REA A C13 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1908 >_refine.ls_number_reflns_R_free ? >HETATM 1105 C C14 . REA B 2 . ? 22.135 22.473 24.834 1.00 11.88 ? 200 REA A C14 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1909 >_refine.ls_number_parameters ? >HETATM 1106 C C15 . REA B 2 . ? 22.563 21.710 26.016 1.00 14.86 ? 200 REA A C15 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1910 >_refine.ls_number_restraints ? >HETATM 1107 C C16 . REA B 2 . ? 22.238 30.737 17.948 1.00 15.47 ? 200 REA A C16 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1911 >_refine.occupancy_min ? >HETATM 1108 C C17 . REA B 2 . ? 23.292 29.620 15.948 1.00 13.42 ? 200 REA A C17 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1912 >_refine.occupancy_max ? >HETATM 1109 C C18 . REA B 2 . ? 19.791 26.449 16.947 1.00 12.61 ? 200 REA A C18 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1913 >_refine.B_iso_mean 16.6 >HETATM 1110 C C19 . REA B 2 . ? 24.181 26.841 20.385 1.00 10.08 ? 200 REA A C19 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1914 >_refine.aniso_B[1][1] ? >HETATM 1111 C C20 . REA B 2 . ? 24.303 23.747 24.489 1.00 10.10 ? 200 REA A C20 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1915 >_refine.aniso_B[2][2] ? >HETATM 1112 O O1 . REA B 2 . ? 23.640 21.075 25.978 1.00 13.29 ? 200 REA A O1 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1916 >_refine.aniso_B[3][3] ? >HETATM 1113 O O2 . REA B 2 . ? 21.840 21.712 27.037 1.00 10.99 ? 200 REA A O2 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1917 >_refine.aniso_B[1][2] ? >HETATM 1114 O O . HOH C 3 . ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1918 >_refine.aniso_B[1][3] ? >HETATM 1115 O O . HOH C 3 . ? 7.617 26.892 37.107 1.00 12.66 ? 301 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1919 >_refine.aniso_B[2][3] ? >HETATM 1116 O O . HOH C 3 . ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1920 >_refine.solvent_model_details ? >HETATM 1117 O O . HOH C 3 . ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1921 >_refine.solvent_model_param_ksol ? >HETATM 1118 O O . HOH C 3 . ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1922 >_refine.solvent_model_param_bsol ? >HETATM 1119 O O . HOH C 3 . ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1923 >_refine.pdbx_ls_cross_valid_method ? >HETATM 1120 O O . HOH C 3 . ? 19.459 26.601 30.320 1.00 9.81 ? 306 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1924 >_refine.details ? >HETATM 1121 O O . HOH C 3 . ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1925 >_refine.pdbx_starting_model ? >HETATM 1122 O O . HOH C 3 . ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1926 >_refine.pdbx_method_to_determine_struct ? >HETATM 1123 O O . HOH C 3 . ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1927 >_refine.pdbx_isotropic_thermal_model ? >HETATM 1124 O O . HOH C 3 . ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1928 >_refine.pdbx_stereochemistry_target_values ? >HETATM 1125 O O . HOH C 3 . ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1929 >_refine.pdbx_stereochem_target_val_spec_case ? >HETATM 1126 O O . HOH C 3 . ? 7.344 23.059 35.600 1.00 8.82 ? 312 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1930 >_refine.pdbx_R_Free_selection_details ? >HETATM 1127 O O . HOH C 3 . ? 6.876 22.668 20.375 1.00 29.74 ? 313 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1931 >_refine.pdbx_overall_ESU_R ? >HETATM 1128 O O . HOH C 3 . ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1932 >_refine.pdbx_overall_ESU_R_Free ? >HETATM 1129 O O . HOH C 3 . ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1933 >_refine.overall_SU_ML ? >HETATM 1130 O O . HOH C 3 . ? 28.721 7.425 30.043 1.00 14.94 ? 316 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1934 >_refine.overall_SU_B ? >HETATM 1131 O O . HOH C 3 . ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1935 >_refine.pdbx_refine_id 'X-RAY DIFFRACTION' >HETATM 1132 O O . HOH C 3 . ? 6.094 9.777 39.151 1.00 13.98 ? 318 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1936 >_refine.pdbx_diffrn_id 1 >HETATM 1133 O O . HOH C 3 . ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1937 >_refine.pdbx_TLS_residual_ADP_flag ? >HETATM 1134 O O . HOH C 3 . ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1938 >_refine.correlation_coeff_Fo_to_Fc ? >HETATM 1135 O O . HOH C 3 . ? 25.244 34.269 18.193 1.00 9.65 ? 321 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1939 >_refine.correlation_coeff_Fo_to_Fc_free ? >HETATM 1136 O O . HOH C 3 . ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1940 >_refine.pdbx_solvent_vdw_probe_radii ? >HETATM 1137 O O . HOH C 3 . ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1941 >_refine.pdbx_solvent_ion_probe_radii ? >HETATM 1138 O O . HOH C 3 . ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1942 >_refine.pdbx_solvent_shrinkage_radii ? >HETATM 1139 O O . HOH C 3 . ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1943 >_refine.pdbx_overall_phase_error ? >HETATM 1140 O O . HOH C 3 . ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1944 >_refine.overall_SU_R_Cruickshank_DPI ? >HETATM 1141 O O . HOH C 3 . ? 4.514 21.426 18.685 1.00 45.94 ? 327 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1945 >_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? >HETATM 1142 O O . HOH C 3 . ? 8.081 23.201 17.690 1.00 30.16 ? 328 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1946 >_refine.pdbx_overall_SU_R_Blow_DPI ? >HETATM 1143 O O . HOH C 3 . ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1947 >_refine.pdbx_overall_SU_R_free_Blow_DPI ? >HETATM 1144 O O . HOH C 3 . ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1948 ># >HETATM 1145 O O . HOH C 3 . ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1949 >_reflns.entry_id 1CBS >HETATM 1146 O O . HOH C 3 . ? 5.189 16.418 31.375 1.00 35.78 ? 332 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1950 >_reflns.observed_criterion_sigma_I 3. >HETATM 1147 O O . HOH C 3 . ? 0.738 25.633 36.349 1.00 29.00 ? 333 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1951 >_reflns.observed_criterion_sigma_F ? >HETATM 1148 O O . HOH C 3 . ? 2.976 28.966 37.321 1.00 40.14 ? 334 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1952 >_reflns.d_resolution_low ? >HETATM 1149 O O . HOH C 3 . ? 6.424 28.750 38.849 1.00 32.17 ? 335 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1953 >_reflns.d_resolution_high ? >HETATM 1150 O O . HOH C 3 . ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1954 >_reflns.number_obs 14678 >HETATM 1151 O O . HOH C 3 . ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1955 >_reflns.number_all ? >HETATM 1152 O O . HOH C 3 . ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1956 >_reflns.percent_possible_obs 90.3 >HETATM 1153 O O . HOH C 3 . ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1957 >_reflns.pdbx_Rmerge_I_obs ? >HETATM 1154 O O . HOH C 3 . ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1958 >_reflns.pdbx_Rsym_value ? >HETATM 1155 O O . HOH C 3 . ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1959 >_reflns.pdbx_netI_over_sigmaI ? >HETATM 1156 O O . HOH C 3 . ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1960 >_reflns.B_iso_Wilson_estimate ? >HETATM 1157 O O . HOH C 3 . ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1961 >_reflns.pdbx_redundancy ? >HETATM 1158 O O . HOH C 3 . ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1962 >_reflns.pdbx_diffrn_id 1 >HETATM 1159 O O . HOH C 3 . ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1963 >_reflns.pdbx_ordinal 1 >HETATM 1160 O O . HOH C 3 . ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1964 ># >HETATM 1161 O O . HOH C 3 . ? 3.502 22.911 43.083 1.00 30.15 ? 347 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1965 >_diffrn_radiation_wavelength.id 1 >HETATM 1162 O O . HOH C 3 . ? 20.610 7.668 40.212 1.00 49.06 ? 348 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1966 >_diffrn_radiation_wavelength.wavelength . >HETATM 1163 O O . HOH C 3 . ? 24.813 2.899 36.403 1.00 48.98 ? 349 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1967 >_diffrn_radiation_wavelength.wt 1.0 >HETATM 1164 O O . HOH C 3 . ? 29.900 5.163 26.918 1.00 23.60 ? 350 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1968 ># >HETATM 1165 O O . HOH C 3 . ? 14.333 5.466 42.757 1.00 22.90 ? 351 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1969 >_diffrn_radiation.diffrn_id 1 >HETATM 1166 O O . HOH C 3 . ? 8.914 5.771 35.515 1.00 35.92 ? 352 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1970 >_diffrn_radiation.wavelength_id 1 >HETATM 1167 O O . HOH C 3 . ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1971 >_diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? >HETATM 1168 O O . HOH C 3 . ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1972 >_diffrn_radiation.monochromator ? >HETATM 1169 O O . HOH C 3 . ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1973 >_diffrn_radiation.pdbx_diffrn_protocol ? >HETATM 1170 O O . HOH C 3 . ? 12.491 24.840 7.594 1.00 39.45 ? 356 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1974 >_diffrn_radiation.pdbx_scattering_type x-ray >HETATM 1171 O O . HOH C 3 . ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1975 ># >HETATM 1172 O O . HOH C 3 . ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1976 >_diffrn.id 1 >HETATM 1173 O O . HOH C 3 . ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1977 >_diffrn.ambient_temp ? >HETATM 1174 O O . HOH C 3 . ? 11.358 8.880 19.119 1.00 24.31 ? 360 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1978 >_diffrn.ambient_temp_details ? >HETATM 1175 O O . HOH C 3 . ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1979 >_diffrn.crystal_id 1 >HETATM 1176 O O . HOH C 3 . ? 22.049 27.870 4.565 1.00 25.37 ? 362 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1980 ># >HETATM 1177 O O . HOH C 3 . ? 11.533 6.689 34.501 1.00 29.92 ? 363 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1981 >_exptl_crystal.id 1 >HETATM 1178 O O . HOH C 3 . ? 13.269 4.551 36.338 1.00 45.75 ? 364 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1982 >_exptl_crystal.density_meas ? >HETATM 1179 O O . HOH C 3 . ? 23.149 9.493 41.173 1.00 30.10 ? 365 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1983 >_exptl_crystal.density_Matthews 2.70 >HETATM 1180 O O . HOH C 3 . ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1984 >_exptl_crystal.density_percent_sol 54.49 >HETATM 1181 O O . HOH C 3 . ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1985 >_exptl_crystal.description ? >HETATM 1182 O O . HOH C 3 . ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1986 ># >HETATM 1183 O O . HOH C 3 . ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1987 >_exptl.entry_id 1CBS >HETATM 1184 O O . HOH C 3 . ? 31.928 9.444 23.294 1.00 46.07 ? 370 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1988 >_exptl.method 'X-RAY DIFFRACTION' >HETATM 1185 O O . HOH C 3 . ? 25.699 10.933 9.557 1.00 44.12 ? 371 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1989 >_exptl.crystals_number ? >HETATM 1186 O O . HOH C 3 . ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1990 ># >HETATM 1187 O O . HOH C 3 . ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1991 >loop_ >HETATM 1188 O O . HOH C 3 . ? 20.596 32.070 6.807 1.00 36.38 ? 374 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1992 >_chem_comp.id >HETATM 1189 O O . HOH C 3 . ? 17.126 28.421 9.515 1.00 23.81 ? 375 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1993 >_chem_comp.type >HETATM 1190 O O . HOH C 3 . ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1994 >_chem_comp.mon_nstd_flag >HETATM 1191 O O . HOH C 3 . ? 6.046 30.510 19.639 1.00 29.02 ? 377 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1995 >_chem_comp.name >HETATM 1192 O O . HOH C 3 . ? 9.543 16.072 11.145 1.00 50.91 ? 378 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1996 >_chem_comp.pdbx_synonyms >HETATM 1193 O O . HOH C 3 . ? 8.174 14.289 20.240 1.00 54.21 ? 379 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1997 >_chem_comp.formula >HETATM 1194 O O . HOH C 3 . ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1998 >_chem_comp.formula_weight >HETATM 1195 O O . HOH C 3 . ? 5.486 15.385 24.922 1.00 50.19 ? 381 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >1999 >ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 >HETATM 1196 O O . HOH C 3 . ? 6.038 21.424 43.276 1.00 46.64 ? 382 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2000 >ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 >HETATM 1197 O O . HOH C 3 . ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2001 >ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 >HETATM 1198 O O . HOH C 3 . ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2002 >ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 >HETATM 1199 O O . HOH C 3 . ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2003 >CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 >HETATM 1200 O O . HOH C 3 . ? 31.446 7.504 31.389 1.00 28.93 ? 386 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2004 >GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 >HETATM 1201 O O . HOH C 3 . ? 18.212 20.893 5.892 1.00 29.90 ? 387 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2005 >GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 >HETATM 1202 O O . HOH C 3 . ? 15.148 27.608 7.685 1.00 30.91 ? 388 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2006 >GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 >HETATM 1203 O O . HOH C 3 . ? 2.656 23.148 20.117 1.00 35.98 ? 389 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2007 >HOH non-polymer . WATER ? 'H2 O' 18.015 >HETATM 1204 O O . HOH C 3 . ? 3.100 22.690 28.640 1.00 31.31 ? 390 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2008 >ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 >HETATM 1205 O O . HOH C 3 . ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2009 >LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 >HETATM 1206 O O . HOH C 3 . ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2010 >LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 >HETATM 1207 O O . HOH C 3 . ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2011 >MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 >HETATM 1208 O O . HOH C 3 . ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2012 >PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 >HETATM 1209 O O . HOH C 3 . ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2013 >PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 >HETATM 1210 O O . HOH C 3 . ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2014 >REA non-polymer . 'RETINOIC ACID' ? 'C20 H28 O2' 300.435 >HETATM 1211 O O . HOH C 3 . ? 1.988 27.992 43.589 1.00 33.97 ? 397 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2015 >SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 >HETATM 1212 O O . HOH C 3 . ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2016 >THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 >HETATM 1213 O O . HOH C 3 . ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2017 >TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2018 >TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2019 >VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 >_pdbx_poly_seq_scheme.asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2020 ># >_pdbx_poly_seq_scheme.entity_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2021 >_struct_ref_seq.align_id 1 >_pdbx_poly_seq_scheme.seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2022 >_struct_ref_seq.ref_id 1 >_pdbx_poly_seq_scheme.mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2023 >_struct_ref_seq.pdbx_PDB_id_code 1CBS >_pdbx_poly_seq_scheme.ndb_seq_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2024 >_struct_ref_seq.pdbx_strand_id A >_pdbx_poly_seq_scheme.pdb_seq_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2025 >_struct_ref_seq.seq_align_beg 1 >_pdbx_poly_seq_scheme.auth_seq_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2026 >_struct_ref_seq.pdbx_seq_align_beg_ins_code ? >_pdbx_poly_seq_scheme.pdb_mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2027 >_struct_ref_seq.seq_align_end 137 >_pdbx_poly_seq_scheme.auth_mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2028 >_struct_ref_seq.pdbx_seq_align_end_ins_code ? >_pdbx_poly_seq_scheme.pdb_strand_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2029 >_struct_ref_seq.pdbx_db_accession P29373 >_pdbx_poly_seq_scheme.pdb_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2030 >_struct_ref_seq.db_align_beg 1 >_pdbx_poly_seq_scheme.hetero >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2031 >_struct_ref_seq.pdbx_db_align_beg_ins_code ? >A 1 1 PRO 1 1 1 PRO PRO A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2032 >_struct_ref_seq.db_align_end 137 >A 1 2 ASN 2 2 2 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2033 >_struct_ref_seq.pdbx_db_align_end_ins_code ? >A 1 3 PHE 3 3 3 PHE PHE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2034 >_struct_ref_seq.pdbx_auth_seq_align_beg 1 >A 1 4 SER 4 4 4 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2035 >_struct_ref_seq.pdbx_auth_seq_align_end 137 >A 1 5 GLY 5 5 5 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2036 ># >A 1 6 ASN 6 6 6 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2037 >_struct_ref.id 1 >A 1 7 TRP 7 7 7 TRP TRP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2038 >_struct_ref.db_name UNP >A 1 8 LYS 8 8 8 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2039 >_struct_ref.db_code RABP2_HUMAN >A 1 9 ILE 9 9 9 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2040 >_struct_ref.entity_id 1 >A 1 10 ILE 10 10 10 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2041 >_struct_ref.pdbx_db_accession P29373 >A 1 11 ARG 11 11 11 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2042 >_struct_ref.pdbx_align_begin 1 >A 1 12 SER 12 12 12 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2043 >_struct_ref.pdbx_seq_one_letter_code >A 1 13 GLU 13 13 13 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2044 >;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP >A 1 14 ASN 14 14 14 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2045 >CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE >A 1 15 PHE 15 15 15 PHE PHE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2046 >; >A 1 16 GLU 16 16 16 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2047 >_struct_ref.pdbx_db_isoform ? >A 1 17 GLU 17 17 17 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2048 ># >A 1 18 LEU 18 18 18 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2049 >_entity_src_gen.entity_id 1 >A 1 19 LEU 19 19 19 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2050 >_entity_src_gen.pdbx_src_id 1 >A 1 20 LYS 20 20 20 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2051 >_entity_src_gen.pdbx_alt_source_flag sample >A 1 21 VAL 21 21 21 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2052 >_entity_src_gen.pdbx_seq_type ? >A 1 22 LEU 22 22 22 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2053 >_entity_src_gen.pdbx_beg_seq_num ? >A 1 23 GLY 23 23 23 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2054 >_entity_src_gen.pdbx_end_seq_num ? >A 1 24 VAL 24 24 24 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2055 >_entity_src_gen.gene_src_common_name human >A 1 25 ASN 25 25 25 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2056 >_entity_src_gen.gene_src_genus Homo >A 1 26 VAL 26 26 26 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2057 >_entity_src_gen.pdbx_gene_src_gene 'HUMAN CRABP-II' >A 1 27 MET 27 27 27 MET MET A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2058 >_entity_src_gen.gene_src_species ? >A 1 28 LEU 28 28 28 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2059 >_entity_src_gen.gene_src_strain ? >A 1 29 ARG 29 29 29 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2060 >_entity_src_gen.gene_src_tissue ? >A 1 30 LYS 30 30 30 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2061 >_entity_src_gen.gene_src_tissue_fraction ? >A 1 31 ILE 31 31 31 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2062 >_entity_src_gen.gene_src_details ? >A 1 32 ALA 32 32 32 ALA ALA A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2063 >_entity_src_gen.pdbx_gene_src_fragment ? >A 1 33 VAL 33 33 33 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2064 >_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' >A 1 34 ALA 34 34 34 ALA ALA A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2065 >_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 >A 1 35 ALA 35 35 35 ALA ALA A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2066 >_entity_src_gen.pdbx_gene_src_variant ? >A 1 36 ALA 36 36 36 ALA ALA A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2067 >_entity_src_gen.pdbx_gene_src_cell_line BL21 >A 1 37 SER 37 37 37 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2068 >_entity_src_gen.pdbx_gene_src_atcc ? >A 1 38 LYS 38 38 38 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2069 >_entity_src_gen.pdbx_gene_src_organ ? >A 1 39 PRO 39 39 39 PRO PRO A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2070 >_entity_src_gen.pdbx_gene_src_organelle ? >A 1 40 ALA 40 40 40 ALA ALA A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2071 >_entity_src_gen.pdbx_gene_src_cell ? >A 1 41 VAL 41 41 41 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2072 >_entity_src_gen.pdbx_gene_src_cellular_location ? >A 1 42 GLU 42 42 42 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2073 >_entity_src_gen.host_org_common_name ? >A 1 43 ILE 43 43 43 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2074 >_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' >A 1 44 LYS 44 44 44 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2075 >_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 >A 1 45 GLN 45 45 45 GLN GLN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2076 >_entity_src_gen.host_org_genus Escherichia >A 1 46 GLU 46 46 46 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2077 >_entity_src_gen.pdbx_host_org_gene ? >A 1 47 GLY 47 47 47 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2078 >_entity_src_gen.pdbx_host_org_organ ? >A 1 48 ASP 48 48 48 ASP ASP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2079 >_entity_src_gen.host_org_species 'Escherichia coli' >A 1 49 THR 49 49 49 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2080 >_entity_src_gen.pdbx_host_org_tissue ? >A 1 50 PHE 50 50 50 PHE PHE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2081 >_entity_src_gen.pdbx_host_org_tissue_fraction ? >A 1 51 TYR 51 51 51 TYR TYR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2082 >_entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' >A 1 52 ILE 52 52 52 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2083 >_entity_src_gen.pdbx_host_org_variant ? >A 1 53 LYS 53 53 53 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2084 >_entity_src_gen.pdbx_host_org_cell_line ? >A 1 54 THR 54 54 54 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2085 >_entity_src_gen.pdbx_host_org_atcc ? >A 1 55 SER 55 55 55 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2086 >_entity_src_gen.pdbx_host_org_culture_collection ? >A 1 56 THR 56 56 56 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2087 >_entity_src_gen.pdbx_host_org_cell ? >A 1 57 THR 57 57 57 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2088 >_entity_src_gen.pdbx_host_org_organelle ? >A 1 58 VAL 58 58 58 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2089 >_entity_src_gen.pdbx_host_org_cellular_location ? >A 1 59 ARG 59 59 59 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2090 >_entity_src_gen.pdbx_host_org_vector_type ? >A 1 60 THR 60 60 60 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2091 >_entity_src_gen.pdbx_host_org_vector ? >A 1 61 THR 61 61 61 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2092 >_entity_src_gen.host_org_details ? >A 1 62 GLU 62 62 62 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2093 >_entity_src_gen.expression_system_id ? >A 1 63 ILE 63 63 63 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2094 >_entity_src_gen.plasmid_name PET-3A >A 1 64 ASN 64 64 64 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2095 >_entity_src_gen.plasmid_details ? >A 1 65 PHE 65 65 65 PHE PHE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2096 >_entity_src_gen.pdbx_description ? >A 1 66 LYS 66 66 66 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2097 ># >A 1 67 VAL 67 67 67 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2098 >loop_ >A 1 68 GLY 68 68 68 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2099 >_entity_poly_seq.entity_id >A 1 69 GLU 69 69 69 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2100 >_entity_poly_seq.num >A 1 70 GLU 70 70 70 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2101 >_entity_poly_seq.mon_id >A 1 71 PHE 71 71 71 PHE PHE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2102 >_entity_poly_seq.hetero >A 1 72 GLU 72 72 72 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2103 >1 1 PRO n >A 1 73 GLU 73 73 73 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2104 >1 2 ASN n >A 1 74 GLN 74 74 74 GLN GLN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2105 >1 3 PHE n >A 1 75 THR 75 75 75 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2106 >1 4 SER n >A 1 76 VAL 76 76 76 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2107 >1 5 GLY n >A 1 77 ASP 77 77 77 ASP ASP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2108 >1 6 ASN n >A 1 78 GLY 78 78 78 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2109 >1 7 TRP n >A 1 79 ARG 79 79 79 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2110 >1 8 LYS n >A 1 80 PRO 80 80 80 PRO PRO A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2111 >1 9 ILE n >A 1 81 CYS 81 81 81 CYS CYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2112 >1 10 ILE n >A 1 82 LYS 82 82 82 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2113 >1 11 ARG n >A 1 83 SER 83 83 83 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2114 >1 12 SER n >A 1 84 LEU 84 84 84 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2115 >1 13 GLU n >A 1 85 VAL 85 85 85 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2116 >1 14 ASN n >A 1 86 LYS 86 86 86 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2117 >1 15 PHE n >A 1 87 TRP 87 87 87 TRP TRP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2118 >1 16 GLU n >A 1 88 GLU 88 88 88 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2119 >1 17 GLU n >A 1 89 SER 89 89 89 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2120 >1 18 LEU n >A 1 90 GLU 90 90 90 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2121 >1 19 LEU n >A 1 91 ASN 91 91 91 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2122 >1 20 LYS n >A 1 92 LYS 92 92 92 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2123 >1 21 VAL n >A 1 93 MET 93 93 93 MET MET A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2124 >1 22 LEU n >A 1 94 VAL 94 94 94 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2125 >1 23 GLY n >A 1 95 CYS 95 95 95 CYS CYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2126 >1 24 VAL n >A 1 96 GLU 96 96 96 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2127 >1 25 ASN n >A 1 97 GLN 97 97 97 GLN GLN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2128 >1 26 VAL n >A 1 98 LYS 98 98 98 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2129 >1 27 MET n >A 1 99 LEU 99 99 99 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2130 >1 28 LEU n >A 1 100 LEU 100 100 100 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2131 >1 29 ARG n >A 1 101 LYS 101 101 101 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2132 >1 30 LYS n >A 1 102 GLY 102 102 102 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2133 >1 31 ILE n >A 1 103 GLU 103 103 103 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2134 >1 32 ALA n >A 1 104 GLY 104 104 104 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2135 >1 33 VAL n >A 1 105 PRO 105 105 105 PRO PRO A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2136 >1 34 ALA n >A 1 106 LYS 106 106 106 LYS LYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2137 >1 35 ALA n >A 1 107 THR 107 107 107 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2138 >1 36 ALA n >A 1 108 SER 108 108 108 SER SER A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2139 >1 37 SER n >A 1 109 TRP 109 109 109 TRP TRP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2140 >1 38 LYS n >A 1 110 THR 110 110 110 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2141 >1 39 PRO n >A 1 111 ARG 111 111 111 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2142 >1 40 ALA n >A 1 112 GLU 112 112 112 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2143 >1 41 VAL n >A 1 113 LEU 113 113 113 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2144 >1 42 GLU n >A 1 114 THR 114 114 114 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2145 >1 43 ILE n >A 1 115 ASN 115 115 115 ASN ASN A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2146 >1 44 LYS n >A 1 116 ASP 116 116 116 ASP ASP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2147 >1 45 GLN n >A 1 117 GLY 117 117 117 GLY GLY A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2148 >1 46 GLU n >A 1 118 GLU 118 118 118 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2149 >1 47 GLY n >A 1 119 LEU 119 119 119 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2150 >1 48 ASP n >A 1 120 ILE 120 120 120 ILE ILE A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2151 >1 49 THR n >A 1 121 LEU 121 121 121 LEU LEU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2152 >1 50 PHE n >A 1 122 THR 122 122 122 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2153 >1 51 TYR n >A 1 123 MET 123 123 123 MET MET A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2154 >1 52 ILE n >A 1 124 THR 124 124 124 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2155 >1 53 LYS n >A 1 125 ALA 125 125 125 ALA ALA A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2156 >1 54 THR n >A 1 126 ASP 126 126 126 ASP ASP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2157 >1 55 SER n >A 1 127 ASP 127 127 127 ASP ASP A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2158 >1 56 THR n >A 1 128 VAL 128 128 128 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2159 >1 57 THR n >A 1 129 VAL 129 129 129 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2160 >1 58 VAL n >A 1 130 CYS 130 130 130 CYS CYS A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2161 >1 59 ARG n >A 1 131 THR 131 131 131 THR THR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2162 >1 60 THR n >A 1 132 ARG 132 132 132 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2163 >1 61 THR n >A 1 133 VAL 133 133 133 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2164 >1 62 GLU n >A 1 134 TYR 134 134 134 TYR TYR A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2165 >1 63 ILE n >A 1 135 VAL 135 135 135 VAL VAL A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2166 >1 64 ASN n >A 1 136 ARG 136 136 136 ARG ARG A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2167 >1 65 PHE n >A 1 137 GLU 137 137 137 GLU GLU A . n >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2168 >1 66 LYS n ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2169 >1 67 VAL n >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2170 >1 68 GLY n >_pdbx_nonpoly_scheme.asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2171 >1 69 GLU n >_pdbx_nonpoly_scheme.entity_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2172 >1 70 GLU n >_pdbx_nonpoly_scheme.mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2173 >1 71 PHE n >_pdbx_nonpoly_scheme.ndb_seq_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2174 >1 72 GLU n >_pdbx_nonpoly_scheme.pdb_seq_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2175 >1 73 GLU n >_pdbx_nonpoly_scheme.auth_seq_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2176 >1 74 GLN n >_pdbx_nonpoly_scheme.pdb_mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2177 >1 75 THR n >_pdbx_nonpoly_scheme.auth_mon_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2178 >1 76 VAL n >_pdbx_nonpoly_scheme.pdb_strand_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2179 >1 77 ASP n >_pdbx_nonpoly_scheme.pdb_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2180 >1 78 GLY n >B 2 REA 1 200 200 REA REA A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2181 >1 79 ARG n >C 3 HOH 1 300 300 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2182 >1 80 PRO n >C 3 HOH 2 301 301 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2183 >1 81 CYS n >C 3 HOH 3 302 302 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2184 >1 82 LYS n >C 3 HOH 4 303 303 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2185 >1 83 SER n >C 3 HOH 5 304 304 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2186 >1 84 LEU n >C 3 HOH 6 305 305 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2187 >1 85 VAL n >C 3 HOH 7 306 306 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2188 >1 86 LYS n >C 3 HOH 8 307 307 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2189 >1 87 TRP n >C 3 HOH 9 308 308 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2190 >1 88 GLU n >C 3 HOH 10 309 309 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2191 >1 89 SER n >C 3 HOH 11 310 310 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2192 >1 90 GLU n >C 3 HOH 12 311 311 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2193 >1 91 ASN n >C 3 HOH 13 312 312 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2194 >1 92 LYS n >C 3 HOH 14 313 313 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2195 >1 93 MET n >C 3 HOH 15 314 314 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2196 >1 94 VAL n >C 3 HOH 16 315 315 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2197 >1 95 CYS n >C 3 HOH 17 316 316 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2198 >1 96 GLU n >C 3 HOH 18 317 317 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2199 >1 97 GLN n >C 3 HOH 19 318 318 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2200 >1 98 LYS n >C 3 HOH 20 319 319 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2201 >1 99 LEU n >C 3 HOH 21 320 320 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2202 >1 100 LEU n >C 3 HOH 22 321 321 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2203 >1 101 LYS n >C 3 HOH 23 322 322 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2204 >1 102 GLY n >C 3 HOH 24 323 323 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2205 >1 103 GLU n >C 3 HOH 25 324 324 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2206 >1 104 GLY n >C 3 HOH 26 325 325 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2207 >1 105 PRO n >C 3 HOH 27 326 326 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2208 >1 106 LYS n >C 3 HOH 28 327 327 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2209 >1 107 THR n >C 3 HOH 29 328 328 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2210 >1 108 SER n >C 3 HOH 30 329 329 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2211 >1 109 TRP n >C 3 HOH 31 330 330 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2212 >1 110 THR n >C 3 HOH 32 331 331 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2213 >1 111 ARG n >C 3 HOH 33 332 332 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2214 >1 112 GLU n >C 3 HOH 34 333 333 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2215 >1 113 LEU n >C 3 HOH 35 334 334 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2216 >1 114 THR n >C 3 HOH 36 335 335 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2217 >1 115 ASN n >C 3 HOH 37 336 336 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2218 >1 116 ASP n >C 3 HOH 38 337 337 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2219 >1 117 GLY n >C 3 HOH 39 338 338 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2220 >1 118 GLU n >C 3 HOH 40 339 339 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2221 >1 119 LEU n >C 3 HOH 41 340 340 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2222 >1 120 ILE n >C 3 HOH 42 341 341 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2223 >1 121 LEU n >C 3 HOH 43 342 342 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2224 >1 122 THR n >C 3 HOH 44 343 343 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2225 >1 123 MET n >C 3 HOH 45 344 344 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2226 >1 124 THR n >C 3 HOH 46 345 345 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2227 >1 125 ALA n >C 3 HOH 47 346 346 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2228 >1 126 ASP n >C 3 HOH 48 347 347 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2229 >1 127 ASP n >C 3 HOH 49 348 348 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2230 >1 128 VAL n >C 3 HOH 50 349 349 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2231 >1 129 VAL n >C 3 HOH 51 350 350 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2232 >1 130 CYS n >C 3 HOH 52 351 351 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2233 >1 131 THR n >C 3 HOH 53 352 352 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2234 >1 132 ARG n >C 3 HOH 54 353 353 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2235 >1 133 VAL n >C 3 HOH 55 354 354 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2236 >1 134 TYR n >C 3 HOH 56 355 355 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2237 >1 135 VAL n >C 3 HOH 57 356 356 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2238 >1 136 ARG n >C 3 HOH 58 357 357 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2239 >1 137 GLU n >C 3 HOH 59 358 358 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2240 ># >C 3 HOH 60 359 359 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2241 >_entity_poly.entity_id 1 >C 3 HOH 61 360 360 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2242 >_entity_poly.type polypeptide(L) >C 3 HOH 62 361 361 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2243 >_entity_poly.nstd_linkage no >C 3 HOH 63 362 362 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2244 >_entity_poly.nstd_monomer no >C 3 HOH 64 363 363 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2245 >_entity_poly.pdbx_seq_one_letter_code >C 3 HOH 65 364 364 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2246 >;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP >C 3 HOH 66 365 365 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2247 >CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE >C 3 HOH 67 366 366 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2248 >; >C 3 HOH 68 367 367 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2249 >_entity_poly.pdbx_seq_one_letter_code_can >C 3 HOH 69 368 368 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2250 >;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP >C 3 HOH 70 369 369 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2251 >CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE >C 3 HOH 71 370 370 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2252 >; >C 3 HOH 72 371 371 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2253 >_entity_poly.pdbx_strand_id A >C 3 HOH 73 372 372 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2254 >_entity_poly.pdbx_target_identifier ? >C 3 HOH 74 373 373 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2255 ># >C 3 HOH 75 374 374 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2256 >loop_ >C 3 HOH 76 375 375 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2257 >_entity.id >C 3 HOH 77 376 376 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2258 >_entity.type >C 3 HOH 78 377 377 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2259 >_entity.src_method >C 3 HOH 79 378 378 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2260 >_entity.pdbx_description >C 3 HOH 80 379 379 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2261 >_entity.formula_weight >C 3 HOH 81 380 380 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2262 >_entity.pdbx_number_of_molecules >C 3 HOH 82 381 381 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2263 >_entity.pdbx_ec >C 3 HOH 83 382 382 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2264 >_entity.pdbx_mutation >C 3 HOH 84 383 383 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2265 >_entity.pdbx_fragment >C 3 HOH 85 384 384 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2266 >_entity.details >C 3 HOH 86 385 385 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2267 >1 polymer man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1 ? ? ? ? >C 3 HOH 87 386 386 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2268 >2 non-polymer syn 'RETINOIC ACID' 300.435 1 ? ? ? ? >C 3 HOH 88 387 387 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2269 >3 water nat water 18.015 100 ? ? ? ? >C 3 HOH 89 388 388 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2270 ># >C 3 HOH 90 389 389 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2271 >_symmetry.entry_id 1CBS >C 3 HOH 91 390 390 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2272 >_symmetry.space_group_name_H-M 'P 21 21 21' >C 3 HOH 92 391 391 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2273 >_symmetry.pdbx_full_space_group_name_H-M ? >C 3 HOH 93 392 392 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2274 >_symmetry.cell_setting ? >C 3 HOH 94 393 393 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2275 >_symmetry.Int_Tables_number 19 >C 3 HOH 95 394 394 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2276 ># >C 3 HOH 96 395 395 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2277 >_cell.entry_id 1CBS >C 3 HOH 97 396 396 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2278 >_cell.length_a 45.650 >C 3 HOH 98 397 397 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2279 >_cell.length_b 47.560 >C 3 HOH 99 398 398 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2280 >_cell.length_c 77.610 >C 3 HOH 100 399 399 HOH HOH A . >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2281 >_cell.angle_alpha 90.00 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2282 >_cell.angle_beta 90.00 >_pdbx_struct_assembly.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2283 >_cell.angle_gamma 90.00 >_pdbx_struct_assembly.details author_defined_assembly >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2284 >_cell.Z_PDB 4 >_pdbx_struct_assembly.method_details ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2285 >_cell.pdbx_unique_axis ? >_pdbx_struct_assembly.oligomeric_details monomeric >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2286 ># >_pdbx_struct_assembly.oligomeric_count 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2287 >loop_ ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2288 >_citation_author.citation_id >_pdbx_struct_assembly_gen.assembly_id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2289 >_citation_author.name >_pdbx_struct_assembly_gen.oper_expression 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2290 >_citation_author.ordinal >_pdbx_struct_assembly_gen.asym_id_list A,B,C >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2291 >primary 'Kleywegt, G.J.' 1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2292 >primary 'Bergfors, T.' 2 >_pdbx_struct_oper_list.id 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2293 >primary 'Senn, H.' 3 >_pdbx_struct_oper_list.type 'identity operation' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2294 >primary 'Le Motte, P.' 4 >_pdbx_struct_oper_list.name 1_555 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2295 >primary 'Gsell, B.' 5 >_pdbx_struct_oper_list.symmetry_operation x,y,z >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2296 >primary 'Shudo, K.' 6 >_pdbx_struct_oper_list.matrix[1][1] 1.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2297 >primary 'Jones, T.A.' 7 >_pdbx_struct_oper_list.matrix[1][2] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2298 >1 'Banaszak, L.' 8 >_pdbx_struct_oper_list.matrix[1][3] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2299 >1 'Winter, N.' 9 >_pdbx_struct_oper_list.vector[1] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2300 >1 'Xu, Z.' 10 >_pdbx_struct_oper_list.matrix[2][1] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2301 >1 'Bernlohr, D.A.' 11 >_pdbx_struct_oper_list.matrix[2][2] 1.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2302 >1 'Cowan, S.W.' 12 >_pdbx_struct_oper_list.matrix[2][3] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2303 >1 'Jones, T.A.' 13 >_pdbx_struct_oper_list.vector[2] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2304 >2 'Bergfors, T.' 14 >_pdbx_struct_oper_list.matrix[3][1] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2305 >2 'Kleywegt, G.J.' 15 >_pdbx_struct_oper_list.matrix[3][2] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2306 >2 'Jones, T.A.' 16 >_pdbx_struct_oper_list.matrix[3][3] 1.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2307 >3 'Cowan, S.W.' 17 >_pdbx_struct_oper_list.vector[3] 0.0000000000 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2308 >3 'Newcomer, M.E.' 18 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2309 >3 'Jones, T.A.' 19 >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2310 >4 'Jones, T.A.' 20 >_pdbx_audit_revision_history.ordinal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2311 >4 'Bergfors, T.' 21 >_pdbx_audit_revision_history.data_content_type >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2312 >4 'Sedzik, J.' 22 >_pdbx_audit_revision_history.major_revision >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2313 >4 'Unge, T.' 23 >_pdbx_audit_revision_history.minor_revision >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2314 ># >_pdbx_audit_revision_history.revision_date >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2315 >loop_ >1 'Structure model' 1 0 1995-01-26 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2316 >_citation.id >2 'Structure model' 1 1 2008-03-24 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2317 >_citation.title >3 'Structure model' 1 2 2011-07-13 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2318 >_citation.journal_abbrev ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2319 >_citation.journal_volume >_pdbx_audit_revision_details.ordinal 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2320 >_citation.page_first >_pdbx_audit_revision_details.revision_ordinal 1 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2321 >_citation.page_last >_pdbx_audit_revision_details.data_content_type 'Structure model' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2322 >_citation.year >_pdbx_audit_revision_details.provider repository >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2323 >_citation.journal_id_ASTM >_pdbx_audit_revision_details.type 'Initial release' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2324 >_citation.country >_pdbx_audit_revision_details.description ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2325 >_citation.journal_id_ISSN ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2326 >_citation.journal_id_CSD >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2327 >_citation.book_publisher >_pdbx_audit_revision_group.ordinal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2328 >_citation.pdbx_database_id_PubMed >_pdbx_audit_revision_group.revision_ordinal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2329 >_citation.pdbx_database_id_DOI >_pdbx_audit_revision_group.data_content_type >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2330 >primary >_pdbx_audit_revision_group.group >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2331 >;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid. >1 2 'Structure model' 'Version format compliance' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2332 >; >2 3 'Structure model' 'Version format compliance' >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2333 >Structure 2 1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2334 >1 'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins' >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2335 >'Adv.Protein Chem.' 45 89 ? 1994 APCHA2 US 0065-3233 0433 ? ? ? >_software.name >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2336 >2 'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' >_software.classification >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2337 >'Acta Crystallogr.,Sect.D' 50 370 ? 1994 ABCRE6 DK 0907-4449 0766 ? ? ? >_software.version >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2338 >3 >_software.citation_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2339 >;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol >_software.pdbx_ordinal >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2340 >; >_software.date >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2341 >J.Mol.Biol. 230 1225 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? >X-PLOR 'model building' . ? 1 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2342 >4 'The Three-Dimensional Structure of P2 Myelin Protein' >X-PLOR refinement . ? 2 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2343 >'Embo J.' 7 1597 ? 1988 EMJODG UK 0261-4189 0897 ? ? ? >X-PLOR phasing . ? 3 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2344 ># >dssp other ? ? 4 ? >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2345 >loop_ ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2346 >_audit_author.name >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2347 >_audit_author.pdbx_ordinal >_pdbx_validate_torsion.id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2348 >'Kleywegt, G.J.' 1 >_pdbx_validate_torsion.PDB_model_num >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2349 >'Bergfors, T.' 2 >_pdbx_validate_torsion.auth_comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2350 >'Jones, T.A.' 3 >_pdbx_validate_torsion.auth_asym_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2351 ># >_pdbx_validate_torsion.auth_seq_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2352 >_pdbx_database_status.status_code REL >_pdbx_validate_torsion.PDB_ins_code >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2353 >_pdbx_database_status.entry_id 1CBS >_pdbx_validate_torsion.label_alt_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2354 >_pdbx_database_status.recvd_initial_deposition_date 1994-09-28 >_pdbx_validate_torsion.phi >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2355 >_pdbx_database_status.deposit_site ? >_pdbx_validate_torsion.psi >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2356 >_pdbx_database_status.process_site ? >1 1 GLU A 73 ? ? -144.94 -154.28 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2357 >_pdbx_database_status.status_code_sf REL >2 1 ASP A 126 ? ? 55.69 -115.96 >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2358 >_pdbx_database_status.status_code_mr ? ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2359 >_pdbx_database_status.SG_entry ? >loop_ >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2360 >_pdbx_database_status.pdb_format_compatible Y >_pdbx_entity_nonpoly.entity_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2361 >_pdbx_database_status.status_code_cs ? >_pdbx_entity_nonpoly.name >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2362 ># >_pdbx_entity_nonpoly.comp_id >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2363 >loop_ >2 'RETINOIC ACID' REA >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2364 >_database_2.database_id >3 water HOH >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >2365 >_database_2.database_code ># >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(123): [1;31;49merror: in "ut_mmcif": check line_t == line_r has failed[0;39;49m >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(114): [1;31;49merror: in "ut_mmcif": check done_r == done_t has failed [true != false][0;39;49m >/var/tmp/portage/sci-chemistry/dssp-4.0.3/work/dssp-4.0.3/test/unit-test.cpp(126): [1;31;49merror: in "ut_mmcif": check test.eof() has failed[0;39;49m > >[1;31;49m*** 2363 failures are detected in the test module "DSSP_Test" >[0;39;49m ><end of output> >Test time = 0.39 sec >---------------------------------------------------------- >Test Failed. >"unit-test" end time: Mar 10 09:26 CET >"unit-test" time elapsed: 00:00:00 >---------------------------------------------------------- > >End testing: Mar 10 09:26 CET
You cannot view the attachment while viewing its details because your browser does not support IFRAMEs.
View the attachment on a separate page
.
View Attachment As Raw
Actions:
View
Attachments on
bug 834882
: 766725